BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050M04

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628293.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    233   5e-71   Nicotiana tomentosiformis
ref|XP_009787152.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    229   2e-69   Nicotiana sylvestris
ref|XP_004236847.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    218   3e-65   Solanum lycopersicum
ref|XP_006359285.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    218   4e-65   Solanum tuberosum [potatoes]
ref|XP_010319328.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    218   5e-65   Solanum lycopersicum
ref|XP_008455212.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    209   2e-61   Cucumis melo [Oriental melon]
emb|CDO97455.1|  unnamed protein product                                206   2e-60   Coffea canephora [robusta coffee]
ref|XP_011087881.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    203   7e-60   Sesamum indicum [beniseed]
gb|KHG14788.1|  CD2 antigen cytoplasmic tail-binding 2                  198   2e-57   Gossypium arboreum [tree cotton]
ref|XP_004136873.1|  PREDICTED: uncharacterized protein LOC101218985    197   6e-57   Cucumis sativus [cucumbers]
gb|KCW56994.1|  hypothetical protein EUGRSUZ_I026661                    189   2e-56   Eucalyptus grandis [rose gum]
ref|XP_002303188.2|  CD2-binding family protein                         192   2e-55   
ref|XP_010656830.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    192   2e-55   Vitis vinifera
ref|XP_002269975.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    192   3e-55   Vitis vinifera
ref|XP_010030930.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    189   8e-55   Eucalyptus grandis [rose gum]
ref|XP_007042973.1|  CD2-binding protein-related, putative              191   2e-54   
gb|EYU18484.1|  hypothetical protein MIMGU_mgv1a008901mg                186   3e-53   Erythranthe guttata [common monkey flower]
emb|CBI17819.3|  unnamed protein product                                186   6e-53   Vitis vinifera
gb|KJB79663.1|  hypothetical protein B456_013G061400                    185   6e-53   Gossypium raimondii
ref|XP_011004970.1|  PREDICTED: LIN1-like protein                       186   7e-53   Populus euphratica
gb|KDP32429.1|  hypothetical protein JCGZ_13354                         186   1e-52   Jatropha curcas
gb|KJB79662.1|  hypothetical protein B456_013G061400                    184   1e-52   Gossypium raimondii
ref|XP_011002067.1|  PREDICTED: uncharacterized protein LOC105109156    186   2e-52   Populus euphratica
ref|XP_002298200.2|  hypothetical protein POPTR_0001s21330g             184   2e-52   
gb|KHG20831.1|  CD2 antigen cytoplasmic tail-binding 2                  185   2e-52   Gossypium arboreum [tree cotton]
gb|KJB79661.1|  hypothetical protein B456_013G061400                    185   2e-52   Gossypium raimondii
ref|XP_010094166.1|  hypothetical protein L484_017210                   185   3e-52   Morus notabilis
ref|XP_007148416.1|  hypothetical protein PHAVU_006G206700g             181   3e-51   Phaseolus vulgaris [French bean]
ref|XP_008237185.1|  PREDICTED: LIN1-like protein                       182   3e-51   Prunus mume [ume]
ref|XP_007199874.1|  hypothetical protein PRUPE_ppa006084mg             179   7e-50   Prunus persica
ref|XP_002530265.1|  conserved hypothetical protein                     176   1e-49   
ref|XP_004485576.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    172   2e-47   Cicer arietinum [garbanzo]
ref|XP_010268025.1|  PREDICTED: uncharacterized protein LOC104605...    171   3e-47   Nelumbo nucifera [Indian lotus]
gb|KJB31989.1|  hypothetical protein B456_005G2198002                   168   2e-46   Gossypium raimondii
gb|KJB31986.1|  hypothetical protein B456_005G2198002                   169   2e-46   Gossypium raimondii
ref|XP_008373191.1|  PREDICTED: uncharacterized protein LOC103436539    168   6e-46   Malus domestica [apple tree]
gb|KDO47022.1|  hypothetical protein CISIN_1g024218mg                   162   1e-45   Citrus sinensis [apfelsine]
gb|KDO47021.1|  hypothetical protein CISIN_1g024218mg                   162   1e-45   Citrus sinensis [apfelsine]
gb|KDO47020.1|  hypothetical protein CISIN_1g024218mg                   163   2e-45   Citrus sinensis [apfelsine]
gb|KDO47019.1|  hypothetical protein CISIN_1g024218mg                   162   4e-45   Citrus sinensis [apfelsine]
gb|KJB31987.1|  hypothetical protein B456_005G2198002                   164   5e-45   Gossypium raimondii
ref|XP_006464265.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    164   7e-45   Citrus sinensis [apfelsine]
gb|ACU14443.1|  unknown                                                 159   2e-44   Glycine max [soybeans]
ref|XP_003593195.1|  CD2 antigen cytoplasmic tail-binding protein       161   9e-44   Medicago truncatula
ref|XP_003611728.1|  CD2 antigen cytoplasmic tail-binding protein       157   2e-43   
ref|XP_003547624.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    159   8e-43   Glycine max [soybeans]
ref|XP_003531549.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    157   6e-42   Glycine max [soybeans]
ref|XP_006828483.1|  hypothetical protein AMTR_s00060p00158750          157   2e-41   
ref|XP_010546337.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    152   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_006428140.1|  hypothetical protein CICLE_v10025761mg             149   7e-39   
ref|XP_006428141.1|  hypothetical protein CICLE_v10025761mg             148   1e-38   
ref|XP_006428139.1|  hypothetical protein CICLE_v10025761mg             148   2e-38   
ref|XP_010690483.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    145   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008790842.1|  PREDICTED: LIN1-like protein isoform X2            138   8e-35   Phoenix dactylifera
ref|XP_008790841.1|  PREDICTED: LIN1-like protein isoform X1            138   9e-35   Phoenix dactylifera
ref|XP_009381505.1|  PREDICTED: uncharacterized protein LOC103969...    138   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939639.1|  PREDICTED: LIN1-like protein isoform X2            137   3e-34   
ref|XP_010939641.1|  PREDICTED: LIN1-like protein isoform X4            137   3e-34   
ref|XP_010939640.1|  PREDICTED: LIN1-like protein isoform X3            137   3e-34   Elaeis guineensis
ref|XP_010939638.1|  PREDICTED: LIN1-like protein isoform X1            136   7e-34   Elaeis guineensis
gb|EPS61335.1|  hypothetical protein M569_13462                         132   5e-33   Genlisea aurea
ref|XP_009381504.1|  PREDICTED: uncharacterized protein LOC103969...    133   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871367.1|  hypothetical protein ARALYDRAFT_487751             130   3e-32   Arabidopsis lyrata subsp. lyrata
ref|NP_001031859.1|  CD2 antigen cytoplasmic tail-binding protein 2     126   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209261.1|  hypothetical protein PRUPE_ppa007353mg             126   9e-31   
emb|CAC05465.1|  putative protein                                       126   9e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568211.1|  CD2 antigen cytoplasmic tail-binding protein 2        126   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001143950.1|  hypothetical protein                               124   1e-29   Zea mays [maize]
dbj|BAK03908.1|  predicted protein                                      122   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010452927.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    121   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004974125.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    121   9e-29   
ref|XP_004974124.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    121   1e-28   Setaria italica
gb|ACG36671.1|  hypothetical protein                                    121   1e-28   Zea mays [maize]
ref|XP_002460146.1|  hypothetical protein SORBIDRAFT_02g023395          115   3e-28   
ref|XP_006287920.1|  hypothetical protein CARUB_v10001155mg             119   5e-28   
ref|XP_009122513.1|  PREDICTED: protein LIN1                            118   8e-28   Brassica rapa
emb|CDY21579.1|  BnaC09g47130D                                          117   1e-27   Brassica napus [oilseed rape]
ref|XP_008239376.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    118   1e-27   Prunus mume [ume]
ref|XP_008374343.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    117   2e-27   
emb|CDX69908.1|  BnaA10g22570D                                          117   2e-27   
ref|XP_010268033.1|  PREDICTED: LIN1-like protein isoform X2            116   4e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010238121.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    116   6e-27   Brachypodium distachyon [annual false brome]
ref|XP_010238120.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    116   8e-27   Brachypodium distachyon [annual false brome]
ref|XP_004299178.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    115   2e-26   Fragaria vesca subsp. vesca
ref|XP_009333892.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    114   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_008392871.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    112   1e-25   
ref|XP_009359513.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    112   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_006369337.1|  hypothetical protein POPTR_0001s21330g             110   3e-25   
ref|XP_006399414.1|  hypothetical protein EUTSA_v10013574mg             110   6e-25   
gb|EMS65905.1|  hypothetical protein TRIUR3_15046                       109   7e-25   Triticum urartu
gb|EMT23641.1|  hypothetical protein F775_06893                         110   1e-24   
emb|CAN64184.1|  hypothetical protein VITISV_022648                     105   7e-23   Vitis vinifera
gb|KFK25249.1|  hypothetical protein AALP_AA8G087200                    103   1e-22   Arabis alpina [alpine rockcress]
emb|CAN80868.1|  hypothetical protein VITISV_038604                     102   3e-22   Vitis vinifera
ref|XP_003606370.1|  CD2 antigen cytoplasmic tail-binding protein     98.6    7e-22   
ref|XP_006661174.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  99.4    8e-22   
ref|XP_010491564.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...    101   8e-22   Camelina sativa [gold-of-pleasure]
dbj|BAG95087.1|  unnamed protein product                                101   1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08865.1|  hypothetical protein OsI_31127                          101   1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_008651230.1|  PREDICTED: hypothetical protein isoform X1         100   2e-21   Zea mays [maize]
gb|EAZ44513.1|  hypothetical protein OsJ_29131                          100   4e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010422989.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  99.0    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_001780269.1|  predicted protein                                96.3    8e-20   
ref|XP_002964431.1|  hypothetical protein SELMODRAFT_438774           95.1    1e-19   Selaginella moellendorffii
gb|ABR17802.1|  unknown                                               87.0    2e-16   Picea sitchensis
ref|XP_004959414.1|  PREDICTED: pumilio domain-containing protein...  77.0    7e-13   
ref|XP_007023576.1|  Uncharacterized protein TCM_027619               72.0    7e-13   
ref|XP_007028441.1|  Uncharacterized protein TCM_024237               72.0    1e-12   
ref|XP_007032091.1|  Uncharacterized protein TCM_017427               67.4    2e-11   
gb|KIY99068.1|  CD2 antigen cytoplasmic tail-binding protein 2        67.0    2e-10   Monoraphidium neglectum
ref|XP_002949281.1|  hypothetical protein VOLCADRAFT_89573            69.7    3e-10   Volvox carteri f. nagariensis
ref|XP_005849831.1|  hypothetical protein CHLNCDRAFT_142977           65.1    5e-09   Chlorella variabilis
ref|XP_008374380.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  62.8    2e-08   
ref|XP_011401180.1|  hypothetical protein F751_6934                   63.2    2e-08   Auxenochlorella protothecoides
ref|XP_009379748.1|  PREDICTED: uncharacterized protein LOC103968132  57.4    1e-07   
ref|XP_003074380.1|  putative protein (ISS)                           58.9    7e-07   Ostreococcus tauri
ref|XP_005646924.1|  hypothetical protein COCSUDRAFT_56069            58.5    7e-07   Coccomyxa subellipsoidea C-169
ref|XP_004705722.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  58.5    7e-07   Echinops telfairi [lesser hedgehog tenrec]
dbj|BAN21141.1|  aspartyl beta-hydroxylase, putative                  55.8    9e-07   Riptortus pedestris
ref|XP_001692179.1|  hypothetical protein CHLREDRAFT_170950           56.6    1e-06   Chlamydomonas reinhardtii
ref|XP_005852071.1|  hypothetical protein CHLNCDRAFT_133077           57.8    2e-06   Chlorella variabilis
ref|XP_002769875.1|  CD2 antigen cytoplasmic tail-binding protein...  57.4    2e-06   Perkinsus marinus ATCC 50983
ref|XP_007884271.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  57.4    2e-06   Callorhinchus milii [Australian ghost shark]
ref|XP_002165595.2|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  57.0    2e-06   
ref|XP_007107447.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  56.6    3e-06   Physeter catodon
gb|ERG79626.1|  lin1-like protein                                     56.6    3e-06   
ref|XP_002115174.1|  hypothetical protein TRIADDRAFT_28719            56.6    3e-06   Trichoplax adhaerens
ref|XP_003383440.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  56.2    4e-06   Amphimedon queenslandica
ref|XP_007499007.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    5e-06   
ref|XP_007536213.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  56.2    5e-06   Erinaceus europaeus [common hedgehog]
gb|EDM17310.1|  CD2 antigen (cytoplasmic tail) binding protein 2 ...  54.7    5e-06   Rattus norvegicus [brown rat]
ref|XP_006871959.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    5e-06   Chrysochloris asiatica
ref|XP_006914179.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    6e-06   Pteropus alecto
ref|XP_006977123.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    6e-06   Peromyscus maniculatus bairdii
ref|XP_007612402.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    6e-06   
ref|XP_005351339.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    6e-06   Microtus ochrogaster [prairie voles]
ref|XP_007612404.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    6e-06   
ref|XP_007606013.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    6e-06   Cricetulus griseus [Chinese hamsters]
gb|EDL17505.1|  mCG134114, isoform CRA_b                              55.8    6e-06   Mus musculus [mouse]
ref|NP_001099767.1|  CD2 antigen cytoplasmic tail-binding protein 2   55.8    6e-06   Rattus norvegicus [brown rat]
ref|XP_003515745.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    6e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_004692044.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.8    7e-06   Condylura cristata
dbj|BAD32400.1|  mKIAA1178 protein                                    55.5    7e-06   Mus musculus [mouse]
ref|XP_004328717.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    7e-06   
ref|XP_005064429.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    7e-06   Mesocricetus auratus [Syrian golden hamster]
ref|NP_081629.1|  CD2 antigen cytoplasmic tail-binding protein 2      55.5    7e-06   Mus musculus [mouse]
dbj|BAE32530.1|  unnamed protein product                              55.5    7e-06   Mus musculus [mouse]
ref|XP_004671133.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    7e-06   Jaculus jaculus
ref|XP_007186462.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    7e-06   Balaenoptera acutorostrata scammoni
ref|XP_007107443.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    7e-06   Physeter catodon
ref|XP_004268728.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    8e-06   Orcinus orca [Orca]
ref|XP_007452800.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    8e-06   Lipotes vexillifer [baiji]
ref|XP_008151048.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    8e-06   Eptesicus fuscus
ref|XP_008822081.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    9e-06   Nannospalax galili
ref|XP_006103519.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Myotis lucifugus
ref|XP_004586938.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Ochotona princeps [southern American pika]
ref|XP_005405306.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Chinchilla lanigera
ref|XP_006070508.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   
ref|XP_005405305.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Chinchilla lanigera
ref|XP_002951145.1|  hypothetical protein VOLCADRAFT_91665            55.5    1e-05   Volvox carteri f. nagariensis
gb|EHH60310.1|  CD2 antigen cytoplasmic tail-binding protein 2        55.1    1e-05   Macaca fascicularis [crab eating macaque]
ref|XP_003477917.2|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Cavia porcellus [guinea pig]
ref|XP_004479416.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   
ref|XP_005224960.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Bos taurus [bovine]
ref|XP_006070509.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Bubalus bubalis [domestic water buffalo]
ref|XP_010835623.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Bison bison bison
ref|XP_005888877.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Bos mutus
gb|ELR61413.1|  CD2 antigen cytoplasmic tail-binding protein 2        55.1    1e-05   Bos mutus
ref|XP_010835625.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Bison bison bison
ref|XP_001415871.1|  predicted protein                                55.1    1e-05   Ostreococcus lucimarinus CCE9901
ref|XP_005963168.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005007633.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   
ref|XP_003795854.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   
ref|XP_006753014.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Myotis davidii
ref|XP_004020948.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   Ovis aries [domestic sheep]
ref|XP_004902872.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.1    1e-05   
ref|NP_001270359.1|  uncharacterized protein LOC101865010             55.1    1e-05   Macaca fascicularis [crab eating macaque]
ref|XP_010615683.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Fukomys damarensis [Damara mole rat]
ref|XP_005697757.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   
ref|XP_007948423.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Orycteropus afer afer
ref|XP_003918731.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Papio anubis [baboon]
ref|NP_001247625.1|  CD2 antigen cytoplasmic tail-binding protein 2   54.7    1e-05   Macaca mulatta [rhesus macaque]
ref|XP_007988171.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Chlorocebus sabaeus
ref|XP_004773950.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Mustela putorius furo [black ferret]
ref|NP_001077151.1|  CD2 antigen cytoplasmic tail-binding protein 2   54.7    1e-05   Bos taurus [bovine]
ref|XP_005697756.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Capra hircus [domestic goat]
ref|XP_004623024.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Octodon degus
ref|XP_010386147.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Rhinopithecus roxellana
ref|XP_009248910.1|  PREDICTED: LOW QUALITY PROTEIN: CD2 antigen ...  54.7    1e-05   
ref|XP_004902874.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   
ref|XP_003807513.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Pan paniscus [bonobo]
ref|XP_008246967.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Oryctolagus cuniculus [domestic rabbit]
ref|XP_010338989.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Saimiri boliviensis boliviensis
ref|XP_004057546.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_004816876.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   
ref|XP_005648710.1|  hypothetical protein COCSUDRAFT_47170            54.7    1e-05   Coccomyxa subellipsoidea C-169
ref|XP_003280476.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Nomascus leucogenys [White-cheeked Gibbon]
gb|ELT91715.1|  hypothetical protein CAPTEDRAFT_148353                54.7    1e-05   Capitella teleta
ref|XP_008065868.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    1e-05   Carlito syrichta
ref|XP_004615931.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    2e-05   Sorex araneus [Eurasian shrew]
ref|NP_006101.1|  CD2 antigen cytoplasmic tail-binding protein 2      54.7    2e-05   Homo sapiens [man]
ref|XP_004439483.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    2e-05   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001501595.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    2e-05   Equus caballus [domestic horse]
ref|XP_006896590.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.7    2e-05   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_001125729.1|  CD2 antigen cytoplasmic tail-binding protein 2   54.7    2e-05   Pongo abelii [orang utan]
emb|CAH91742.1|  hypothetical protein                                 54.3    2e-05   Pongo abelii [orang utan]
ref|XP_003998707.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Felis catus [cat]
ref|XP_005882088.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Myotis brandtii
ref|XP_006201352.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Vicugna pacos
ref|XP_006181576.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Camelus ferus
ref|XP_002924816.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Ailuropoda melanoleuca
ref|XP_003761631.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Sarcophilus harrisii
ref|XP_003354584.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Sus scrofa [pigs]
ref|XP_005323906.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Ictidomys tridecemlineatus
ref|XP_004479417.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Dasypus novemcinctus
ref|XP_008683515.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Ursus maritimus [white bear]
ref|XP_004397271.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Odobenus rosmarus divergens
ref|XP_002756099.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Callithrix jacchus [common marmoset]
ref|XP_007094815.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Panthera tigris altaica
ref|XP_006148232.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Tupaia chinensis
ref|XP_547057.2|  PREDICTED: CD2 antigen cytoplasmic tail-binding...  54.3    2e-05   Canis lupus familiaris [dogs]
ref|XP_005621390.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   
ref|XP_006738047.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  54.3    2e-05   Leptonychotes weddellii
ref|XP_007432293.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.9    2e-05   Python bivittatus
ref|XP_007432291.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.9    2e-05   
ref|XP_008327573.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.9    3e-05   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008119203.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.9    3e-05   Anolis carolinensis [Carolina anole]
emb|CAA08790.1|  SMC2orf                                              53.9    3e-05   Podocoryna carnea
ref|NP_957255.1|  CD2 antigen cytoplasmic tail-binding protein 2      53.9    3e-05   Danio rerio [leopard danio]
ref|XP_007235412.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.9    3e-05   
gb|EQB77973.1|  TBC1 domain family, member 10B                        53.9    3e-05   Camelus ferus
gb|ACO08847.1|  CD2 antigen cytoplasmic tail-binding protein 2        53.5    3e-05   Osmerus mordax
gb|KHN80241.1|  CD2 antigen cytoplasmic tail-binding protein 2        53.5    4e-05   Toxocara canis
ref|XP_005164061.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.5    4e-05   
ref|XP_004386718.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.5    4e-05   Trichechus manatus latirostris
ref|XP_008327571.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  53.5    4e-05   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ETE71829.1|  CD2 antigen cytoplasmic tail-binding protein 2        53.1    4e-05   Ophiophagus hannah
ref|XP_003141874.1|  hypothetical protein LOAG_06290                  50.8    6e-05   
gb|EJD75662.1|  hypothetical protein LOAG_17242                       52.4    8e-05   Loa loa
ref|XP_003370683.1|  putative GYF domain protein                      52.4    8e-05   Trichinella spiralis
ref|XP_010596815.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  52.4    1e-04   Loxodonta africana [African bush elephant]
ref|XP_009053028.1|  hypothetical protein LOTGIDRAFT_144141           52.0    1e-04   Lottia gigantea
gb|ACQ58674.1|  CD2 antigen cytoplasmic tail-binding protein 2        52.0    1e-04   Anoplopoma fimbria
ref|XP_005831089.1|  hypothetical protein GUITHDRAFT_109893           52.0    1e-04   Guillardia theta CCMP2712
ref|XP_003418899.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  52.0    1e-04   Loxodonta africana [African bush elephant]
gb|AAH75535.1|  CAP-GLY domain containing linker protein family, ...  52.0    1e-04   Xenopus tropicalis [western clawed frog]
ref|XP_010767594.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  52.0    1e-04   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008592062.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  51.6    1e-04   Galeopterus variegatus [Malayan flying lemur]
gb|AAH45270.1|  Cd2bp2 protein                                        52.0    1e-04   Xenopus laevis [clawed frog]
ref|NP_001080561.1|  CD2 (cytoplasmic tail) binding protein 2         51.6    1e-04   Xenopus laevis [clawed frog]
ref|XP_001655737.1|  AAEL011793-PA                                    51.6    2e-04   
ref|XP_001636667.1|  predicted protein                                51.6    2e-04   Nematostella vectensis
ref|XP_004071229.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  51.6    2e-04   Oryzias latipes [Japanese rice fish]
ref|NP_989351.3|  CAP-GLY domain containing linker protein family...  51.2    2e-04   Xenopus tropicalis [western clawed frog]
emb|CDX94997.1|  BnaC05g06740D                                        48.9    2e-04   
ref|XP_002641351.1|  C. briggsae CBR-TEG-1 protein                    51.2    2e-04   Caenorhabditis briggsae
emb|CDQ76281.1|  unnamed protein product                              51.2    2e-04   Oncorhynchus mykiss
ref|XP_008293558.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  51.2    3e-04   Stegastes partitus
ref|XP_002051146.1|  GJ14592                                          50.4    3e-04   Drosophila virilis
ref|XP_001993054.1|  GH13298                                          50.4    3e-04   Drosophila grimshawi
ref|XP_006643368.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  49.3    4e-04   
ref|XP_782125.3|  PREDICTED: LIN1-like protein-like                   50.4    4e-04   Strongylocentrotus purpuratus [purple urchin]
ref|XP_011335497.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  50.4    4e-04   Ooceraea biroi
ref|XP_002737591.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  50.4    4e-04   Saccoglossus kowalevskii
ref|XP_003104082.1|  CRE-TEG-1 protein                                50.4    4e-04   Caenorhabditis remanei
ref|XP_782062.3|  PREDICTED: LIN1-like protein-like                   50.4    5e-04   
gb|EHJ63439.1|  putative Aspartyl beta-hydroxylase                    50.1    5e-04   
ref|XP_003964973.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  50.1    5e-04   Takifugu rubripes [tiger puffer]
ref|XP_001913470.1|  hypothetical protein                             49.3    5e-04   Entamoeba histolytica HM-1:IMSS
ref|XP_011335496.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  50.1    5e-04   Ooceraea biroi
ref|XP_006009091.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  50.1    6e-04   
ref|XP_001357399.1|  GA18730                                          50.1    6e-04   
emb|CDQ94471.1|  unnamed protein product                              50.1    6e-04   Oncorhynchus mykiss
ref|NP_001140114.1|  CD2 antigen cytoplasmic tail-binding protein 2   50.1    6e-04   Salmo salar
ref|XP_002014331.1|  GL19140                                          50.1    6e-04   Drosophila persimilis
ref|XP_002003910.1|  GI18162                                          49.7    6e-04   Drosophila mojavensis
ref|XP_002078963.1|  GD23703                                          49.7    6e-04   Drosophila simulans
ref|XP_002036521.1|  GM18415                                          49.7    7e-04   Drosophila sechellia
ref|XP_001963130.1|  GF15791                                          49.7    7e-04   Drosophila ananassae
ref|XP_006037614.1|  PREDICTED: uncharacterized protein LOC102370757  50.1    7e-04   
ref|XP_008615448.1|  hypothetical protein SDRG_11196                  49.7    7e-04   
ref|XP_001969491.1|  GG10134                                          49.7    7e-04   
ref|XP_005810187.1|  PREDICTED: LOW QUALITY PROTEIN: CD2 antigen ...  49.7    8e-04   
ref|XP_002089122.1|  GE18946                                          49.3    8e-04   
gb|KDO34071.1|  hypothetical protein SPRG_01345                       49.3    8e-04   
ref|XP_009177825.1|  hypothetical protein T265_16063                  48.5    9e-04   
ref|XP_005726290.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  49.3    9e-04   
ref|XP_007562252.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  49.3    0.001   
ref|XP_007562250.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  49.3    0.001   
ref|NP_609404.2|  hole-in-one                                         49.3    0.001   
ref|XP_008414553.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  49.3    0.001   



>ref|XP_009628293.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nicotiana 
tomentosiformis]
Length=390

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            MEEG  +RS KRPFVD  DDDS K  A+KRVRFPKGKK+K+GD  ++G E+LPSGW++PR
Sbjct  1    MEEGSSRRS-KRPFVDVEDDDSNKAPAQKRVRFPKGKKVKQGDNTIEGREDLPSGWRDPR  59

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
            LAAKER++RR+QITA+LLDE N G + +I+ AE  Y +NETF++DGI IEPFNL+KEREE
Sbjct  60   LAAKERSVRRNQITAELLDEENEGEIADISRAEVEYGENETFIDDGIAIEPFNLDKEREE  119

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            GYFDA GNYVEY+NEN+IKDAWLDS+D   + + K+ +  +NED  +DLT+EELG
Sbjct  120  GYFDAAGNYVEYLNENEIKDAWLDSVDTEKRFSGKSAIRISNEDEIQDLTAEELG  174



>ref|XP_009787152.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nicotiana 
sylvestris]
Length=390

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            MEEG  +RS KRPFVD  DDDS+K  A+KRVRFPKGKK+K+GD  ++G E+LPS W++PR
Sbjct  1    MEEGSSRRS-KRPFVDVEDDDSKKAPAQKRVRFPKGKKVKQGDNTIEGREDLPSAWRDPR  59

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
            LAAKER++RR+QITA+LLDE N G + +I+ AE  Y ++ETF++DGI IEPFNL+KEREE
Sbjct  60   LAAKERSVRRNQITAELLDEENEGEIADISQAEVEYGEHETFIDDGIAIEPFNLDKEREE  119

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            GYFDA GNYVEY+NEN+IKDAWLDS+D   +   K+ +  +NED  +DLT+EELG
Sbjct  120  GYFDAAGNYVEYLNENEIKDAWLDSVDTEKRFFGKSAIRISNEDEIQDLTAEELG  174



>ref|XP_004236847.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010319329.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Solanum lycopersicum]
Length=388

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            MEEG  +R+ KRPFV+  DDDS K   +KRVRFPKGKK K+GD  +DG E+ PSG  +PR
Sbjct  1    MEEGSSRRA-KRPFVE--DDDSNKAPEQKRVRFPKGKKAKQGDTTIDGCEDKPSGRTDPR  57

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AAKER+ RR+QITA+LLDE N G + +I+ AE  YE+NETF++DGI IEPFNLNKEREE
Sbjct  58   NAAKERSARRNQITAELLDEENEGEIADISRAEVEYEENETFIDDGIAIEPFNLNKEREE  117

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            GYFDA+GNYVEY+NEN+IKDAWLDS+D     + K  +  +NED  +DLTSE+LG
Sbjct  118  GYFDASGNYVEYLNENEIKDAWLDSVDTEKTYSGKKAIKISNEDEIQDLTSEQLG  172



>ref|XP_006359285.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Solanum tuberosum]
Length=419

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 140/176 (80%), Gaps = 3/176 (2%)
 Frame = +1

Query  127  AMEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNP  306
            AMEEG  +R+ KRPFV+  DDDS K   +KRVRFPKGKK+K+GD  +DG E+ PSG  +P
Sbjct  31   AMEEGSSRRA-KRPFVE--DDDSNKAPEQKRVRFPKGKKVKQGDNTIDGREDKPSGRTDP  87

Query  307  RLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKERE  486
            R AAKER+ RR+QITA+LLDE N G + +I+ AE  YE+NETF++DGI IEPFNL+KERE
Sbjct  88   RAAAKERSARRNQITAELLDEENEGEIADISRAEVEYEENETFIDDGIAIEPFNLDKERE  147

Query  487  EGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EGYFDA+GNYVEY+N+N+IKDAWLDS+D   + + K  +  +NED  +DLTSE+LG
Sbjct  148  EGYFDASGNYVEYLNQNEIKDAWLDSVDTEKRYSGKKAIKISNEDEIQDLTSEQLG  203



>ref|XP_010319328.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Solanum lycopersicum]
Length=398

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            MEEG  +R+ KRPFV+  DDDS K   +KRVRFPKGKK K+GD  +DG E+ PSG  +PR
Sbjct  1    MEEGSSRRA-KRPFVE--DDDSNKAPEQKRVRFPKGKKAKQGDTTIDGCEDKPSGRTDPR  57

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AAKER+ RR+QITA+LLDE N G + +I+ AE  YE+NETF++DGI IEPFNLNKEREE
Sbjct  58   NAAKERSARRNQITAELLDEENEGEIADISRAEVEYEENETFIDDGIAIEPFNLNKEREE  117

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            GYFDA+GNYVEY+NEN+IKDAWLDS+D     + K  +  +NED  +DLTSE+LG
Sbjct  118  GYFDASGNYVEYLNENEIKDAWLDSVDTEKTYSGKKAIKISNEDEIQDLTSEQLG  172



>ref|XP_008455212.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 homolog 
[Cucumis melo]
Length=409

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDG--SEELPSGWKN  303
            ME+   + + KR F +  DDDS KP+A+KRVRFPKGKK+K GD  +D   +EE P    +
Sbjct  1    MEDNPSRPNLKRRFFEDEDDDSLKPTAQKRVRFPKGKKVKSGDAFLDKGKAEETPDDLTD  60

Query  304  PRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
            PRLAAKERA RR+Q+TADL  E NRG+V++I+ AE  YE+NE F  DGIQ+EPFNL+KER
Sbjct  61   PRLAAKERAKRRNQMTADLFSEENRGLVNDISAAEVTYEENENFDADGIQLEPFNLDKER  120

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFDA GN+VEYVN+ +IKDAWLDS+D+ PK   K+ ++  NED  ++L+SEE+G
Sbjct  121  EEGYFDAAGNFVEYVNDKEIKDAWLDSVDIDPKYTGKSSIVINNEDDVQELSSEEVG  177



>emb|CDO97455.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 131/177 (74%), Gaps = 6/177 (3%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDG--SEELPSGWKN  303
            MEEG    SRKR FV+  DD S KP A+KRVRFPKGKK+K GDYVVD    E+ P   ++
Sbjct  1    MEEG---PSRKRSFVED-DDQSNKPPAQKRVRFPKGKKVKTGDYVVDDQPGEDGPVRSQD  56

Query  304  PRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
            P+L AKER  RRSQ+ ADLLDE NRGM+ +I  AE  YED+ETFVEDGIQIEPFNL KER
Sbjct  57   PQLVAKERRRRRSQMAADLLDEENRGMLPDIMRAEVQYEDDETFVEDGIQIEPFNLEKER  116

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            E GYFD  GNYVE++NEN+IKDAWLDSID +   A  T  +  NED   DL+S++LG
Sbjct  117  EGGYFDPQGNYVEFLNENEIKDAWLDSIDANKDFAANTFAVPKNEDDVADLSSDDLG  173



>ref|XP_011087881.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Sesamum 
indicum]
Length=363

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 138/176 (78%), Gaps = 4/176 (2%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDG-SEELPSGWKNP  306
            M EG  + + KR F++  DD+S KP  EKRVRFPKGKK+K+GD V D   EE+PS WK+P
Sbjct  1    MAEGSSRSNLKRSFIE--DDESDKPPPEKRVRFPKGKKVKQGDCVTDSLGEEIPS-WKDP  57

Query  307  RLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKERE  486
            RLAA++R++RRS+ITA+LLD+ N  ++ +I  AE  YEDNETFV++G+QIEPFNL+KERE
Sbjct  58   RLAARDRSIRRSKITAELLDDENNDLLPDIRKAEVRYEDNETFVDEGVQIEPFNLDKERE  117

Query  487  EGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            +GYFD NGNYVEY+N N IKDAWLDS+DV  K + K+ + T+ ++  +DL++EEL 
Sbjct  118  DGYFDENGNYVEYINRNVIKDAWLDSVDVQEKYSGKSSIPTSYDEKPQDLSTEELA  173



>gb|KHG14788.1| CD2 antigen cytoplasmic tail-binding 2 [Gossypium arboreum]
Length=393

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 133/184 (72%), Gaps = 15/184 (8%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV------DGSEELPS  291
            MEE  P    KRPF D  DDDS KP A+KR+RFPKGKK+K G+  V      DGS  L  
Sbjct  1    MEEKPPSSHLKRPFFD--DDDSNKPPAQKRIRFPKGKKVKPGEEAVNRVDVEDGSRNL--  56

Query  292  GWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNL  471
              ++PRLAAKER+ RR+QIT +L  E  RGM+++I LAE AYEDNE F++DGIQIEPFNL
Sbjct  57   --QDPRLAAKERSKRRNQITTELFTEDGRGMLNDITLAEVAYEDNENFIDDGIQIEPFNL  114

Query  472  NKEREEGYFDANGNYVEYVNENDIKDAWLDSIDV---HPKAAVKTRVITANEDXARDLTS  642
            +KEREEGYFDA+GN+VEYVN N IKDAWLDS++    +   A  T+    NED A+DL++
Sbjct  115  DKEREEGYFDADGNFVEYVNNNGIKDAWLDSVEADVQYTGKAFATKNGEDNEDVAQDLSA  174

Query  643  EELG  654
            +++G
Sbjct  175  QDIG  178



>ref|XP_004136873.1| PREDICTED: uncharacterized protein LOC101218985 [Cucumis sativus]
 ref|XP_004155444.1| PREDICTED: uncharacterized protein LOC101223926 [Cucumis sativus]
 gb|KGN43714.1| hypothetical protein Csa_7G062800 [Cucumis sativus]
Length=409

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 131/177 (74%), Gaps = 2/177 (1%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDG--SEELPSGWKN  303
            ME+   + + KR F +  DDDS K +A+KRVRFPKG+K+K GD  +D   +EE P    +
Sbjct  1    MEDNPSRPNLKRRFFEDEDDDSLKSTAQKRVRFPKGRKVKSGDAFLDKGKAEENPDDLTD  60

Query  304  PRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
            PRLAAKERA RR+Q+TADL  E NRG+V++I+ AE  YE+NE F  DGIQ+EPFNL+KER
Sbjct  61   PRLAAKERAKRRNQMTADLFSEENRGIVNDISAAEVTYEENENFDADGIQLEPFNLDKER  120

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFDA GN+VEYVN+ +IKDAWLDS+D+ PK   K   +   ED  ++L+SEE+G
Sbjct  121  EEGYFDAAGNFVEYVNDKEIKDAWLDSVDIDPKYTGKRSTVINYEDDVQELSSEEVG  177



>gb|KCW56994.1| hypothetical protein EUGRSUZ_I026661, partial [Eucalyptus grandis]
 gb|KCW56995.1| hypothetical protein EUGRSUZ_I026661, partial [Eucalyptus grandis]
Length=196

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 133/184 (72%), Gaps = 12/184 (7%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY------VVDGSEELPS  291
            ME      SRKRPF +  D DS K  ++KRVRFPKGKK+K GD       VV+  ++ PS
Sbjct  1    MEGSSSHPSRKRPFFED-DPDSSKAPSQKRVRFPKGKKVKPGDEAAVKRPVVE--DKAPS  57

Query  292  GWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNL  471
              K+ RLAAKERA RRSQITA+L  E +RG  ++I+ AE AYEDNE+FVEDGIQIEPFNL
Sbjct  58   DAKDARLAAKERASRRSQITAELFSEDSRGGANDISSAEVAYEDNESFVEDGIQIEPFNL  117

Query  472  NKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVK---TRVITANEDXARDLTS  642
            +KEREEGYFDA GN+VEYVNEN+IKDAWLDS++     A +     V+T  E+ A +L+S
Sbjct  118  DKEREEGYFDAEGNFVEYVNENEIKDAWLDSVEAVTSLASRRLVASVVTPAEEDAGELSS  177

Query  643  EELG  654
            +++G
Sbjct  178  DDIG  181



>ref|XP_002303188.2| CD2-binding family protein [Populus trichocarpa]
 gb|EEE78167.2| CD2-binding family protein [Populus trichocarpa]
Length=354

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 12/173 (7%)
 Frame = +1

Query  157  RKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVD---GSEELPSGWKNPRLAAKER  327
            RKRPF++ ++DD  K + +K+VRFPKGKK+K  D  VD     EE PS  K+PRLAAKER
Sbjct  5    RKRPFLEDIEDDD-KSNKQKKVRFPKGKKVKSVDERVDRGKAEEEGPSDLKDPRLAAKER  63

Query  328  AMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDAN  507
            AM RS IT    DEG  G +++ + AE AYE+NE FVEDGIQIEPFNL KEREEGYFDA+
Sbjct  64   AMLRSLIT----DEGFSGDINDASAAEVAYEENENFVEDGIQIEPFNLEKEREEGYFDAD  119

Query  508  GNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE----DXARDLTSEELG  654
            GN+VEY+NEN+IKDAWLDS+ VH +   KT V + NE    D  RDL+SEE+G
Sbjct  120  GNFVEYINENEIKDAWLDSVQVHERYVGKTSVASINEDDEKDDGRDLSSEEIG  172



>ref|XP_010656830.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Vitis vinifera]
Length=394

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 130/177 (73%), Gaps = 6/177 (3%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGS--EELPSGWKN  303
            MEE  P RS KRP   S DD   KP  +KRV+FPKGKK+K GD V++    E++PS  K+
Sbjct  1    MEEK-PARSMKRPL--SADDVLNKPPMQKRVKFPKGKKVKPGDEVLNAGKDEDVPSELKD  57

Query  304  PRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
            PRLAAKERA  R+QITA+L  E +RG+ H+I+ AE  YE +E F +DGIQIEPFNLN+ER
Sbjct  58   PRLAAKERAKHRTQITAELFSEESRGIFHDISAAEMNYEGDENFDDDGIQIEPFNLNQER  117

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFD+ GN+VEYVNE +IKDAWLDS+D+ PK   K  ++T  ED  +DLT+  +G
Sbjct  118  EEGYFDSEGNFVEYVNEKEIKDAWLDSVDLEPKFD-KRNMVTKVEDDTQDLTTAAIG  173



>ref|XP_002269975.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Vitis vinifera]
 ref|XP_010656828.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Vitis vinifera]
 ref|XP_010656829.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Vitis vinifera]
Length=419

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 130/177 (73%), Gaps = 6/177 (3%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGS--EELPSGWKN  303
            MEE  P RS KRP   S DD   KP  +KRV+FPKGKK+K GD V++    E++PS  K+
Sbjct  1    MEEK-PARSMKRPL--SADDVLNKPPMQKRVKFPKGKKVKPGDEVLNAGKDEDVPSELKD  57

Query  304  PRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
            PRLAAKERA  R+QITA+L  E +RG+ H+I+ AE  YE +E F +DGIQIEPFNLN+ER
Sbjct  58   PRLAAKERAKHRTQITAELFSEESRGIFHDISAAEMNYEGDENFDDDGIQIEPFNLNQER  117

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFD+ GN+VEYVNE +IKDAWLDS+D+ PK   K  ++T  ED  +DLT+  +G
Sbjct  118  EEGYFDSEGNFVEYVNEKEIKDAWLDSVDLEPKFD-KRNMVTKVEDDTQDLTTAAIG  173



>ref|XP_010030930.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Eucalyptus 
grandis]
Length=338

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 133/184 (72%), Gaps = 12/184 (7%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY------VVDGSEELPS  291
            ME      SRKRPF +  D DS K  ++KRVRFPKGKK+K GD       VV+  ++ PS
Sbjct  1    MEGSSSHPSRKRPFFED-DPDSSKAPSQKRVRFPKGKKVKPGDEAAVKRPVVE--DKAPS  57

Query  292  GWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNL  471
              K+ RLAAKERA RRSQITA+L  E +RG  ++I+ AE AYEDNE+FVEDGIQIEPFNL
Sbjct  58   DAKDARLAAKERASRRSQITAELFSEDSRGGANDISSAEVAYEDNESFVEDGIQIEPFNL  117

Query  472  NKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVK---TRVITANEDXARDLTS  642
            +KEREEGYFDA GN+VEYVNEN+IKDAWLDS++     A +     V+T  E+ A +L+S
Sbjct  118  DKEREEGYFDAEGNFVEYVNENEIKDAWLDSVEAVTSLASRRLVASVVTPAEEDAGELSS  177

Query  643  EELG  654
            +++G
Sbjct  178  DDIG  181



>ref|XP_007042973.1| CD2-binding protein-related, putative [Theobroma cacao]
 gb|EOX98804.1| CD2-binding protein-related, putative [Theobroma cacao]
Length=419

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 16/185 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV------DGSEELPS  291
            MEE      RKR F +  D+DS KP A+KRVRFPKGKK+K G+  V      DGS +L  
Sbjct  1    MEEKPSSSHRKRQFFE--DEDSDKPPAQKRVRFPKGKKVKPGEEPVNRVDVEDGSGDL--  56

Query  292  GWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNL  471
              K+PRLAAKERA  RSQIT +L     +GM+++++ AE AYEDNE FV+DGIQIEPFNL
Sbjct  57   --KDPRLAAKERAKHRSQITTELFTADGQGMLNDVSAAEVAYEDNENFVDDGIQIEPFNL  114

Query  472  NKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANED----XARDLT  639
            NKEREEGYFDA+GN+VEYVN+N+IKDAWLDS++   K   KT   T +ED      +DL+
Sbjct  115  NKEREEGYFDADGNFVEYVNDNEIKDAWLDSVEADIKYTGKTSATTNDEDDNEVVTQDLS  174

Query  640  SEELG  654
            S+++G
Sbjct  175  SQDIG  179



>gb|EYU18484.1| hypothetical protein MIMGU_mgv1a008901mg [Erythranthe guttata]
Length=359

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 126/169 (75%), Gaps = 2/169 (1%)
 Frame = +1

Query  148  QRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPRLAAKER  327
            + S KR FV+  DDDS KP  EKRVRFPKGKK+++GDYV +   E  +  K   LAAK+R
Sbjct  3    ENSLKRSFVE--DDDSSKPPPEKRVRFPKGKKVQQGDYVKNSLGEDTAIKKKALLAAKDR  60

Query  328  AMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDAN  507
            A+RRS IT +LLD+  +  V ++  AE  Y+++ETFV++G  +EPFNL+KEREEGYFD +
Sbjct  61   AVRRSNITPELLDDEYKDFVPDVRKAEVHYKEDETFVDEGTPMEPFNLDKEREEGYFDDD  120

Query  508  GNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            GNYVEYVN+N+IKDAWLDS+DVHPK   K+ + T N+D  +DL +EEL 
Sbjct  121  GNYVEYVNQNEIKDAWLDSVDVHPKYTGKSSIPTNNDDKPQDLVTEELA  169



>emb|CBI17819.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 124/167 (74%), Gaps = 5/167 (3%)
 Frame = +1

Query  160  KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGS--EELPSGWKNPRLAAKERAM  333
            KRP   S DD   KP  +KRV+FPKGKK+K GD V++    E++PS  K+PRLAAKERA 
Sbjct  2    KRPL--SADDVLNKPPMQKRVKFPKGKKVKPGDEVLNAGKDEDVPSELKDPRLAAKERAK  59

Query  334  RRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGN  513
             R+QITA+L  E +RG+ H+I+ AE  YE +E F +DGIQIEPFNLN+EREEGYFD+ GN
Sbjct  60   HRTQITAELFSEESRGIFHDISAAEMNYEGDENFDDDGIQIEPFNLNQEREEGYFDSEGN  119

Query  514  YVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            +VEYVNE +IKDAWLDS+D+ PK   K  ++T  ED  +DLT+  +G
Sbjct  120  FVEYVNEKEIKDAWLDSVDLEPKFD-KRNMVTKVEDDTQDLTTAAIG  165



>gb|KJB79663.1| hypothetical protein B456_013G061400 [Gossypium raimondii]
Length=360

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 16/185 (9%)
 Frame = +1

Query  130  MEEGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY------VVDGSEELP  288
            MEE   QRS  KR F +  D  S KP A+KRVRFPKGKK+K G+       + DGS +L 
Sbjct  1    MEENPQQRSHLKRQFFE--DQHSNKPPAQKRVRFPKGKKVKPGEEAPNRVDIEDGSGDL-  57

Query  289  SGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFN  468
               K+P LAAKERA RRSQIT +L  E  RGM+++++ AE +YEDNE FV+DG+QIEPFN
Sbjct  58   ---KDPCLAAKERAKRRSQITTELFAEDGRGMLNDVSAAEISYEDNENFVDDGVQIEPFN  114

Query  469  LNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANED---XARDLT  639
            L+KEREEGYFDA+GN+VEYV + +IKDAWLDS++V  K   KT V T  ED    A+DL+
Sbjct  115  LSKEREEGYFDADGNFVEYVADKEIKDAWLDSVEVDIKYTGKTSVTTKGEDNEVAAQDLS  174

Query  640  SEELG  654
            ++++G
Sbjct  175  TQDVG  179



>ref|XP_011004970.1| PREDICTED: LIN1-like protein [Populus euphratica]
Length=394

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 129/182 (71%), Gaps = 16/182 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVD---GSEELPSGWK  300
            MEEG     RKRPF++ ++DD  K + +K+VRFPKGKK+K  D  VD     EE PS  K
Sbjct  1    MEEG----KRKRPFLEDIEDD-DKSNKQKKVRFPKGKKVKSVDERVDRGKAEEEGPSDLK  55

Query  301  NPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKE  480
            +PRLAAKERAM R+ IT    DEG  G +++ + AE AYE+NE FVEDGIQIEPFNL KE
Sbjct  56   DPRLAAKERAMLRNLIT----DEGFSGNINDASAAEVAYEENENFVEDGIQIEPFNLEKE  111

Query  481  REEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE----DXARDLTSEE  648
            REEGYFDA GN+VEY+NEN+IKDAWLDS+ V  +   KT V +  E    D  RDL+SEE
Sbjct  112  REEGYFDAEGNFVEYINENEIKDAWLDSVQVDERYVGKTSVASIKEDDEKDDGRDLSSEE  171

Query  649  LG  654
            +G
Sbjct  172  IG  173



>gb|KDP32429.1| hypothetical protein JCGZ_13354 [Jatropha curcas]
Length=427

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 135/185 (73%), Gaps = 14/185 (8%)
 Frame = +1

Query  130  MEEGG-PQRS-RKRPFVDSV-DDDSQKPSAEKRVRFPKGKKLKRGD--YVVDGS--EELP  288
            MEEG  P RS RKRPF + + DDDS KP  +K+VRFPKGKK+K GD   + DG   E++P
Sbjct  1    MEEGMLPSRSNRKRPFFEDLEDDDSNKPPKQKKVRFPKGKKVKPGDEEALADGPKVEDVP  60

Query  289  SGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFN  468
               K+PR+AAKERA RRSQIT +L +E      ++++ AE +YEDNETFVEDGIQIEPFN
Sbjct  61   LDIKDPRVAAKERAKRRSQITVELFNE----ETNDVSTAEVSYEDNETFVEDGIQIEPFN  116

Query  469  LNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANED---XARDLT  639
            L +EREEGYFDA GN+VEYV+E + KDAWLDS++V P+ A K+ +     D    + DL+
Sbjct  117  LEQEREEGYFDAQGNFVEYVHEKEFKDAWLDSVEVDPRYASKSSMEAVENDDKNDSSDLS  176

Query  640  SEELG  654
            SE++G
Sbjct  177  SEDIG  181



>gb|KJB79662.1| hypothetical protein B456_013G061400 [Gossypium raimondii]
Length=362

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 16/185 (9%)
 Frame = +1

Query  130  MEEGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY------VVDGSEELP  288
            MEE   QRS  KR F +  D  S KP A+KRVRFPKGKK+K G+       + DGS +L 
Sbjct  1    MEENPQQRSHLKRQFFE--DQHSNKPPAQKRVRFPKGKKVKPGEEAPNRVDIEDGSGDL-  57

Query  289  SGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFN  468
               K+P LAAKERA RRSQIT +L  E  RGM+++++ AE +YEDNE FV+DG+QIEPFN
Sbjct  58   ---KDPCLAAKERAKRRSQITTELFAEDGRGMLNDVSAAEISYEDNENFVDDGVQIEPFN  114

Query  469  LNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANED---XARDLT  639
            L+KEREEGYFDA+GN+VEYV + +IKDAWLDS++V  K   KT V T  ED    A+DL+
Sbjct  115  LSKEREEGYFDADGNFVEYVADKEIKDAWLDSVEVDIKYTGKTSVTTKGEDNEVAAQDLS  174

Query  640  SEELG  654
            ++++G
Sbjct  175  TQDVG  179



>ref|XP_011002067.1| PREDICTED: uncharacterized protein LOC105109156 [Populus euphratica]
 ref|XP_011002068.1| PREDICTED: uncharacterized protein LOC105109156 [Populus euphratica]
 ref|XP_011002069.1| PREDICTED: uncharacterized protein LOC105109156 [Populus euphratica]
Length=420

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 11/173 (6%)
 Frame = +1

Query  157  RKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGS---EELPSGWKNPRLAAKER  327
            RKR F++ ++D   + S +K+VRFPKGKK+K GD +VD S   EE PS  K+PRLAAKER
Sbjct  5    RKRSFLEEIEDTESEKSKQKKVRFPKGKKVKSGDEIVDRSKAGEEGPSERKDPRLAAKER  64

Query  328  AMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDAN  507
            A+ R++ITA +  E      ++ + AE AYE+NE FVEDGIQIEPFNL KEREEGYFDA 
Sbjct  65   AILRNEITAQIFSED----TNDPSAAEVAYEENENFVEDGIQIEPFNLEKEREEGYFDAE  120

Query  508  GNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE----DXARDLTSEELG  654
            GN+VEY+N+N+IKDAWLDSI V P+ A K  ++  NE    D  R+L+SEE+G
Sbjct  121  GNFVEYINQNEIKDAWLDSIQVDPRYAGKNSMVRINEHDDKDDVRELSSEEIG  173



>ref|XP_002298200.2| hypothetical protein POPTR_0001s21330g [Populus trichocarpa]
 gb|EEE83005.2| hypothetical protein POPTR_0001s21330g [Populus trichocarpa]
Length=349

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 126/173 (73%), Gaps = 11/173 (6%)
 Frame = +1

Query  157  RKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVD---GSEELPSGWKNPRLAAKER  327
            RKR F++ ++D+  + S +K+VRFPKGKK+K GD +VD     EE PS  K+PRLAAKER
Sbjct  5    RKRSFLEEIEDNESEKSKQKKVRFPKGKKVKSGDEIVDRGKAGEEGPSERKDPRLAAKER  64

Query  328  AMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDAN  507
            A+ R++ITA +  E      ++ + AE AYE+NE FVEDGIQIEPFNL KEREEGYFDA 
Sbjct  65   AILRNEITAQIFSED----TNDPSAAEVAYEENENFVEDGIQIEPFNLEKEREEGYFDAE  120

Query  508  GNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE----DXARDLTSEELG  654
            GN+VEY+N+N+IKDAWLDSI V P+ A K   +  NE    D  R+L+S+E+G
Sbjct  121  GNFVEYINQNEIKDAWLDSIQVDPRYAGKNSTVRINEHDDKDDVRELSSKEIG  173



>gb|KHG20831.1| CD2 antigen cytoplasmic tail-binding 2 [Gossypium arboreum]
Length=414

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 134/185 (72%), Gaps = 16/185 (9%)
 Frame = +1

Query  130  MEEGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY------VVDGSEELP  288
            MEE   QRS  KR F +  D  S KP A+KRVRFPKGKK+K G+       + +GS +L 
Sbjct  1    MEENPQQRSHLKRQFFE--DQHSNKPPAQKRVRFPKGKKVKPGEEAPNRVDIENGSGDL-  57

Query  289  SGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFN  468
               K+PRLAAKERA RRSQIT +L  E  RGM+++++ AE +YEDNE FV+DG+QIEPFN
Sbjct  58   ---KDPRLAAKERAKRRSQITTELFAEDGRGMLNDVSAAEISYEDNENFVDDGVQIEPFN  114

Query  469  LNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANED---XARDLT  639
            L+KEREEGYFDA+GN+VEYV + +IKDAWLDS++V  K   KT V T  ED    A+DL+
Sbjct  115  LSKEREEGYFDADGNFVEYVADKEIKDAWLDSVEVDIKYTGKTSVTTKAEDNEVAAQDLS  174

Query  640  SEELG  654
            ++++G
Sbjct  175  TQDVG  179



>gb|KJB79661.1| hypothetical protein B456_013G061400 [Gossypium raimondii]
 gb|KJB79664.1| hypothetical protein B456_013G061400 [Gossypium raimondii]
 gb|KJB79665.1| hypothetical protein B456_013G061400 [Gossypium raimondii]
Length=414

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 16/185 (9%)
 Frame = +1

Query  130  MEEGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY------VVDGSEELP  288
            MEE   QRS  KR F +  D  S KP A+KRVRFPKGKK+K G+       + DGS +L 
Sbjct  1    MEENPQQRSHLKRQFFE--DQHSNKPPAQKRVRFPKGKKVKPGEEAPNRVDIEDGSGDL-  57

Query  289  SGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFN  468
               K+P LAAKERA RRSQIT +L  E  RGM+++++ AE +YEDNE FV+DG+QIEPFN
Sbjct  58   ---KDPCLAAKERAKRRSQITTELFAEDGRGMLNDVSAAEISYEDNENFVDDGVQIEPFN  114

Query  469  LNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANED---XARDLT  639
            L+KEREEGYFDA+GN+VEYV + +IKDAWLDS++V  K   KT V T  ED    A+DL+
Sbjct  115  LSKEREEGYFDADGNFVEYVADKEIKDAWLDSVEVDIKYTGKTSVTTKGEDNEVAAQDLS  174

Query  640  SEELG  654
            ++++G
Sbjct  175  TQDVG  179



>ref|XP_010094166.1| hypothetical protein L484_017210 [Morus notabilis]
 gb|EXB55299.1| hypothetical protein L484_017210 [Morus notabilis]
Length=406

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 125/169 (74%), Gaps = 6/169 (4%)
 Frame = +1

Query  160  KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV----DGSEELPSGWKNPRLAAKER  327
            KRPF D  DD S KP  +K+VRFPKGKK++ G   V    D SE  P    +PR+AAKER
Sbjct  11   KRPFSDDGDDASAKPPMQKKVRFPKGKKVRLGHEPVERGRDESEAAP--VTDPRVAAKER  68

Query  328  AMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDAN  507
            A RRSQIT +L  E +RG+V +I+ AE AYED++ FV+DGIQIEPFNL +EREEGYFDA+
Sbjct  69   AKRRSQITTELFGEDSRGIVKDISTAEVAYEDDDDFVQDGIQIEPFNLKQEREEGYFDAD  128

Query  508  GNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
             N+VE+VNE +IKDAWLDS++V PK A K   +T N++ A +L+S ++G
Sbjct  129  MNFVEFVNEKEIKDAWLDSLEVDPKYAGKVPNVTTNDNDAPELSSSDIG  177



>ref|XP_007148416.1| hypothetical protein PHAVU_006G206700g [Phaseolus vulgaris]
 gb|ESW20410.1| hypothetical protein PHAVU_006G206700g [Phaseolus vulgaris]
Length=376

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 129/175 (74%), Gaps = 7/175 (4%)
 Frame = +1

Query  148  QRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGS--EELPSGWKNPRLAAK  321
            +RS KRPFV+  D+ S++P A KRVRFPKGKK+K GD VVD    EE      NPR+AAK
Sbjct  7    RRSGKRPFVEEDDESSKEPPA-KRVRFPKGKKVKPGDEVVDKGNVEEGEVDIMNPRVAAK  65

Query  322  ---ERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEG  492
               ERA +R+Q TA+LL EG  G+  + ++AE  YED+E FV+DGIQIEPFNL+KEREEG
Sbjct  66   AAKERANQRNQFTAELLSEGTGGIGIDFSVAEVTYEDSENFVDDGIQIEPFNLDKEREEG  125

Query  493  YFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANED-XARDLTSEELG  654
            YFDA GN+VEYV EN+IKDAWLD+I+V PK +    V T +ED    DL+SE++G
Sbjct  126  YFDAAGNFVEYVRENEIKDAWLDNIEVDPKYSALKSVPTNDEDEEPPDLSSEDIG  180



>ref|XP_008237185.1| PREDICTED: LIN1-like protein [Prunus mume]
Length=428

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 128/182 (70%), Gaps = 11/182 (6%)
 Frame = +1

Query  136  EGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVD--------GSEELP  288
            E  P RS  KRPF +  DD S KP A+KRVRFPKGKK + GD  V+        G    P
Sbjct  2    ESNPSRSNLKRPFFE--DDGSDKPPAQKRVRFPKGKKARPGDEAVNRGRPEEAVGVGIGP  59

Query  289  SGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFN  468
            +   +PR AAKERA RRSQIT +L  E   G++++++ AE  Y+D E FVEDGIQIEPFN
Sbjct  60   TPLTDPRSAAKERAKRRSQITTELFSEETAGILNDVSAAEVTYKDYEDFVEDGIQIEPFN  119

Query  469  LNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEE  648
            LNKEREEGYFDA+GN+VEY N+N+++DAWLDS++V  K A K   +T ++D  +DL+S++
Sbjct  120  LNKEREEGYFDADGNFVEYANKNEVEDAWLDSVEVDTKYAGKGFAVTKDDDDVQDLSSDD  179

Query  649  LG  654
            +G
Sbjct  180  VG  181



>ref|XP_007199874.1| hypothetical protein PRUPE_ppa006084mg [Prunus persica]
 gb|EMJ01073.1| hypothetical protein PRUPE_ppa006084mg [Prunus persica]
Length=428

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 11/182 (6%)
 Frame = +1

Query  136  EGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVD--------GSEELP  288
            E  P RS  KRPF +  DD S KP A+KRVRFPKGKK + GD  V+        G    P
Sbjct  2    ESNPSRSNLKRPFFE--DDGSDKPQAQKRVRFPKGKKARPGDEAVNRGRPEEAVGVGIGP  59

Query  289  SGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFN  468
            +   +PR AAKERA RRSQIT +L  E   G++++++ AE  Y+D + FVEDGI IEPFN
Sbjct  60   TPLTDPRSAAKERAKRRSQITTELFSEETAGILNDVSAAEVTYKDYDDFVEDGIPIEPFN  119

Query  469  LNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEE  648
            LNKEREEGYFDA+GN+VEY N+N+++DAWLDS++V  K A K   +T ++D  +DL+S++
Sbjct  120  LNKEREEGYFDADGNFVEYANKNEVEDAWLDSVEVDTKYAGKGFAVTKDDDDVQDLSSDD  179

Query  649  LG  654
            +G
Sbjct  180  VG  181



>ref|XP_002530265.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32105.1| conserved hypothetical protein, partial [Ricinus communis]
Length=348

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 130/188 (69%), Gaps = 18/188 (10%)
 Frame = +1

Query  130  MEEGGP--QRSRKRPFVDSV----DDDSQKPSAEKRVRFPKGKKLKRGD---YVVDGSEE  282
            ME   P  + +RKRP+++      DD S KP  +K+VRFPKGKK+K GD     +    E
Sbjct  1    MESAIPSSRSNRKRPYLEQDLEFDDDSSSKPPKQKKVRFPKGKKVKPGDEAPIAITKVLE  60

Query  283  LPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEP  462
               G +NPRLAAKERA RR+ ITA+L  E     +++++ AE  Y+DNE+FVEDGIQIEP
Sbjct  61   EEDG-QNPRLAAKERAKRRNLITAELFSE----ELNDVSTAEVTYQDNESFVEDGIQIEP  115

Query  463  FNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARD---  633
            FNL KEREEGYFD  GN+VEYVNEN++KDAWLDS+ V P+ A K+  +T NED  +D   
Sbjct  116  FNLEKEREEGYFDEAGNFVEYVNENEVKDAWLDSVAVDPRYAGKSSKVTTNEDDTKDDVI  175

Query  634  -LTSEELG  654
             L+SE+LG
Sbjct  176  ELSSEDLG  183



>ref|XP_004485576.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Cicer arietinum]
Length=405

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = +1

Query  139  GGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGS--EELPSGWKNPR  309
            GG  RS  KRP  +  D+ ++ P A KRVRFPKGKK K  D +V+    EE  +   NP 
Sbjct  3    GGSSRSNGKRPLQEDDDELTKNPPA-KRVRFPKGKKGKPVDVIVEKVIVEEDVNDLTNPV  61

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
            +AAKER  RR+QITA+LL E N G  +N++ AE  YEDNE FV+DGIQIEPFNLNKEREE
Sbjct  62   VAAKERVKRRNQITAELLSEENGGTSNNLSAAEVKYEDNENFVDDGIQIEPFNLNKEREE  121

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            GYFDA GN+VEYV +N+IKDAWLD++DV P+ A  + V   +E+  ++L+S+++ 
Sbjct  122  GYFDAAGNFVEYVRDNEIKDAWLDNVDVDPRYAGLSSVAINDEEEVQELSSKDVA  176



>ref|XP_010268025.1| PREDICTED: uncharacterized protein LOC104605102 isoform X1 [Nelumbo 
nucifera]
Length=414

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 116/167 (69%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY--VVDGSEELPSGWKNPRLAAKERAM  333
            KRP  D  DD+  KP A+KRVRFPKGKK+K GD    V   E+  S   +PRLAAKERA 
Sbjct  2    KRPRSD--DDEPNKPPAQKRVRFPKGKKVKTGDERPSVSVDEDGLSELADPRLAAKERAK  59

Query  334  RRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGN  513
            RR+Q+TA+L  E   G+ H+++ AE  YEDN   V+DGIQIEPFNL +EREEGYFDA GN
Sbjct  60   RRNQMTAELFREETHGIFHDVSSAEVTYEDNAELVDDGIQIEPFNLEQEREEGYFDAQGN  119

Query  514  YVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            +VEY  EN+IKDAWLDS ++  + A K      NE+   DL+S+++G
Sbjct  120  FVEYFRENEIKDAWLDSAEIDTRFAEKNLETAKNEEDIHDLSSKDIG  166



>gb|KJB31989.1| hypothetical protein B456_005G2198002, partial [Gossypium raimondii]
Length=371

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 113/156 (72%), Gaps = 13/156 (8%)
 Frame = +1

Query  214  KRVRFPKGKKLKRGDYVV------DGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGN  375
            KR+RFPKGKK+K G+  V      DGS  L    ++PRLAAKER+ RR+QIT +L  E  
Sbjct  2    KRIRFPKGKKVKPGEEAVNRVDVEDGSGNL----QDPRLAAKERSKRRNQITTELFTEDG  57

Query  376  RGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAW  555
            RGM+++I LAE AYEDNE F++DGIQIEPFNL+KEREEGYFDA+GN+VEYVN N IKDAW
Sbjct  58   RGMLNDITLAEVAYEDNENFIDDGIQIEPFNLDKEREEGYFDADGNFVEYVNNNGIKDAW  117

Query  556  LDSIDVHPKAAVKTRVITANEDX---ARDLTSEELG  654
             DS++   +   K    T  ED    A+DL+++++G
Sbjct  118  FDSVEADVQYTGKAFTTTNGEDNEVVAQDLSAQDIG  153



>gb|KJB31986.1| hypothetical protein B456_005G2198002, partial [Gossypium raimondii]
 gb|KJB31988.1| hypothetical protein B456_005G2198002, partial [Gossypium raimondii]
Length=392

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 113/156 (72%), Gaps = 13/156 (8%)
 Frame = +1

Query  214  KRVRFPKGKKLKRGDYVV------DGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGN  375
            KR+RFPKGKK+K G+  V      DGS  L    ++PRLAAKER+ RR+QIT +L  E  
Sbjct  2    KRIRFPKGKKVKPGEEAVNRVDVEDGSGNL----QDPRLAAKERSKRRNQITTELFTEDG  57

Query  376  RGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAW  555
            RGM+++I LAE AYEDNE F++DGIQIEPFNL+KEREEGYFDA+GN+VEYVN N IKDAW
Sbjct  58   RGMLNDITLAEVAYEDNENFIDDGIQIEPFNLDKEREEGYFDADGNFVEYVNNNGIKDAW  117

Query  556  LDSIDVHPKAAVKTRVITANEDX---ARDLTSEELG  654
             DS++   +   K    T  ED    A+DL+++++G
Sbjct  118  FDSVEADVQYTGKAFTTTNGEDNEVVAQDLSAQDIG  153



>ref|XP_008373191.1| PREDICTED: uncharacterized protein LOC103436539 [Malus domestica]
Length=423

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 121/177 (68%), Gaps = 13/177 (7%)
 Frame = +1

Query  151  RSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR-------  309
            R+ KRPF +  DD S KP A+KRVRFPKGKK +  D     S  +P+    P        
Sbjct  5    RNLKRPFFE--DDSSGKPPAQKRVRFPKGKKARPEDETALKS--IPAEAIGPTPAAAATD  60

Query  310  --LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
               AAKERA RRSQIT +L  E   G+V +++ AE  Y+D E FVEDGI+IEPFNLNKER
Sbjct  61   PRAAAKERAKRRSQITTELFTEDAAGVVSDVSAAEVTYKDYEDFVEDGIRIEPFNLNKER  120

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFDANGN+VEY N+N++KDAWLDSI+V  K A K  V+T + D  +DL+S+++G
Sbjct  121  EEGYFDANGNFVEYANKNEVKDAWLDSIEVATKYAGKDVVVTKDYDDVQDLSSDDIG  177



>gb|KDO47022.1| hypothetical protein CISIN_1g024218mg [Citrus sinensis]
Length=200

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 128/176 (73%), Gaps = 11/176 (6%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KRVRFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRVRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDA  504
            RA  R+ +T +L  E +RG  ++I+ AE  YE +E FV+DGIQI+PFNL+KEREEGYFDA
Sbjct  64   RATHRNLMTFELCSEESRGNGNDISAAEVTYEGDENFVDDGIQIDPFNLDKEREEGYFDA  123

Query  505  NGNYVEYVNENDIKDAWLDSIDVHPK----AAVKTRVITANEDXARD--LTSEELG  654
             GN+VEYVNEN+IKDAWLDS++V  +    A +  +VI A ED   D  L+SEELG
Sbjct  124  QGNFVEYVNENEIKDAWLDSLEVDQRYVGTAVIDNKVIEAQEDKDNDHELSSEELG  179



>gb|KDO47021.1| hypothetical protein CISIN_1g024218mg [Citrus sinensis]
Length=218

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 128/176 (73%), Gaps = 11/176 (6%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KRVRFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRVRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDA  504
            RA  R+ +T +L  E +RG  ++I+ AE  YE +E FV+DGIQI+PFNL+KEREEGYFDA
Sbjct  64   RATHRNLMTFELCSEESRGNGNDISAAEVTYEGDENFVDDGIQIDPFNLDKEREEGYFDA  123

Query  505  NGNYVEYVNENDIKDAWLDSIDVHPK----AAVKTRVITANEDXARD--LTSEELG  654
             GN+VEYVNEN+IKDAWLDS++V  +    A +  +VI A ED   D  L+SEELG
Sbjct  124  QGNFVEYVNENEIKDAWLDSLEVDQRYVGTAVIDNKVIEAQEDKDNDHELSSEELG  179



>gb|KDO47020.1| hypothetical protein CISIN_1g024218mg [Citrus sinensis]
Length=270

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 128/176 (73%), Gaps = 11/176 (6%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KRVRFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRVRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDA  504
            RA  R+ +T +L  E +RG  ++I+ AE  YE +E FV+DGIQI+PFNL+KEREEGYFDA
Sbjct  64   RATHRNLMTFELCSEESRGNGNDISAAEVTYEGDENFVDDGIQIDPFNLDKEREEGYFDA  123

Query  505  NGNYVEYVNENDIKDAWLDSIDVHPK----AAVKTRVITANEDXARD--LTSEELG  654
             GN+VEYVNEN+IKDAWLDS++V  +    A +  +VI A ED   D  L+SEELG
Sbjct  124  QGNFVEYVNENEIKDAWLDSLEVDQRYVGTAVIDNKVIEAQEDKDNDHELSSEELG  179



>gb|KDO47019.1| hypothetical protein CISIN_1g024218mg [Citrus sinensis]
Length=256

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 128/176 (73%), Gaps = 11/176 (6%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KRVRFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRVRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDA  504
            RA  R+ +T +L  E +RG  ++I+ AE  YE +E FV+DGIQI+PFNL+KEREEGYFDA
Sbjct  64   RATHRNLMTFELCSEESRGNGNDISAAEVTYEGDENFVDDGIQIDPFNLDKEREEGYFDA  123

Query  505  NGNYVEYVNENDIKDAWLDSIDVHPK----AAVKTRVITANEDXARD--LTSEELG  654
             GN+VEYVNEN+IKDAWLDS++V  +    A +  +VI A ED   D  L+SEELG
Sbjct  124  QGNFVEYVNENEIKDAWLDSLEVDQRYVGTAVIDNKVIEAQEDKDNDHELSSEELG  179



>gb|KJB31987.1| hypothetical protein B456_005G2198002, partial [Gossypium raimondii]
Length=330

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = +1

Query  214  KRVRFPKGKKLKRGDYVV------DGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGN  375
            KR+RFPKGKK+K G+  V      DGS  L    ++PRLAAKER+ RR+QIT +L  E  
Sbjct  2    KRIRFPKGKKVKPGEEAVNRVDVEDGSGNL----QDPRLAAKERSKRRNQITTELFTEDG  57

Query  376  RGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAW  555
            RGM+++I LAE AYEDNE F++DGIQIEPFNL+KEREEGYFDA+GN+VEYVN N IKDAW
Sbjct  58   RGMLNDITLAEVAYEDNENFIDDGIQIEPFNLDKEREEGYFDADGNFVEYVNNNGIKDAW  117

Query  556  LDSIDVHPKAAVKTRVITANED  621
             DS++   +   K    T  ED
Sbjct  118  FDSVEADVQYTGKAFTTTNGED  139



>ref|XP_006464265.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 homolog 
[Citrus sinensis]
Length=372

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 129/176 (73%), Gaps = 11/176 (6%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KR+RFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRIRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDA  504
            RA RR+ +T +L  E +RG  ++I+ AE  YE +E FV+DGIQI+PFNL+KEREEGYFDA
Sbjct  64   RATRRNLMTFELCSEESRGNGNDISAAEVTYEGDENFVDDGIQIDPFNLDKEREEGYFDA  123

Query  505  NGNYVEYVNENDIKDAWLDSIDVHPK----AAVKTRVITANEDXARD--LTSEELG  654
             GN+VEYVNEN+IKDAWLDS++V  +    A +  +VI A ED   D  L+SEELG
Sbjct  124  EGNFVEYVNENEIKDAWLDSLEVDQRYVGTAVIDNKVIEAQEDKDNDHELSSEELG  179



>gb|ACU14443.1| unknown [Glycine max]
Length=238

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 129/218 (59%), Gaps = 51/218 (23%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGD-YVVDGS------------------  276
            S KRPF++  D++  K   EKRVRFPKGKK+K GD  VVD +                  
Sbjct  9    SAKRPFMEEDDNEFSKKPPEKRVRFPKGKKVKPGDEVVVDKANVEEGEVDLVNAKTATNA  68

Query  277  ----EELPSGWK--------------------------NPRLAA-KERAMRRSQITADLL  363
                E+L    K                          NP++AA KERA  R+QIT++LL
Sbjct  69   AKEREKLRRFLKGKKVKPGDEVVVDKANVEEGEEVDLMNPKIAAAKERAKLRNQITSELL  128

Query  364  DEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDI  543
             EG  G+ ++++ AE  YEDNE FV+DGIQIEPFNL KEREEGYFDA GN+VEYV EN+I
Sbjct  129  SEGAGGITNDLSAAEVTYEDNENFVDDGIQIEPFNLEKEREEGYFDAAGNFVEYVRENEI  188

Query  544  KDAWLDSIDVHPKAAVKTRVITANEDXA-RDLTSEELG  654
            KDAWLD+++V PK A  + V T +ED    DL+S+++G
Sbjct  189  KDAWLDNVEVDPKYAALSSVATNDEDEGPPDLSSKDIG  226



>ref|XP_003593195.1| CD2 antigen cytoplasmic tail-binding protein [Medicago truncatula]
 gb|AES63446.1| CD2 antigen cytoplasmic tail-binding-like protein [Medicago truncatula]
Length=363

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 126/174 (72%), Gaps = 7/174 (4%)
 Frame = +1

Query  142  GPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDG--SEELPSGWKNPRL  312
            G  RSR KRP  +  DD ++ P A KRVRFPKGKK K  + +V+   ++E  +   NP +
Sbjct  5    GSSRSRGKRPLPEDNDDSAKNPPA-KRVRFPKGKKGKPVEVIVEKVIAKEDVNDLSNPAV  63

Query  313  AAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEG  492
            AAKER  RR+QITA+L+ + N G+     +AE  Y++NE FVEDGIQIEPFNL+KEREEG
Sbjct  64   AAKERVKRRNQITAELISDENGGISK---VAEVTYKENENFVEDGIQIEPFNLDKEREEG  120

Query  493  YFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            YFDA+GN+VEYV +N+IKDAWLD+++V P+ A  + V T +E+  ++L+S+++ 
Sbjct  121  YFDASGNFVEYVRDNEIKDAWLDNVEVDPRYAGLSSVATNDEEEVQELSSKDVA  174



>ref|XP_003611728.1| CD2 antigen cytoplasmic tail-binding protein [Medicago truncatula]
 gb|AES94686.1| CD2 antigen cytoplasmic tail-binding-like protein [Medicago truncatula]
Length=238

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = +1

Query  130  MEEGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDG--SEELPSGWK  300
            M   G  RSR KRP  +  DD ++ P A KRVRFPKGKK K  D +V+   +EE  +   
Sbjct  1    MSGEGSSRSRGKRPLPEDNDDSTKNPPA-KRVRFPKGKKGKPVDVIVEKVFAEEDVNDLS  59

Query  301  NPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKE  480
            NP +AAKE+  RR+QITA+L  + N G+     +AE  Y++NE FVEDGIQIEPFNL+KE
Sbjct  60   NPAVAAKEQVKRRNQITAELFSDENGGISK---VAEVIYKENENFVEDGIQIEPFNLDKE  116

Query  481  REEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            REEGYFDA+ N+VEYV +N+IKDAWLD+++V P+ A  +   T +E+  ++L+S+++ 
Sbjct  117  REEGYFDASENFVEYVRDNEIKDAWLDNVEVDPRYARLSSAATNDEEEVQELSSKDVA  174



>ref|XP_003547624.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 homolog 
[Glycine max]
 gb|KHN33523.1| LIN1-like protein [Glycine soja]
Length=405

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 129/218 (59%), Gaps = 51/218 (23%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGD-YVVDGS------------------  276
            S KRPF++  D++  K   EKRVRFPKGKK+K GD  VVD +                  
Sbjct  9    SAKRPFMEEDDNEFSKKPPEKRVRFPKGKKVKPGDEVVVDKANVEEGEVDLVNAKTATNA  68

Query  277  ----EELPSGWK--------------------------NPRLAA-KERAMRRSQITADLL  363
                E+L    K                          NP++AA KERA  R+QIT++LL
Sbjct  69   AKEREKLRRFLKGKKVKPGDEVVVDKANVEEGEEVDLMNPKIAAAKERAKLRNQITSELL  128

Query  364  DEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDI  543
             EG  G+ ++++ AE  YEDNE FV+DGIQIEPFNL KEREEGYFDA GN+VEYV EN+I
Sbjct  129  SEGAGGITNDLSAAEVTYEDNENFVDDGIQIEPFNLEKEREEGYFDAAGNFVEYVRENEI  188

Query  544  KDAWLDSIDVHPKAAVKTRVITANEDXA-RDLTSEELG  654
            KDAWLD+++V PK A  + V T +ED    DL+S+++G
Sbjct  189  KDAWLDNVEVDPKYAALSSVATNDEDEGPPDLSSKDIG  226



>ref|XP_003531549.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Glycine max]
 gb|KHN26744.1| CD2 antigen cytoplasmic tail-binding protein 2 [Glycine soja]
Length=405

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 125/218 (57%), Gaps = 51/218 (23%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGD-------------------------  258
            S KRPF++  DD+  K    KRVRFPKGKK+K GD                         
Sbjct  9    SAKRPFMEEDDDEFSKKPPAKRVRFPKGKKVKPGDEVVVDKANVEEGEEVDLVNAKTATN  68

Query  259  ----------------------YVVDGS--EELPSGWKNPRLAA-KERAMRRSQITADLL  363
                                   VVD +  EE      NP++AA KERA  R+QITA+LL
Sbjct  69   AAKEREKLRRFLKGKKVKPGDEVVVDKANVEEGEVDLMNPKIAAAKERAKLRNQITAELL  128

Query  364  DEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDI  543
             E   G+ ++++ AE  YEDNE FV+DGIQIEPFNL KEREEGYFDA GN+VEY+ EN+I
Sbjct  129  RESAGGITNDLSAAEVTYEDNENFVDDGIQIEPFNLEKEREEGYFDAAGNFVEYIRENEI  188

Query  544  KDAWLDSIDVHPKAAVKTRVITANEDXA-RDLTSEELG  654
            KDAWLD+++V PK A  + V T +ED    DL+S+++G
Sbjct  189  KDAWLDNVEVDPKYAALSSVATDDEDEGPPDLSSKDIG  226



>ref|XP_006828483.1| hypothetical protein AMTR_s00060p00158750 [Amborella trichopoda]
 gb|ERM95899.1| hypothetical protein AMTR_s00060p00158750 [Amborella trichopoda]
Length=436

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 110/159 (69%), Gaps = 8/159 (5%)
 Frame = +1

Query  136  EGGPQRSRKRP---FVDSVDDDSQKPSAEKRVRFPKGKKLKRGD---YVVDGSEELPSGW  297
            EG     R RP   F DS  +D++    E++VRFPKGKK+KR D    V D S E   G 
Sbjct  2    EGPSNLKRPRPPEEFSDSHKEDNRP--RERKVRFPKGKKVKRTDGTSLVKDESGENVIGL  59

Query  298  KNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNK  477
             +PR AAKERA RR+QI A+LL + N G++ +IA AEE YED+  F EDG+QIEPFNL  
Sbjct  60   TDPRFAAKERANRRNQIEAELLSDENTGILDDIAGAEEEYEDDGEFEEDGVQIEPFNLKL  119

Query  478  EREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVK  594
            EREEGYFD+ GNYVEY NENDIKDAWLD+IDV  + A K
Sbjct  120  EREEGYFDSEGNYVEYRNENDIKDAWLDNIDVDGQYARK  158



>ref|XP_010546337.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Tarenaya 
hassleriana]
Length=408

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 116/187 (62%), Gaps = 21/187 (11%)
 Frame = +1

Query  136  EGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLK-------RGDYVVDGSEELPSG  294
            EG  +   KR FVD  + DS    A+KRVRFPKGKK K       +GD     +E +P  
Sbjct  2    EGESRNKLKRSFVD--EGDSSDQPAQKRVRFPKGKKTKPTYEVFHKGD-----AEAVPID  54

Query  295  WKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLN  474
             ++PR AAKERA RR+QIT +L  E   G + ++  AEE YED+    EDGI IE FNLN
Sbjct  55   PRDPRHAAKERAKRRNQITTELFTEDGEGFLDDVTAAEETYEDDGNRSEDGIHIEAFNLN  114

Query  475  KEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVI-------TANEDXARD  633
            KEREEGYFDA+GN+VEY  E +IKDAWLDSI+ +PK   ++          + NE+   +
Sbjct  115  KEREEGYFDADGNFVEYAREKEIKDAWLDSIEANPKYMGRSAANDSGNDEDSGNENTVDE  174

Query  634  LTSEELG  654
            L+ EE+G
Sbjct  175  LSQEEIG  181



>ref|XP_006428140.1| hypothetical protein CICLE_v10025761mg [Citrus clementina]
 gb|ESR41380.1| hypothetical protein CICLE_v10025761mg [Citrus clementina]
Length=377

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 129/207 (62%), Gaps = 42/207 (20%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KR+RFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRIRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYE----------------------------  420
            RA RR+ +T +L  E +RG  ++I+ AE  YE                            
Sbjct  64   RATRRNLMTFELCSEESRGNGNDISAAEVTYEVRICTYSFLMSLLSCSTFHHVLNAITEG  123

Query  421  ---DNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPK---  582
                +E FV+DGIQI+PFNL+KEREEGYFDA GN+VEYVNEN+IKDAWLDS++V  +   
Sbjct  124  YHMGDENFVDDGIQIDPFNLDKEREEGYFDAEGNFVEYVNENEIKDAWLDSLEVDQRYVG  183

Query  583  -AAVKTRVITANEDXARD--LTSEELG  654
             A +  +VI A ED   D  L+SEELG
Sbjct  184  TAVIDNKVIEAQEDKDNDHELSSEELG  210



>ref|XP_006428141.1| hypothetical protein CICLE_v10025761mg [Citrus clementina]
 gb|ESR41381.1| hypothetical protein CICLE_v10025761mg [Citrus clementina]
Length=403

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 129/207 (62%), Gaps = 42/207 (20%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KR+RFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRIRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYE----------------------------  420
            RA RR+ +T +L  E +RG  ++I+ AE  YE                            
Sbjct  64   RATRRNLMTFELCSEESRGNGNDISAAEVTYEVRICTYSFLMSLLSCSTFHHVLNAITEG  123

Query  421  ---DNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPK---  582
                +E FV+DGIQI+PFNL+KEREEGYFDA GN+VEYVNEN+IKDAWLDS++V  +   
Sbjct  124  YHMGDENFVDDGIQIDPFNLDKEREEGYFDAEGNFVEYVNENEIKDAWLDSLEVDQRYVG  183

Query  583  -AAVKTRVITANEDXARD--LTSEELG  654
             A +  +VI A ED   D  L+SEELG
Sbjct  184  TAVIDNKVIEAQEDKDNDHELSSEELG  210



>ref|XP_006428139.1| hypothetical protein CICLE_v10025761mg [Citrus clementina]
 gb|ESR41379.1| hypothetical protein CICLE_v10025761mg [Citrus clementina]
Length=401

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 129/207 (62%), Gaps = 42/207 (20%)
 Frame = +1

Query  154  SRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEE---LPSGWKNPRLAAKE  324
            SRKR F+D  D+DS +   +KR+RFPKGKK+K G   VDG ++    P+G KNP+LAAKE
Sbjct  6    SRKRHFLD--DEDSDEQPMQKRIRFPKGKKVKPGKEAVDGVKDDGDGPTGLKNPQLAAKE  63

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAYE----------------------------  420
            RA RR+ +T +L  E +RG  ++I+ AE  YE                            
Sbjct  64   RATRRNLMTFELCSEESRGNGNDISAAEVTYEVRICTYSFLMSLLSCSTFHHVLNAITEG  123

Query  421  ---DNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPK---  582
                +E FV+DGIQI+PFNL+KEREEGYFDA GN+VEYVNEN+IKDAWLDS++V  +   
Sbjct  124  YHMGDENFVDDGIQIDPFNLDKEREEGYFDAEGNFVEYVNENEIKDAWLDSLEVDQRYVG  183

Query  583  -AAVKTRVITANEDXARD--LTSEELG  654
             A +  +VI A ED   D  L+SEELG
Sbjct  184  TAVIDNKVIEAQEDKDNDHELSSEELG  210



>ref|XP_010690483.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 homolog 
[Beta vulgaris subsp. vulgaris]
Length=376

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 118/179 (66%), Gaps = 8/179 (4%)
 Frame = +1

Query  136  EGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDY----VVDGSEELPS--GW  297
            EG    SRKRPF++  DDDS K + EKRVRFPK KKLK G       V   +EL +    
Sbjct  2    EGASSSSRKRPFLEE-DDDSNK-NKEKRVRFPKKKKLKAGGLPEPVTVKEEDELAALPDL  59

Query  298  KNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNK  477
             +PR AAKERA RR Q+T  L  E     + +IA AE  Y++NE+FV+DGIQ+EPFNL +
Sbjct  60   ADPRHAAKERAKRRGQMTTQLFTEDGEVELAHIASAEVDYKENESFVDDGIQLEPFNLER  119

Query  478  EREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EREEGYFD  GN+VEYV E + KDAWLDS+ + P  A +   I  N+D  ++L+S+++G
Sbjct  120  EREEGYFDEAGNFVEYVLEKEEKDAWLDSLAMDPTLADRVSTIPNNDDEEQELSSDDVG  178



>ref|XP_008790842.1| PREDICTED: LIN1-like protein isoform X2 [Phoenix dactylifera]
Length=423

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 116/177 (66%), Gaps = 11/177 (6%)
 Frame = +1

Query  136  EGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGD---YVVDGSEELPSGWKN  303
            EG  Q SR KRP  D   DDS     ++R RFPK KK K+G+   +  DG EE      +
Sbjct  2    EGKGQSSRPKRPLPD---DDSDPSPLQRRARFPKAKKAKKGNELSFGGDGDEEDFQPRFD  58

Query  304  PRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
             +LAAKERA RRSQ+  + L    R  V +I+ AE  YED+  F EDGI+IEPFNL +ER
Sbjct  59   AQLAAKERAKRRSQLREEEL---FRDQV-DISSAEVHYEDDANFEEDGIRIEPFNLKQER  114

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFD NGN+VEY +++DIKDAWLD+++V  + A K +   + E+  +DL+SE++G
Sbjct  115  EEGYFDENGNFVEYASQHDIKDAWLDNVEVDTRFAKKHQEKVSAEEDYQDLSSEDIG  171



>ref|XP_008790841.1| PREDICTED: LIN1-like protein isoform X1 [Phoenix dactylifera]
Length=424

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 116/177 (66%), Gaps = 11/177 (6%)
 Frame = +1

Query  136  EGGPQRSR-KRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGD---YVVDGSEELPSGWKN  303
            EG  Q SR KRP  D   DDS     ++R RFPK KK K+G+   +  DG EE      +
Sbjct  2    EGKGQSSRPKRPLPD---DDSDPSPLQRRARFPKAKKAKKGNELSFGGDGDEEDFQPRFD  58

Query  304  PRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKER  483
             +LAAKERA RRSQ+  + L    R  V +I+ AE  YED+  F EDGI+IEPFNL +ER
Sbjct  59   AQLAAKERAKRRSQLREEEL---FRDQV-DISSAEVHYEDDANFEEDGIRIEPFNLKQER  114

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFD NGN+VEY +++DIKDAWLD+++V  + A K +   + E+  +DL+SE++G
Sbjct  115  EEGYFDENGNFVEYASQHDIKDAWLDNVEVDTRFAKKHQEKVSAEEDYQDLSSEDIG  171



>ref|XP_009381505.1| PREDICTED: uncharacterized protein LOC103969641 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=409

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 109/176 (62%), Gaps = 19/176 (11%)
 Frame = +1

Query  148  QRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELP-------SGWKNP  306
            + S+KRP     D+    P  ++R RFPKGKK KRG      SE+LP         W +P
Sbjct  3    ETSKKRPL--PPDEFDSPPPEQRRARFPKGKKAKRG------SEDLPFHGDGGDGNWMDP  54

Query  307  RLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKERE  486
            +LAAKERA RR+Q   + +     G   ++   E  YEDN  F +DGIQIEPFNL +ERE
Sbjct  55   QLAAKERAKRRNQTRENEV----LGDQVDVFSGEIQYEDNVNFEDDGIQIEPFNLKQERE  110

Query  487  EGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EGYFDANGN+VEY  +N+IKDAWLD+++V  +   K +  +  E+   DL+S+++G
Sbjct  111  EGYFDANGNFVEYTRQNEIKDAWLDNVEVDTRFVGKFQPKSTAEEVYEDLSSDDIG  166



>ref|XP_010939639.1| PREDICTED: LIN1-like protein isoform X2 [Elaeis guineensis]
Length=438

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 14/180 (8%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV---DGSEELPSGWK  300
            MEE G     KRP  D   D++     ++RVRFPKGKK K+G+ +    DG EE      
Sbjct  1    MEEKGQSSRPKRPLPD---DETDPSPPQRRVRFPKGKKAKKGNDLSLGGDGDEEDFQLRL  57

Query  301  NPRLAAKERAMRRSQITADLL--DEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLN  474
             P+LAAKERA RR+Q+  + L  D+ +      I  AE  YEDN  F EDGI+IEPFNL 
Sbjct  58   APQLAAKERAKRRNQLREEELFRDQAD------ITSAEVHYEDNSNFEEDGIRIEPFNLK  111

Query  475  KEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            +EREEGYFD +GN+VEY ++++IKDAWLD+++V  + A K +     E+  +DL+SE++G
Sbjct  112  QEREEGYFDESGNFVEYASQHEIKDAWLDNVEVDGRFAEKHQEKVTAEEDYQDLSSEDIG  171



>ref|XP_010939641.1| PREDICTED: LIN1-like protein isoform X4 [Elaeis guineensis]
Length=407

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 14/180 (8%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV---DGSEELPSGWK  300
            MEE G     KRP  D   D++     ++RVRFPKGKK K+G+ +    DG EE      
Sbjct  1    MEEKGQSSRPKRPLPD---DETDPSPPQRRVRFPKGKKAKKGNDLSLGGDGDEEDFQLRL  57

Query  301  NPRLAAKERAMRRSQITADLL--DEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLN  474
             P+LAAKERA RR+Q+  + L  D+ +      I  AE  YEDN  F EDGI+IEPFNL 
Sbjct  58   APQLAAKERAKRRNQLREEELFRDQAD------ITSAEVHYEDNSNFEEDGIRIEPFNLK  111

Query  475  KEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            +EREEGYFD +GN+VEY ++++IKDAWLD+++V  + A K +     E+  +DL+SE++G
Sbjct  112  QEREEGYFDESGNFVEYASQHEIKDAWLDNVEVDGRFAEKHQEKVTAEEDYQDLSSEDIG  171



>ref|XP_010939640.1| PREDICTED: LIN1-like protein isoform X3 [Elaeis guineensis]
Length=428

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 14/180 (8%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV---DGSEELPSGWK  300
            MEE G     KRP  D   D++     ++RVRFPKGKK K+G+ +    DG EE      
Sbjct  1    MEEKGQSSRPKRPLPD---DETDPSPPQRRVRFPKGKKAKKGNDLSLGGDGDEEDFQLRL  57

Query  301  NPRLAAKERAMRRSQITADLL--DEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLN  474
             P+LAAKERA RR+Q+  + L  D+ +      I  AE  YEDN  F EDGI+IEPFNL 
Sbjct  58   APQLAAKERAKRRNQLREEELFRDQAD------ITSAEVHYEDNSNFEEDGIRIEPFNLK  111

Query  475  KEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            +EREEGYFD +GN+VEY ++++IKDAWLD+++V  + A K +     E+  +DL+SE++G
Sbjct  112  QEREEGYFDESGNFVEYASQHEIKDAWLDNVEVDGRFAEKHQEKVTAEEDYQDLSSEDIG  171



>ref|XP_010939638.1| PREDICTED: LIN1-like protein isoform X1 [Elaeis guineensis]
Length=457

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 14/180 (8%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV---DGSEELPSGWK  300
            MEE G     KRP  D   D++     ++RVRFPKGKK K+G+ +    DG EE      
Sbjct  1    MEEKGQSSRPKRPLPD---DETDPSPPQRRVRFPKGKKAKKGNDLSLGGDGDEEDFQLRL  57

Query  301  NPRLAAKERAMRRSQITADLL--DEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLN  474
             P+LAAKERA RR+Q+  + L  D+ +      I  AE  YEDN  F EDGI+IEPFNL 
Sbjct  58   APQLAAKERAKRRNQLREEELFRDQAD------ITSAEVHYEDNSNFEEDGIRIEPFNLK  111

Query  475  KEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            +EREEGYFD +GN+VEY ++++IKDAWLD+++V  + A K +     E+  +DL+SE++G
Sbjct  112  QEREEGYFDESGNFVEYASQHEIKDAWLDNVEVDGRFAEKHQEKVTAEEDYQDLSSEDIG  171



>gb|EPS61335.1| hypothetical protein M569_13462, partial [Genlisea aurea]
Length=330

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 105/148 (71%), Gaps = 3/148 (2%)
 Frame = +1

Query  211  EKRVRFPKGKKLKRGDYVVDG-SEELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMV  387
            EKRVRFPKGKK+K  D  VD   EE+PS  K+PRLAA++RA RR+    +  D+      
Sbjct  1    EKRVRFPKGKKVKVADKTVDVVGEEIPS--KDPRLAARDRAARRNTFLEEHTDDVINDRG  58

Query  388  HNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSI  567
             ++  AE  YEDNETFVE+GI ++PFNL KEREEG+FD NGNYVEY+N N++KDAWLDS+
Sbjct  59   SDVKKAEVQYEDNETFVEEGIAVDPFNLEKEREEGFFDENGNYVEYINRNEVKDAWLDSL  118

Query  568  DVHPKAAVKTRVITANEDXARDLTSEEL  651
            D H K   K+ + T ++D   +L++E L
Sbjct  119  DSHTKYTGKSSIPTISDDKPVELSTEVL  146



>ref|XP_009381504.1| PREDICTED: uncharacterized protein LOC103969641 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 109/177 (62%), Gaps = 20/177 (11%)
 Frame = +1

Query  148  QRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELP-------SGWKNP  306
            + S+KRP     D+    P  ++R RFPKGKK KRG      SE+LP         W +P
Sbjct  3    ETSKKRPL--PPDEFDSPPPEQRRARFPKGKKAKRG------SEDLPFHGDGGDGNWMDP  54

Query  307  RLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE-DNETFVEDGIQIEPFNLNKER  483
            +LAAKERA RR+Q   + +     G   ++   E  YE DN  F +DGIQIEPFNL +ER
Sbjct  55   QLAAKERAKRRNQTRENEV----LGDQVDVFSGEIQYEQDNVNFEDDGIQIEPFNLKQER  110

Query  484  EEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            EEGYFDANGN+VEY  +N+IKDAWLD+++V  +   K +  +  E+   DL+S+++G
Sbjct  111  EEGYFDANGNFVEYTRQNEIKDAWLDNVEVDTRFVGKFQPKSTAEEVYEDLSSDDIG  167



>ref|XP_002871367.1| hypothetical protein ARALYDRAFT_487751 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47626.1| hypothetical protein ARALYDRAFT_487751 [Arabidopsis lyrata subsp. 
lyrata]
Length=351

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 116/182 (64%), Gaps = 16/182 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  D+DS K   EKRVRFPKGKK K G+ ++   EE     +  R
Sbjct  1    MAESSSRKNLKRSFLE--DEDSNKQPPEKRVRFPKGKKSK-GEQLL---EEEAVARRKAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AAKERA  R+Q TA+L  E +     +I  A+E YED+    EDGIQIE F+L++E+EE
Sbjct  55   DAAKERAHIRNQNTANLFIENDN---DDIDAAQETYEDDGNRTEDGIQIEAFSLDREKEE  111

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP-----KAAVKTRV--ITANEDXARDLTSEE  648
            GYFDA+GN+VEYV E ++KDAWLDSI+ +P      AA  T     + NE  A DL+ +E
Sbjct  112  GYFDADGNFVEYVREKEVKDAWLDSIEKNPMYMGRSAANDTEKDEDSGNEKVADDLSQDE  171

Query  649  LG  654
            +G
Sbjct  172  IG  173



>ref|NP_001031859.1| CD2 antigen cytoplasmic tail-binding protein 2  [Arabidopsis 
thaliana]
 gb|AED91386.1| CD2 antigen cytoplasmic tail-binding protein 2 [Arabidopsis thaliana]
Length=349

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 110/182 (60%), Gaps = 16/182 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M +   +R+ KR F++  D D Q P  EKRVRFPKGKK K    +    EE     +  R
Sbjct  1    MADSSSRRNLKRSFLEDEDSDKQPP--EKRVRFPKGKKSKPEQLL----EEEALARRKAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AAKERA  R+Q T  L  E +     +I  A+E YED+    EDGIQIE F+L++E+EE
Sbjct  55   DAAKERAKIRNQNTTKLFIEDDS---DDINQAQETYEDDGNRTEDGIQIEAFSLDREKEE  111

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP-----KAAVKTRV--ITANEDXARDLTSEE  648
            GYFDA+GN+VEYV E ++KDAWLDSI+ +P      AA  T +   + NE    DL+ +E
Sbjct  112  GYFDADGNFVEYVREKEVKDAWLDSIEKNPMYMGRSAANDTEMDDDSGNEKAGDDLSQDE  171

Query  649  LG  654
            +G
Sbjct  172  IG  173



>ref|XP_007209261.1| hypothetical protein PRUPE_ppa007353mg [Prunus persica]
 gb|EMJ10460.1| hypothetical protein PRUPE_ppa007353mg [Prunus persica]
Length=371

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 101/161 (63%), Gaps = 15/161 (9%)
 Frame = +1

Query  130  MEEGGPQRSR-KRPFVDSVDDDSQ---KPSAEKRVRFPKGKKLKRGDYVVD-----GSEE  282
            ME   P RS  KR  +    D      KP+AEKRVRFPKGKK + GD  V+       +E
Sbjct  1    MESNQPSRSNLKRKVISEESDSDSDSGKPTAEKRVRFPKGKKARLGDEAVNIRRAEDDDE  60

Query  283  LPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE--DNETFVEDGIQI  456
            +  G  +PR AAKER  RRSQ   D    G  G+  +++ AE +YE  D+E  +EDGI I
Sbjct  61   IGIGLADPRSAAKEREKRRSQRNHDRF--GEDGIGEDVSKAEVSYEGLDSENLMEDGIPI  118

Query  457  EPFNLNKEREEGYFDANGNYVEYV--NENDIKDAWLDSIDV  573
            EPFNL+KEREEGYFDA+GN+VEY    +N +KDAWLDS++ 
Sbjct  119  EPFNLDKEREEGYFDADGNFVEYAPNEKNKVKDAWLDSVEA  159



>emb|CAC05465.1| putative protein [Arabidopsis thaliana]
Length=354

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 111/185 (60%), Gaps = 17/185 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKP---SAEKRVRFPKGKKLKRGDYVVDGSEELPSGWK  300
            M +   +R+ KR F++  D D Q P    +EKRVRFPKGKK K    +    EE     +
Sbjct  1    MADSSSRRNLKRSFLEDEDSDKQPPILSGSEKRVRFPKGKKSKPEQLL----EEEALARR  56

Query  301  NPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKE  480
              R AAKERA  R+Q T  L  E +     +I  A+E YED+    EDGIQIE F+L++E
Sbjct  57   KARDAAKERAKIRNQNTTKLFIEDDS---DDINQAQETYEDDGNRTEDGIQIEAFSLDRE  113

Query  481  REEGYFDANGNYVEYVNENDIKDAWLDSIDVHP-----KAAVKTRV--ITANEDXARDLT  639
            +EEGYFDA+GN+VEYV E ++KDAWLDSI+ +P      AA  T +   + NE    DL+
Sbjct  114  KEEGYFDADGNFVEYVREKEVKDAWLDSIEKNPMYMGRSAANDTEMDDDSGNEKAGDDLS  173

Query  640  SEELG  654
             +E+G
Sbjct  174  QDEIG  178



>ref|NP_568211.1| CD2 antigen cytoplasmic tail-binding protein 2  [Arabidopsis 
thaliana]
 gb|AAM62448.1| unknown [Arabidopsis thaliana]
 gb|AAM74500.1| AT5g09390/T5E8_190 [Arabidopsis thaliana]
 gb|AAN18131.1| At5g09390/T5E8_190 [Arabidopsis thaliana]
 gb|AED91385.1| CD2 antigen cytoplasmic tail-binding protein 2 [Arabidopsis thaliana]
Length=351

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 110/182 (60%), Gaps = 16/182 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M +   +R+ KR F++  D D Q P  EKRVRFPKGKK K    +    EE     +  R
Sbjct  1    MADSSSRRNLKRSFLEDEDSDKQPP--EKRVRFPKGKKSKPEQLL----EEEALARRKAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AAKERA  R+Q T  L  E +     +I  A+E YED+    EDGIQIE F+L++E+EE
Sbjct  55   DAAKERAKIRNQNTTKLFIEDD---SDDINQAQETYEDDGNRTEDGIQIEAFSLDREKEE  111

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP-----KAAVKTRV--ITANEDXARDLTSEE  648
            GYFDA+GN+VEYV E ++KDAWLDSI+ +P      AA  T +   + NE    DL+ +E
Sbjct  112  GYFDADGNFVEYVREKEVKDAWLDSIEKNPMYMGRSAANDTEMDDDSGNEKAGDDLSQDE  171

Query  649  LG  654
            +G
Sbjct  172  IG  173



>ref|NP_001143950.1| hypothetical protein [Zea mays]
 gb|ACF85397.1| unknown [Zea mays]
 tpg|DAA61216.1| TPA: hypothetical protein ZEAMMB73_322343 [Zea mays]
Length=423

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 105/185 (57%), Gaps = 18/185 (10%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSG-----  294
            ME   P R  KRP   +  DD      E++ RFPKGKK K  D    G+E  PSG     
Sbjct  1    METTEPSRGTKRPLTATAGDDDD-AGLERKPRFPKGKKAKYRDV---GAEGGPSGNAVDL  56

Query  295  --WKNPRLAAKERAMRRSQITADLLDEGN--RGMVHNIALAEEAYEDNETFVEDGIQIEP  462
                NP LAA+ RA +R       L EG+  +G    +   E  Y D+  FV+DGI+IEP
Sbjct  57   DSMLNPELAAERRARQRHV----QLKEGDDAKGGAAEVKGFEVRYNDSVNFVDDGIRIEP  112

Query  463  FNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE-DXARDLT  639
            FNL +EREEGYFD NGN+VEY   N+IKDAWLDS++V P  A K +     + D   DL+
Sbjct  113  FNLEREREEGYFDENGNFVEYARGNEIKDAWLDSVEVDPTYAAKVQNKGKEKVDEFEDLS  172

Query  640  SEELG  654
            S+++G
Sbjct  173  SDDIG  177



>dbj|BAK03908.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 111/196 (57%), Gaps = 16/196 (8%)
 Frame = +1

Query  97   TNCSELRRR*AMEEGGPQRSRKRPFVDSV---DDDSQKPSAEKRVRFPKGKKLKRGDYVV  267
            T+ +  RRR  ME   PQR  KRP   +     DD +    +++VRFPKGKK K  D   
Sbjct  14   TDAASARRR-PMEPTAPQRGTKRPLPGTAAGDQDDDRSALGDRKVRFPKGKKAKHRDPAA  72

Query  268  DGSE-------ELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDN  426
             GS        E      NP LAA +RA RR +   D     +     N+   E  Y+D+
Sbjct  73   AGSSGEGGAAAEDIDDLMNPELAAVKRARRRHRRDGD-----DTQGTANVKGFEMRYKDD  127

Query  427  ETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVI  606
              F++DGI+IEPFNL +EREEGYFD NGN+VE+   ND+KDAWLD+++V  K A K +  
Sbjct  128  ANFIDDGIEIEPFNLEQEREEGYFDENGNFVEFARGNDMKDAWLDNVEVDTKFAGKVQKK  187

Query  607  TANEDXARDLTSEELG  654
               E+  +DL+S+++G
Sbjct  188  KDKEEEFQDLSSDDIG  203



>ref|XP_010452927.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Camelina sativa]
Length=353

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 98/150 (65%), Gaps = 7/150 (5%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  D D Q P  EKRVRFPKGKK K    +    EE     +N R
Sbjct  1    MAESSSRKNLKRSFLEDEDSDKQPP--EKRVRFPKGKKSKPEQLL----EEEAIARRNAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AA+ERA  R+Q TA L ++       NI  A+E YE++    EDGIQIE F+L++E+EE
Sbjct  55   DAAEERARHRNQNTAQLFNDNED-DNDNIDEAQETYENDGNRTEDGIQIEAFSLDREKEE  113

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP  579
            GYFDA+GN+VEYV E ++KDAWLDSI+ +P
Sbjct  114  GYFDADGNFVEYVREKEVKDAWLDSIEKNP  143



>ref|XP_004974125.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
isoform X2 [Setaria italica]
Length=427

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 105/184 (57%), Gaps = 17/184 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWK---  300
            ME   P R  KRP     DDD+ +   E++ RFPKGKK K   Y   G+E  PS      
Sbjct  1    MEPAEPTRGTKRPLAGEDDDDAGR---ERKPRFPKGKKAK---YRDPGAEGGPSAAAAVD  54

Query  301  -----NPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPF  465
                 NP LAA+ RA +R     D  DE  +G   +I   E  Y D   FV+DGI+IEPF
Sbjct  55   IDSMLNPELAAERRARQRHGQVRDG-DEA-KGGASDIKGFEVRYSDGVNFVDDGIRIEPF  112

Query  466  NLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE-DXARDLTS  642
            NL +EREEGYFD NGN+VEY   N+IKDAWLDS++V P    K +     + +  +DL+S
Sbjct  113  NLEREREEGYFDENGNFVEYARGNEIKDAWLDSVEVDPTFVAKVQNKGKEKVEEFQDLSS  172

Query  643  EELG  654
            +++G
Sbjct  173  DDIG  176



>ref|XP_004974124.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
isoform X1 [Setaria italica]
Length=430

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 105/184 (57%), Gaps = 17/184 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWK---  300
            ME   P R  KRP     DDD+ +   E++ RFPKGKK K   Y   G+E  PS      
Sbjct  1    MEPAEPTRGTKRPLAGEDDDDAGR---ERKPRFPKGKKAK---YRDPGAEGGPSAAAAVD  54

Query  301  -----NPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPF  465
                 NP LAA+ RA +R     D  DE  +G   +I   E  Y D   FV+DGI+IEPF
Sbjct  55   IDSMLNPELAAERRARQRHGQVRDG-DEA-KGGASDIKGFEVRYSDGVNFVDDGIRIEPF  112

Query  466  NLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE-DXARDLTS  642
            NL +EREEGYFD NGN+VEY   N+IKDAWLDS++V P    K +     + +  +DL+S
Sbjct  113  NLEREREEGYFDENGNFVEYARGNEIKDAWLDSVEVDPTFVAKVQNKGKEKVEEFQDLSS  172

Query  643  EELG  654
            +++G
Sbjct  173  DDIG  176



>gb|ACG36671.1| hypothetical protein [Zea mays]
Length=423

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 105/185 (57%), Gaps = 18/185 (10%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSG-----  294
            ME   P R  KRP   +  DD      E++ RFPKGKK K  D    G+E  PSG     
Sbjct  1    METTEPSRGTKRPLTATAGDDDD-AGLERKPRFPKGKKAKYRDV---GAEGGPSGNAVDL  56

Query  295  --WKNPRLAAKERAMRRSQITADLLDEGN--RGMVHNIALAEEAYEDNETFVEDGIQIEP  462
                NP LA + RA R+  +    L EG+  +G    +   E  Y D+  FV+DGI+IEP
Sbjct  57   DSMLNPELAXERRA-RQXXVQ---LKEGDDAKGGAAEVKGFEVRYNDSVNFVDDGIRIEP  112

Query  463  FNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE-DXARDLT  639
            FNL +EREEGYFD NGN+VEY   N+IKDAWLDS++V P  A K +     + D   DL+
Sbjct  113  FNLEREREEGYFDENGNFVEYARGNEIKDAWLDSVEVDPTYAAKVQNKGKEKVDEFEDLS  172

Query  640  SEELG  654
            S+++G
Sbjct  173  SDDIG  177



>ref|XP_002460146.1| hypothetical protein SORBIDRAFT_02g023395 [Sorghum bicolor]
 gb|EER96667.1| hypothetical protein SORBIDRAFT_02g023395 [Sorghum bicolor]
Length=181

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 105/185 (57%), Gaps = 18/185 (10%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSG-----  294
            ME   P R  KRP   +  DD      E++ RFPKGKK K   Y   G+E  PSG     
Sbjct  1    MEPTEPSRGTKRPLTATAGDDDDD-GRERKPRFPKGKKAK---YRDAGAEGGPSGNAVDL  56

Query  295  --WKNPRLAAKERAMRRSQITADLLDEGN--RGMVHNIALAEEAYEDNETFVEDGIQIEP  462
                NP LAA+ RA +R       L EG+  +G   ++   E  Y D   FV+DGI+IEP
Sbjct  57   DSMLNPELAAERRARQRHG----QLKEGDDAKGGAADVKGFEVRYNDGVNFVDDGIRIEP  112

Query  463  FNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE-DXARDLT  639
            FNL +EREEGYFD NGN+VEY   N+IKDAWLDS++V P  A K +     + +   DL+
Sbjct  113  FNLEREREEGYFDENGNFVEYARGNEIKDAWLDSVEVDPTYAAKVQKKGKEKVEEFEDLS  172

Query  640  SEELG  654
            S+++G
Sbjct  173  SDDIG  177



>ref|XP_006287920.1| hypothetical protein CARUB_v10001155mg [Capsella rubella]
 gb|EOA20818.1| hypothetical protein CARUB_v10001155mg [Capsella rubella]
Length=387

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 96/150 (64%), Gaps = 7/150 (5%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  D D Q P  EKRVRFPKGKK K    +    EE     +  R
Sbjct  35   MAESSSRKNLKRSFLEDEDSDKQPP--EKRVRFPKGKKSKPEQLL----EEEAIARRKAR  88

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AAKERA  R+Q TA L    N     NI  A+E YE++    EDGIQIE F+L++E+EE
Sbjct  89   DAAKERAKIRNQNTAQLF-ADNENDNDNIDEAQETYENDGNRTEDGIQIEAFSLDREKEE  147

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP  579
            GYFDA+GN+VEYV E ++KDAWLDSI+ +P
Sbjct  148  GYFDADGNFVEYVREKEVKDAWLDSIEKNP  177



>ref|XP_009122513.1| PREDICTED: protein LIN1 [Brassica rapa]
Length=337

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 96/150 (64%), Gaps = 11/150 (7%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  D D Q P  EKRVRFPKGKK K    V    EE     +  R
Sbjct  1    MAESSSRKNLKRSFLEDEDSDKQPP--EKRVRFPKGKKPKPEQIV----EEDTIARRQAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AA ERA  R+  TA L  + + G+ H    AEE YE++    EDGIQIE F+L++E+EE
Sbjct  55   DAALERARLRNLNTASLFTDDD-GVDH----AEEIYENDGNRTEDGIQIEAFSLDREKEE  109

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP  579
            GYFDA+GNYVEYV E + KDAWLDSI+++P
Sbjct  110  GYFDADGNYVEYVREKEDKDAWLDSIEMNP  139



>emb|CDY21579.1| BnaC09g47130D [Brassica napus]
Length=337

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 94/150 (63%), Gaps = 11/150 (7%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  D D Q P  EKRVRFPKGKK K    V    EE     +  R
Sbjct  1    MAESSSRKNLKRSFLEDEDSDKQPP--EKRVRFPKGKKPKPEQIV----EEDTVARRQAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AA ERA  R+  TA L  + +      I  AEE YE++    EDGIQIE F+L++E+EE
Sbjct  55   DAALERARLRNLNTASLFTDDD-----GIDQAEEIYENDGNRTEDGIQIEAFSLDREKEE  109

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP  579
            GYFDA+GNYVEYV E + KDAWLDSI+++P
Sbjct  110  GYFDADGNYVEYVREKEDKDAWLDSIEMNP  139



>ref|XP_008239376.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Prunus mume]
Length=387

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 97/163 (60%), Gaps = 17/163 (10%)
 Frame = +1

Query  130  MEEGGPQRSR-KRPFVDSVDDDSQ---KPSAEKRVRFPKGKKLKRGDYVV-------DGS  276
            ME   P RS  KR  +    D      KP+AEKR+RFPKGKK + GD  V       D  
Sbjct  1    MESNQPSRSNLKRKVISEESDSDSDSGKPTAEKRLRFPKGKKARLGDEAVNIRRAEDDDE  60

Query  277  EELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE--DNETFVEDGI  450
              +  G  +P  AAKER  RRSQ   D    G  G+  +++ AE +YE  D+E  +E GI
Sbjct  61   IGIGIGLADPHSAAKEREKRRSQRNHDRF--GEDGIGEDVSKAEVSYEGLDSENLMEGGI  118

Query  451  QIEPFNLNKEREEGYFDANGNYVEYV--NENDIKDAWLDSIDV  573
             IEPFNL+KEREEGYFDA+GN+VEY    +N +KDAWLDS++ 
Sbjct  119  PIEPFNLDKEREEGYFDADGNFVEYAPNEKNQVKDAWLDSVEA  161



>ref|XP_008374343.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Malus domestica]
 ref|XP_008346714.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Malus domestica]
Length=381

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 109/186 (59%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  MEEGGPQRS-RKRPF--VDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV------DGSEE  282
            ME   P RS RKRP   +   D DS +P+AE++V+FPKGKK KR D  V      +  +E
Sbjct  1    MEPDLPSRSNRKRPIPELSDSDSDSDRPTAERKVKFPKGKKAKREDEPVKIRRADEDDDE  60

Query  283  LPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE---DNETFVEDGIQ  453
            +   + +PR AAKER  RR          G+ G+  +++ AE AY    D + FV+DGIQ
Sbjct  61   IGGEFPDPRFAAKEREKRRRF--------GDDGIGDDVSAAEVAYGEELDYDNFVDDGIQ  112

Query  454  IEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITA-NEDXAR  630
            ++PFNL KER+EGYFDA GN+VEY   N +KDAWLDS++       K  V     ED A 
Sbjct  113  MDPFNLEKERKEGYFDAEGNFVEYAEGNRVKDAWLDSVEA---GVTKLHVPKPKTEDDAA  169

Query  631  DLTSEE  648
            DL  E+
Sbjct  170  DLPPED  175



>emb|CDX69908.1| BnaA10g22570D [Brassica napus]
Length=337

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 94/150 (63%), Gaps = 11/150 (7%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  D D Q P  EKRVRFPKGKK K    V    EE     +  R
Sbjct  1    MAESSSRKNLKRSFLEDEDSDKQPP--EKRVRFPKGKKPKPEQIV----EEDTVARRQAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AA ERA  R+  TA L  + +      +  AEE YE++    EDGIQIE F+L++E+EE
Sbjct  55   DAALERARLRNLNTASLFTDDD-----GVDQAEEIYENDGNRTEDGIQIEAFSLDREKEE  109

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP  579
            GYFDA+GNYVEYV E + KDAWLDSI+++P
Sbjct  110  GYFDADGNYVEYVREKEDKDAWLDSIEMNP  139



>ref|XP_010268033.1| PREDICTED: LIN1-like protein isoform X2 [Nelumbo nucifera]
Length=351

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +1

Query  346  ITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEY  525
            +TA+L  E   G+ H+++ AE  YEDN   V+DGIQIEPFNL +EREEGYFDA GN+VEY
Sbjct  1    MTAELFREETHGIFHDVSSAEVTYEDNAELVDDGIQIEPFNLEQEREEGYFDAQGNFVEY  60

Query  526  VNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
              EN+IKDAWLDS ++  + A K      NE+   DL+S+++G
Sbjct  61   FRENEIKDAWLDSAEIDTRFAEKNLETAKNEEDIHDLSSKDIG  103



>ref|XP_010238121.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Brachypodium distachyon]
Length=380

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 103/181 (57%), Gaps = 11/181 (6%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSV---DDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPS---  291
            ME   PQR  KRP + +    DDD +    ++RVRFPKGKK K  D              
Sbjct  1    MEPTAPQRGTKRPLLATTAGDDDDGRSALEDRRVRFPKGKKAKYRDPAAAEGGAASEDID  60

Query  292  GWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNL  471
               NP LAA  RA RR +   D     +     ++   E  Y+D+  F++DGIQIEPFNL
Sbjct  61   SLMNPELAAVRRARRRHRRDGD-----DTQGTSDVKGFEMRYKDDANFIDDGIQIEPFNL  115

Query  472  NKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEEL  651
             +EREEGYFD NGN+VE+   ND+KDAWLD+++V  K A K +     E+  +DL+S+++
Sbjct  116  EQEREEGYFDENGNFVEFARGNDMKDAWLDNVEVDTKYAEKVQKKKDKEEEFQDLSSDDI  175

Query  652  G  654
            G
Sbjct  176  G  176



>ref|XP_010238120.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Brachypodium distachyon]
Length=406

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 103/181 (57%), Gaps = 11/181 (6%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSV---DDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPS---  291
            ME   PQR  KRP + +    DDD +    ++RVRFPKGKK K  D              
Sbjct  1    MEPTAPQRGTKRPLLATTAGDDDDGRSALEDRRVRFPKGKKAKYRDPAAAEGGAASEDID  60

Query  292  GWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNL  471
               NP LAA  RA RR +   D     +     ++   E  Y+D+  F++DGIQIEPFNL
Sbjct  61   SLMNPELAAVRRARRRHRRDGD-----DTQGTSDVKGFEMRYKDDANFIDDGIQIEPFNL  115

Query  472  NKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEEL  651
             +EREEGYFD NGN+VE+   ND+KDAWLD+++V  K A K +     E+  +DL+S+++
Sbjct  116  EQEREEGYFDENGNFVEFARGNDMKDAWLDNVEVDTKYAEKVQKKKDKEEEFQDLSSDDI  175

Query  652  G  654
            G
Sbjct  176  G  176



>ref|XP_004299178.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Fragaria 
vesca subsp. vesca]
Length=396

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 104/167 (62%), Gaps = 10/167 (6%)
 Frame = +1

Query  184  DDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEEL-PSGWKNPRLAAKERAMRRSQITADL  360
            DD S K    K+VRFPKGKK+K  D      + + P+   +P LAAKERA RRS+    L
Sbjct  13   DDTSAKAPPAKKVRFPKGKKVKPEDEKARVGDAIGPTPHTDPSLAAKERAKRRSEEKVKL  72

Query  361  LDEGNRGMVHNI-ALAEEAYEDN-ETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNE  534
              E  +    +  A  +EA +   + FVEDG+Q EPFNL KE+EEGYFDA+GN+VEYV++
Sbjct  73   SGEIAKLYTDDDDASGDEARKSGRQNFVEDGMQFEPFNLEKEKEEGYFDADGNFVEYVDK  132

Query  535  NDIKDAWLDSID--VHPK-----AAVKTRVITANEDXARDLTSEELG  654
            N +KDAWLDS++  V P+     AA        +++  +DL+S+E+G
Sbjct  133  NQVKDAWLDSLNKAVDPETTRKFAAKNGDGGEGDDEGGQDLSSDEIG  179



>ref|XP_009333892.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Pyrus x bretschneideri]
Length=381

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 109/186 (59%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  MEEGGPQRS-RKRPF--VDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV------DGSEE  282
            ME   P RS RKRP   +   D DS +P+AE++V+FPKGKK KR D  V      +  +E
Sbjct  1    MEPDLPSRSNRKRPIPELSDSDSDSDRPTAERKVKFPKGKKAKREDEPVRIRRADEDDDE  60

Query  283  LPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE---DNETFVEDGIQ  453
            +   + +PR AAKER  RR          G+ G+   ++ AE AY    D + FV+DGIQ
Sbjct  61   IGDEFPDPRFAAKEREKRRRF--------GDDGIGDAVSAAEVAYGEELDYDNFVDDGIQ  112

Query  454  IEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRV-ITANEDXAR  630
            ++PFNL KER+EGYFDA GN+VEY   N +KDAWLDS++       K  V I   ED A 
Sbjct  113  MDPFNLEKERKEGYFDAEGNFVEYAEGNRVKDAWLDSVEA---GVTKLHVPIPKAEDDAA  169

Query  631  DLTSEE  648
            DL  E+
Sbjct  170  DLPPED  175



>ref|XP_008392871.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Malus domestica]
Length=380

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 97/160 (61%), Gaps = 19/160 (12%)
 Frame = +1

Query  130  MEEGGPQRS-RKRPF--VDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV------DGSEE  282
            ME   P RS RKRP   +   D DS +P+AE+RV+FPKGKK +R D  V      +  +E
Sbjct  1    MEPNLPSRSNRKRPVPELSDSDSDSDRPTAERRVKFPKGKKARREDEPVKIPRADEDDDE  60

Query  283  LPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE---DNETFVEDGIQ  453
            +   + +PR AAKER  RR      +          +++ AE AY    D + FVEDGIQ
Sbjct  61   IGVEFPDPRFAAKEREKRRRFGDDGI-------GGDDVSAAEVAYGEELDYDNFVEDGIQ  113

Query  454  IEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDV  573
            +EPFNL KER+EGYFDA GN+VEY   N +KDAWLDS++ 
Sbjct  114  MEPFNLEKERKEGYFDAEGNFVEYAEGNRVKDAWLDSVEA  153



>ref|XP_009359513.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Pyrus x bretschneideri]
Length=382

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 97/160 (61%), Gaps = 19/160 (12%)
 Frame = +1

Query  130  MEEGGPQRS-RKRPF--VDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVV------DGSEE  282
            ME   P RS RKRP   +   D DS +P+AE+RV+FPKGKK +R D  V      +  +E
Sbjct  1    MEPNLPSRSNRKRPVPEISDSDSDSDRPTAERRVKFPKGKKARREDEPVKIPRADEDDDE  60

Query  283  LPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE---DNETFVEDGIQ  453
            +   + +PR AAKER  RR      +          +++ AE  Y+   D + FVEDGIQ
Sbjct  61   IGVEFPDPRFAAKEREKRRRFGDDGI-------GGDDVSAAEVVYDEELDYDNFVEDGIQ  113

Query  454  IEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDV  573
            +EPFNL KER+EGYFDA GN+VEY   N +KDAWLDS++ 
Sbjct  114  MEPFNLEKERKEGYFDAEGNFVEYAEGNRVKDAWLDSVEA  153



>ref|XP_006369337.1| hypothetical protein POPTR_0001s21330g [Populus trichocarpa]
 gb|ERP65906.1| hypothetical protein POPTR_0001s21330g [Populus trichocarpa]
Length=280

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +1

Query  418  EDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKT  597
            ++NE FVEDGIQIEPFNL KEREEGYFDA GN+VEY+N+N+IKDAWLDSI V P+ A K 
Sbjct  22   QENENFVEDGIQIEPFNLEKEREEGYFDAEGNFVEYINQNEIKDAWLDSIQVDPRYAGKN  81

Query  598  RVITANE----DXARDLTSEELG  654
              +  NE    D  R+L+S+E+G
Sbjct  82   STVRINEHDDKDDVRELSSKEIG  104



>ref|XP_006399414.1| hypothetical protein EUTSA_v10013574mg [Eutrema salsugineum]
 gb|ESQ40867.1| hypothetical protein EUTSA_v10013574mg [Eutrema salsugineum]
Length=438

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 96/151 (64%), Gaps = 12/151 (8%)
 Frame = +1

Query  127  AMEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNP  306
             M E   +++ KR F++  D D Q P  EKRVRFPKGKK K    + +G+          
Sbjct  72   TMAENSSRKNLKRSFLEDEDSDKQPP--EKRVRFPKGKKSKPEQTLEEGAVARRQA----  125

Query  307  RLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKERE  486
            R AA ERA  R+Q TA+L       +  +   AEE YE++E   EDGIQIE F+L++E+E
Sbjct  126  RAAALERAQIRNQSTAELF------IGDDNDEAEETYENDENRTEDGIQIEAFSLDREKE  179

Query  487  EGYFDANGNYVEYVNENDIKDAWLDSIDVHP  579
            EGYFDA+GN+VEYV E ++KDAWLDSI+ +P
Sbjct  180  EGYFDADGNFVEYVREKEVKDAWLDSIETNP  210



>gb|EMS65905.1| hypothetical protein TRIUR3_15046 [Triticum urartu]
Length=279

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 103/206 (50%), Gaps = 31/206 (15%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSV---DDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSE-------  279
            M+   PQR  KRP   +    +DD +    +++VRFPKGKK K  D    GS        
Sbjct  1    MDPTAPQRGTKRPLPATAAGDEDDDRSALGDRKVRFPKGKKAKYRDPAAAGSSGEGGAAA  60

Query  280  ELPSGWKNPRLAA---------------------KERAMRRSQITADLLDEGNRGMVHNI  396
            E      NP LAA                     K   MR   +  +   EG +      
Sbjct  61   EDIDELMNPELAAVKRARRRHRREGDDAQGTANVKGFEMRYKVLMENCSPEGTKDKNRGD  120

Query  397  ALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVH  576
                +  +D+  F++DGI+IEPFNL +EREEGYFD NGN+VE+   ND+KDAWLD+++V 
Sbjct  121  NTDFDVQQDDANFIDDGIEIEPFNLEQEREEGYFDENGNFVEFARGNDMKDAWLDNVEVD  180

Query  577  PKAAVKTRVITANEDXARDLTSEELG  654
             K A K +     E+  +DL+S+++G
Sbjct  181  TKFAGKVQKKKDKEEEFQDLSSDDIG  206



>gb|EMT23641.1| hypothetical protein F775_06893 [Aegilops tauschii]
Length=461

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 109/197 (55%), Gaps = 22/197 (11%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSV---DDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSG--  294
            M+   PQR  KRP   +    DDD +    +++VRFPKGKK K  D    GS        
Sbjct  1    MDPTAPQRGTKRPLPATAAGDDDDDRSALGDRKVRFPKGKKAKYRDPAAAGSSGEGGAAA  60

Query  295  -----WKNPRLAAKERAMRRS-QITADLLDEG-NRGMVHNI------ALAE----EAYED  423
                   NP LAA +RA RR  + +A    +G  R   H        AL +    +  +D
Sbjct  61   DDIDELMNPELAAGKRARRRGGEASATAPPQGRGRHAGHRQRQGFRNALQDNTDFDVQQD  120

Query  424  NETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRV  603
            +  F++DGI+IEPFNL +EREEGYFD NGN+VE+   ND+KDAWLD+++V  K A K + 
Sbjct  121  DANFIDDGIEIEPFNLEQEREEGYFDENGNFVEFARGNDMKDAWLDNVEVDTKFAGKVQK  180

Query  604  ITANEDXARDLTSEELG  654
                E+  +DL+S+++G
Sbjct  181  KKDKEEEFQDLSSDDIG  197



>emb|CAN64184.1| hypothetical protein VITISV_022648 [Vitis vinifera]
Length=484

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +1

Query  325  RAMRRSQITADLLDEGNRGMVHNIALAEEAY-EDNETFVEDGIQIEPFNLNKEREEGYFD  501
            R +R S  T  +        V   A+  + + + +E F +DGIQIEPFNLN+EREEGYFD
Sbjct  340  RTVRLSIFTVSITAGFISYWVQGKAMTGDLFWQGDENFDDDGIQIEPFNLNQEREEGYFD  399

Query  502  ANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDXARDLTSEELG  654
            + GN+VEYVNE +IKDAWLDS+D+ PK   +  ++T  ED  +DLT+  +G
Sbjct  400  SEGNFVEYVNEKEIKDAWLDSVDLEPKFDKRNSMVTKVEDDTQDLTTAAIG  450


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +1

Query  127  AMEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGS--EELPSGWK  300
            A+ E  P RS KRP   S DD   KP  +KRV+FPKGKK+K GD V++    E++PS  K
Sbjct  140  ALMEEKPARSMKRPL--SEDDVLNKPPMQKRVKFPKGKKVKPGDEVLNAGKDEDVPSELK  197

Query  301  NPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYE  420
            +PRLAAKERA  R+QITA+L  E +RG+ H+I+ AE  YE
Sbjct  198  DPRLAAKERAKHRTQITAELFSEESRGIFHDISAAEMNYE  237



>gb|KFK25249.1| hypothetical protein AALP_AA8G087200 [Arabis alpina]
Length=365

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 109/182 (60%), Gaps = 17/182 (9%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  D D Q P  EKRVRFPKGKK  + + V+   EE     +  R
Sbjct  1    MAENSSRKNLKRSFLEDEDSDKQPP--EKRVRFPKGKKASKAEQVL---EEETVARRQAR  55

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AA ERA  R+Q T +L  E +     N   A E YE++    EDGIQIE F+L++E+EE
Sbjct  56   AAALERAKARNQNTTELFIEDD-----NADDAGETYENDANRTEDGIQIEAFSLDREKEE  110

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP-----KAAVKTRVITANEDX--ARDLTSEE  648
            GYFD +GN+VEYV + ++KDAWLDSI+ +P      AA  T     NE+   A +L+ E+
Sbjct  111  GYFDDDGNFVEYVRDKELKDAWLDSIENNPMYMGRSAANDTEKDDDNENEKPAEELSQED  170

Query  649  LG  654
            +G
Sbjct  171  IG  172



>emb|CAN80868.1| hypothetical protein VITISV_038604 [Vitis vinifera]
Length=336

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  415  YEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVK  594
            ++ +E F +DGIQIEPFNLN+EREEGYFD+ GN+VEYVNE +IKDAWLDS+D+ PK   K
Sbjct  7    WQGDENFDDDGIQIEPFNLNQEREEGYFDSEGNFVEYVNEKEIKDAWLDSVDLEPKFD-K  65

Query  595  TRVITANEDXARDLTSEELG  654
              ++T  ED  +DLT+  +G
Sbjct  66   RNMVTKVEDDTQDLTTAAIG  85



>ref|XP_003606370.1| CD2 antigen cytoplasmic tail-binding protein [Medicago truncatula]
Length=167

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 68/88 (77%), Gaps = 8/88 (9%)
 Frame = +1

Query  412  AYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIK--------DAWLDSI  567
             +++NE FVEDGIQIEPFNL+KEREEGYFDA+GN+VEYV +N+IK        DAWLD++
Sbjct  21   CWQENENFVEDGIQIEPFNLDKEREEGYFDASGNFVEYVRDNEIKVSCQGFLQDAWLDNV  80

Query  568  DVHPKAAVKTRVITANEDXARDLTSEEL  651
            +V P+ A  + V T +E+  ++L+S+++
Sbjct  81   EVDPRYAGLSSVATNDEEEVQELSSKDV  108



>ref|XP_006661174.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Oryza brachyantha]
Length=199

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = +1

Query  208  AEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMV  387
             E++ RFPKGKK K  D     + E   G  NP LAA+ RA RR +      D+  +G  
Sbjct  31   GERKPRFPKGKKAKYRDPAAAAAAEGIDGLINPELAAERRARRRHRKE----DDDQQGAA  86

Query  388  HNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSI  567
             ++   E  YED+   V+DGI++EPFNL +EREEGYFD NGN+VEY   NDIKDAWLDS+
Sbjct  87   ADVRGFEVRYEDSANLVDDGIRLEPFNLEQEREEGYFDENGNFVEYARGNDIKDAWLDSV  146

Query  568  DVHPKAA  588
            +V  K A
Sbjct  147  EVDTKYA  153



>ref|XP_010491564.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Camelina sativa]
Length=353

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 14/182 (8%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  + D Q P  EKRVRFPKGKK K    +    EE     ++ R
Sbjct  1    MAESSSRKNLKRSFLEDEESDKQPP--EKRVRFPKGKKSKPEQLL----EEEALARRDAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AA+ERA  R+Q TA L ++ +    +    A+E YE++    EDGIQIE F+L++E+EE
Sbjct  55   AAAEERARHRNQNTAQLFNDNDDDNDNIDE-AQETYENDGNRTEDGIQIEAFSLDREKEE  113

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP-----KAAVKTRV--ITANEDXARDLTSEE  648
            GYFDA+GN+VEYV E ++KDAWLDSI+ +P      AA  T     + NE    +L+ E+
Sbjct  114  GYFDADGNFVEYVREKEVKDAWLDSIEKNPLYMGRSAANDTEKDEDSGNEKAVDELSQED  173

Query  649  LG  654
            +G
Sbjct  174  IG  175



>dbj|BAG95087.1| unnamed protein product [Oryza sativa Japonica Group]
Length=427

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 92/151 (61%), Gaps = 6/151 (4%)
 Frame = +1

Query  208  AEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMV  387
             E++ RFPKGKK K  D     + E   G  NP LAA+ RA RR +   D      +G+ 
Sbjct  34   GERKPRFPKGKKAKYRDPAAAAAAEGIDGLINPELAAERRARRRHRKDED----DQQGVA  89

Query  388  HNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSI  567
             ++   E  YED+   V+DGI++EPFNL +EREEGYFD NGN+VEY   NDIKDAWLDS+
Sbjct  90   SDVRGFEVRYEDSANLVDDGIRLEPFNLEQEREEGYFDENGNFVEYARGNDIKDAWLDSV  149

Query  568  DVHPKAAVKTRVITANEDXA--RDLTSEELG  654
            +V  K A K +     E     +DL+S+++G
Sbjct  150  EVDTKYAEKVQKKREKEKEEEFQDLSSDDIG  180



>gb|EAZ08865.1| hypothetical protein OsI_31127 [Oryza sativa Indica Group]
Length=427

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 92/151 (61%), Gaps = 6/151 (4%)
 Frame = +1

Query  208  AEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGMV  387
             E++ RFPKGKK K  D     + E   G  NP LAA+ RA RR +   D      +G+ 
Sbjct  34   GERKPRFPKGKKAKYRDPAAAAAAEGIDGLINPELAAERRARRRHRKDED----DQQGVA  89

Query  388  HNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSI  567
             ++   E  YED+   V+DGI++EPFNL +EREEGYFD NGN+VEY   NDIKDAWLDS+
Sbjct  90   SDVRGFEVRYEDSANLVDDGIRLEPFNLEQEREEGYFDENGNFVEYARGNDIKDAWLDSV  149

Query  568  DVHPKAAVKTRVITANEDXA--RDLTSEELG  654
            +V  K A K +     E     +DL+S+++G
Sbjct  150  EVDTKYAEKVQKKREKEKEEEFQDLSSDDIG  180



>ref|XP_008651230.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=365

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 77/121 (64%), Gaps = 7/121 (6%)
 Frame = +1

Query  301  NPRLAAKERAMRRSQITADLLDEGN--RGMVHNIALAEEAYEDNETFVEDGIQIEPFNLN  474
            NP LAA+ RA +R       L EG+  +G    +   E  Y D+  FV+DGI+IEPFNL 
Sbjct  3    NPELAAERRARQRHV----QLKEGDDAKGGAAEVKGFEVRYNDSVNFVDDGIRIEPFNLE  58

Query  475  KEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE-DXARDLTSEEL  651
            +EREEGYFD NGN+VEY   N+IKDAWLDS++V P  A K +     + D   DL+S+++
Sbjct  59   REREEGYFDENGNFVEYARGNEIKDAWLDSVEVDPTYAAKVQNKGKEKVDEFEDLSSDDI  118

Query  652  G  654
            G
Sbjct  119  G  119



>gb|EAZ44513.1| hypothetical protein OsJ_29131 [Oryza sativa Japonica Group]
Length=434

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 93/152 (61%), Gaps = 6/152 (4%)
 Frame = +1

Query  205  SAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGM  384
            + +++ RFPKGKK K  D     + E   G  NP LAA+ RA RR +   D      +G+
Sbjct  40   AGKRKPRFPKGKKAKYRDPAAAAAAEGIDGLINPELAAERRARRRHRKDED----DQQGV  95

Query  385  VHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDS  564
              ++   E  YED+   V+DGI++EPFNL +EREEGYFD NGN+VEY   NDIKDAWLDS
Sbjct  96   ASDVRGFEVRYEDSANLVDDGIRLEPFNLEQEREEGYFDENGNFVEYARGNDIKDAWLDS  155

Query  565  IDVHPKAAVKTRVITANEDXA--RDLTSEELG  654
            ++V  K A K +     E     +DL+S+++G
Sbjct  156  VEVDTKYAEKVQKKREKEKEEEFQDLSSDDIG  187



>ref|XP_010422989.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Camelina sativa]
Length=353

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 112/182 (62%), Gaps = 14/182 (8%)
 Frame = +1

Query  130  MEEGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPR  309
            M E   +++ KR F++  + D Q P  EKRVRFPKGKK K    +  G E +    ++ R
Sbjct  1    MAESSSRKNLKRSFLEDEESDKQPP--EKRVRFPKGKKSKPEQIL--GEEAIAR--RDAR  54

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREE  489
             AA+ERA  R+Q TA L ++       NI  A+E YE++    EDGIQIE F+L++E+EE
Sbjct  55   EAAEERARHRNQNTAQLFNDNED-DNDNIDEAQETYENDGNRTEDGIQIEAFSLDREKEE  113

Query  490  GYFDANGNYVEYVNENDIKDAWLDSIDVHP-----KAAVKTRV--ITANEDXARDLTSEE  648
            GYFDA+GN+VEYV E ++KDAWLDSI+ +P      AA  T     + NE    +L+ E+
Sbjct  114  GYFDADGNFVEYVREKEVKDAWLDSIEKNPLYMGRSAANDTEKDEDSGNEKAVDELSQED  173

Query  649  LG  654
            +G
Sbjct  174  IG  175



>ref|XP_001780269.1| predicted protein [Physcomitrella patens]
 gb|EDQ54933.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 81/148 (55%), Gaps = 5/148 (3%)
 Frame = +1

Query  142  GPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEEL---PSGWKNPRL  312
            G  R R R  +   + D    S  K+ RFPKGKK      VV+  EE    P    +PRL
Sbjct  3    GKIRKRTRKDLLFNEPDESDASRSKKARFPKGKKDSGPRTVVEEGEEEDGGPILSTDPRL  62

Query  313  AAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEG  492
            AAK RAM R+ +   LL   +  +  ++  AE   E +   VEDGI IEPFNLN+EREEG
Sbjct  63   AAKNRAMLRTVLNEQLLSSEDVSLGDDVVAAE--VEGDTARVEDGITIEPFNLNQEREEG  120

Query  493  YFDANGNYVEYVNENDIKDAWLDSIDVH  576
            YFDA GNYVEY   +D K  W   + VH
Sbjct  121  YFDAEGNYVEYRLNDDDKLNWFGLLHVH  148



>ref|XP_002964431.1| hypothetical protein SELMODRAFT_438774 [Selaginella moellendorffii]
 gb|EFJ34764.1| hypothetical protein SELMODRAFT_438774 [Selaginella moellendorffii]
Length=327

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 8/150 (5%)
 Frame = +1

Query  214  KRVRFPKGKK---LKRGDYVVDGSEELPSGWKNPRLAAKERAMRRSQITADLLDEGNRGM  384
            ++++FPKGKK    +RG    +  +  P   ++ R+AA ERAMRRS +   L    +   
Sbjct  34   RKLKFPKGKKSDVFERGGVDEEEDDGDPRS-RSARIAATERAMRRSVMAEQLRTAEDTSN  92

Query  385  VHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDS  564
            +H+ + AEE++E+++    D +++EPFNLN ER +G+FD +G+YVEY  + + +DAWLDS
Sbjct  93   LHDFSQAEESFENDD----DAVKLEPFNLNAERRDGFFDDDGHYVEYATKFEARDAWLDS  148

Query  565  IDVHPKAAVKTRVITANEDXARDLTSEELG  654
             +V  + A K       E    D++  ++G
Sbjct  149  AEVDTRFAAKHLARKDKEAAEHDISPRDIG  178



>gb|ABR17802.1| unknown [Picea sitchensis]
Length=435

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 110/178 (62%), Gaps = 11/178 (6%)
 Frame = +1

Query  145  PQRSRKRPFV--DSVDDDSQKPSAEKRVRFPKGKKLKRG---DYVVDGSEELPSGWKNPR  309
            P ++R++     + +D D  +   +K+ RFPKGKK K G   D   +G  E P    +PR
Sbjct  3    PSKNRRQNLEAWEGIDTDIDETPRQKKPRFPKGKKQKTGNESDDAENGRAEGPVKPTDPR  62

Query  310  LAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVED-GIQIEPFNLNKERE  486
            LAA  RA RR     + L+  +  ++ +I  AEE YE++E  +ED GI+IEPFNL +ERE
Sbjct  63   LAATRRAARRRDRAEEFLNARDTSVLDDIGEAEEEYEEDEENLEDDGIKIEPFNLKQERE  122

Query  487  EGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAA---VKTRVITANEDXARDLTSEEL  651
            EGYFD+ GNYVEY N N+IKDAWLDS++V  + A   +K  +  + +D   DL+ EE+
Sbjct  123  EGYFDSEGNYVEYGNGNEIKDAWLDSVEVDTRFAEEHLKQSIQESEDDD--DLSPEEI  178



>ref|XP_004959414.1| PREDICTED: pumilio domain-containing protein C6G9.14-like [Setaria 
italica]
Length=559

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  442  DGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTR  600
            D I+IEPFNL +EREEGYFD NGN+VEY   N+IKDAWLDS++V P  A   +
Sbjct  477  DVIRIEPFNLEREREEGYFDENGNFVEYARGNEIKDAWLDSVEVDPTYAANVQ  529



>ref|XP_007023576.1| Uncharacterized protein TCM_027619 [Theobroma cacao]
 gb|EOY26198.1| Uncharacterized protein TCM_027619 [Theobroma cacao]
Length=96

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 4/68 (6%)
 Frame = +1

Query  463  FNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANEDX----AR  630
            FNLNKEREEGYF  +GN+VEY N+N+IKD WLD+++V  K   KT   T NED      +
Sbjct  4    FNLNKEREEGYFIVDGNFVEYRNDNEIKDVWLDNVEVDTKYIGKTSATTNNEDNNEVGTQ  63

Query  631  DLTSEELG  654
            DL+ +++G
Sbjct  64   DLSFQDIG  71



>ref|XP_007028441.1| Uncharacterized protein TCM_024237 [Theobroma cacao]
 gb|EOY08943.1| Uncharacterized protein TCM_024237 [Theobroma cacao]
Length=132

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  457  EPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            EPFNL+KERE+GYFDANGN+VEYVN N+IKDAWLD+I+
Sbjct  73   EPFNLSKEREKGYFDANGNFVEYVNNNEIKDAWLDNIE  110



>ref|XP_007032091.1| Uncharacterized protein TCM_017427 [Theobroma cacao]
 gb|EOY03017.1| Uncharacterized protein TCM_017427 [Theobroma cacao]
Length=67

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  415  YEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIK  546
            ++D+E FV+DGIQIE FNLNKEREEGYFDA+ N+VEY  +N+IK
Sbjct  7    WQDHENFVDDGIQIELFNLNKEREEGYFDADENFVEYAKDNEIK  50



>gb|KIY99068.1| CD2 antigen cytoplasmic tail-binding protein 2 [Monoraphidium 
neglectum]
Length=197

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = +1

Query  373  NRGMVHNIALAEEAYEDNETFVED-GIQIEPFNLNKEREEGYFDANGNYVEYVNENDIK-  546
            ++ ++ +I  AEEAY+  E    D GI IEPF+L +EREEGYFDA GNY++Y    D+  
Sbjct  60   DKSVMEDIEAAEEAYDSPEELYNDAGIPIEPFHLKREREEGYFDAEGNYIQY--RRDVPD  117

Query  547  DAWLDSIDVHP  579
            DAWL+S+   P
Sbjct  118  DAWLESLGAGP  128



>ref|XP_002949281.1| hypothetical protein VOLCADRAFT_89573 [Volvox carteri f. nagariensis]
 gb|EFJ49774.1| hypothetical protein VOLCADRAFT_89573 [Volvox carteri f. nagariensis]
Length=812

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  382  MVHNIALAEEAY-EDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWL  558
            M  ++A AEE Y E  E + E+GI +EPF+L  ERE GYFDA GNY+EY  E +  DAWL
Sbjct  105  MPDDLAAAEEDYDEPEELYNEEGIPMEPFHLRAEREAGYFDAEGNYLEYRLEAEDTDAWL  164

Query  559  DSI  567
            +SI
Sbjct  165  ESI  167



>ref|XP_005849831.1| hypothetical protein CHLNCDRAFT_142977 [Chlorella variabilis]
 gb|EFN57729.1| hypothetical protein CHLNCDRAFT_142977 [Chlorella variabilis]
Length=435

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +1

Query  343  QITADLLDEGNRGMVHNIALAEEAYED-NETFVEDGIQIEPFNLNKEREEGYFDANGNYV  519
            Q+ AD  +EG   M  +I  AEE YED  E F + G+  EPF+L +EREEGYFD +GNYV
Sbjct  34   QLLADF-EEGGVYM-GDIEGAEEDYEDPEEMFNDAGMAFEPFHLKREREEGYFDEDGNYV  91

Query  520  EYVNENDIKDAWLDSI  567
            E+   +D++DAW D +
Sbjct  92   EF-KSDDVEDAWADGL  106



>ref|XP_008374380.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Malus domestica]
Length=281

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +1

Query  460  PFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITA-NEDXARDL  636
            PFNL KER+EGYFDA GN+VEY   N +KDAWLDS++       K  V     ED A DL
Sbjct  15   PFNLEKERKEGYFDAEGNFVEYAEGNRVKDAWLDSVEA---GVTKLHVPKPKTEDDAADL  71

Query  637  TSEE  648
              E+
Sbjct  72   PPED  75



>ref|XP_011401180.1| hypothetical protein F751_6934 [Auxenochlorella protothecoides]
 gb|KFM28167.1| hypothetical protein F751_6934 [Auxenochlorella protothecoides]
Length=366

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +1

Query  301  NPRLAAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYED--NETFVEDGIQIEPFNLN  474
            +P  AA +RA RR        +EG  G   +   AE  Y+D    + +E   ++EPF++ 
Sbjct  51   DPARAASDRAKRRRDALMMSFEEGMEG---DELAAEAEYDDIPVSSRLEHSARLEPFHMK  107

Query  475  KEREEGYFDA-NGNYVEYVNENDIKDAWLDSIDV  573
            +ERE GYFDA  G+YVEY +  D+ DAW D++ V
Sbjct  108  RERELGYFDAETGDYVEYASRRDVPDAWADALPV  141



>ref|XP_009379748.1| PREDICTED: uncharacterized protein LOC103968132 [Pyrus x bretschneideri]
Length=95

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = +1

Query  412  AYEDNETFVEDGIQIEPFNL-NKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAA  588
            A++D +  V DGIQ EP NL NKEREEGYF+A+G Y+ Y  +N++K       D H    
Sbjct  2    AFQDYKDLVADGIQTEPSNLINKEREEGYFNADGKYITYAIKNEVKVNMFIIFDYH--MY  59

Query  589  VKTRVI  606
            ++ R+I
Sbjct  60   LRARLI  65



>ref|XP_003074380.1| putative protein (ISS) [Ostreococcus tauri]
 emb|CAL50231.1| unnamed product [Ostreococcus tauri]
Length=440

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 65/142 (46%), Gaps = 16/142 (11%)
 Frame = +1

Query  136  EGGPQRSRKRPFVDSVDDDSQKPSAEKRVRFPKGKKLKRGDYVVDGSEELPSGWKNPRLA  315
            EGG  R+   P     DD+       KRV F             +  E+  +     + A
Sbjct  47   EGGDARATVLPSGADSDDERAVKRGGKRVSF------------AEDDEDEDALATRAKAA  94

Query  316  AKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGY  495
            ++ RA+ RS+  A +    +R     +  AEE  E N+   E+G     FNL+KER+EGY
Sbjct  95   SETRALLRSEAAAGVRSTDDRETRAGVEDAEENMEKNDE--EEGFT--SFNLDKERQEGY  150

Query  496  FDANGNYVEYVNENDIKDAWLD  561
            FD  GNYVEY  E D    WLD
Sbjct  151  FDDEGNYVEYAEEEDETTLWLD  172



>ref|XP_005646924.1| hypothetical protein COCSUDRAFT_56069 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22380.1| hypothetical protein COCSUDRAFT_56069 [Coccomyxa subellipsoidea 
C-169]
Length=465

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +1

Query  391  NIALAEEAYEDN-ETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSI  567
            ++A AE  YE + + +   G+ +EPFNLN+ERE G+FD +GNYV Y  E +  DAWL+S+
Sbjct  19   DVAAAEVDYEVHAQNWDNSGVPLEPFNLNRERETGHFDEDGNYVAYC-EAEPDDAWLESL  77

Query  568  DVHPK  582
               P+
Sbjct  78   PQGPE  82



>ref|XP_004705722.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Echinops 
telfairi]
Length=339

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 11/89 (12%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E +I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAEIRDSWLDNI  122

Query  568  DVHPKAAVKTRVITANEDXARDLTSEELG  654
            D      VK R    ++  A D   E LG
Sbjct  123  DW-----VKIRERPPDQRQASDSDEEGLG  146



>dbj|BAN21141.1| aspartyl beta-hydroxylase, putative [Riptortus pedestris]
Length=144

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +1

Query  382  MVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLD  561
            MV   +  +++ ED    +E+G+Q  PFN+N+E EEG+FDANG Y  +  E  I+D WL+
Sbjct  1    MVPCDSKNKKSQEDGVAGLEEGVQFTPFNMNEEMEEGHFDANGMY-HWKKEKLIRDNWLE  59

Query  562  SID  570
            +ID
Sbjct  60   NID  62



>ref|XP_001692179.1| hypothetical protein CHLREDRAFT_170950 [Chlamydomonas reinhardtii]
 gb|EDP04129.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=198

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 30/45 (67%), Gaps = 4/45 (9%)
 Frame = +1

Query  442  DGIQIEPFNLNKEREEGYFDANGNYVEYVNEN----DIKDAWLDS  564
            DGIQ EPFNL  EREEG FDA+GNYV    E     D KDAWL S
Sbjct  117  DGIQFEPFNLKAEREEGVFDADGNYVYKKKEGEEGEDGKDAWLAS  161



>ref|XP_005852071.1| hypothetical protein CHLNCDRAFT_133077 [Chlorella variabilis]
 gb|EFN59969.1| hypothetical protein CHLNCDRAFT_133077 [Chlorella variabilis]
Length=577

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 11/92 (12%)
 Frame = +1

Query  301  NPRLAAKERAM-RRSQITADLLDEGNRGMVHNIALAEEAYEDNETFV-EDGIQIEPFNLN  474
            +P  A  +RA+ R+S+     L E  R        A+E Y+  E  V E G  +EPF+L 
Sbjct  15   DPGFARAQRALLRQSRQQQGTLGEALR--------AQELYDQPEEPVNEAGDVVEPFHLR  66

Query  475  KEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            +E  EGYFD  G Y+EY    + +DAWLDSID
Sbjct  67   RELSEGYFDPAGTYIEYGRAEE-QDAWLDSID  97



>ref|XP_002769875.1| CD2 antigen cytoplasmic tail-binding protein, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER02593.1| CD2 antigen cytoplasmic tail-binding protein, putative [Perkinsus 
marinus ATCC 50983]
Length=318

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +1

Query  418  EDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSID  570
            ED E  V+DGI +EPFN+ +E EEG+FD +G YV+  +E  +  DAWLDS+D
Sbjct  94   EDPEMAVDDGIVLEPFNMRRENEEGHFDESGFYVQSRSEQAENLDAWLDSVD  145



>ref|XP_007884271.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Callorhinchus 
milii]
Length=354

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +1

Query  388  HNIALAE--EAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLD  561
            +NI   E  E  E      EDG+QI PFNL++E E+G+FD+ GNY  +  E  I+D+WLD
Sbjct  63   YNILTTEDIEGQESATVDYEDGVQITPFNLDEEMEDGHFDSEGNYF-FKKEAVIRDSWLD  121

Query  562  SID  570
            +ID
Sbjct  122  NID  124



>ref|XP_002165595.2| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Hydra vulgaris]
Length=330

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVKTRVITANE  618
            +DGI + PFNL  E EEG+FDA GNY+    + +I D WLDS+D    + V +     NE
Sbjct  62   DDGIVVTPFNLKDELEEGHFDAQGNYIANKVDENITDGWLDSVDW---SKVPSNRNVLNE  118

Query  619  DXARDL  636
            D   DL
Sbjct  119  DSMEDL  124



>ref|XP_007107447.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X5 [Physeter catodon]
Length=327

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>gb|ERG79626.1| lin1-like protein [Ascaris suum]
Length=345

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  436  VEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID-VHPKAAVKTRVITA  612
             E   +I PFN+ ++ EEG+FD +GN++    E DIKDAWLD+ID  H K+A   +    
Sbjct  89   FEGNTKIMPFNVEEDLEEGHFDTDGNFIFNKKERDIKDAWLDNIDWAHIKSAAGDQWQKT  148

Query  613  NED  621
            NED
Sbjct  149  NED  151



>ref|XP_002115174.1| hypothetical protein TRIADDRAFT_28719 [Trichoplax adhaerens]
 gb|EDV22630.1| hypothetical protein TRIADDRAFT_28719 [Trichoplax adhaerens]
Length=303

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 3/52 (6%)
 Frame = +1

Query  418  EDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSID  570
            ++ ET+ +DG++I PFNL +E EEGYFDA GNY  + N ++D+ D WL ++D
Sbjct  55   DETETYTDDGMKITPFNLKEELEEGYFDAEGNY--FANKDDDVSDNWLQAVD  104



>ref|XP_003383440.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Amphimedon queenslandica]
Length=345

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  430  TFVEDG-IQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            T   DG I++ PFNL +E E+GYFDA+GNY E  + N I+D WL+ +D
Sbjct  75   TIANDGDIKLTPFNLEEEMEDGYFDAHGNYYEKADPNAIQDTWLEGVD  122



>ref|XP_007499007.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Monodelphis 
domestica]
Length=306

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +1

Query  394  IALAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDS  564
            + LA E  E  E      E G++I PFNL +E EEG+FD++GNY  +  +  I+D+WLD+
Sbjct  61   VILASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDSDGNYFLH-RDAQIRDSWLDN  119

Query  565  ID  570
            ID
Sbjct  120  ID  121



>ref|XP_007536213.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Erinaceus 
europaeus]
Length=342

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>gb|EDM17310.1| CD2 antigen (cytoplasmic tail) binding protein 2 (predicted), 
isoform CRA_b [Rattus norvegicus]
Length=197

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEND-IKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDSQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_006871959.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Chrysochloris 
asiatica]
Length=340

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_006914179.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Pteropus 
alecto]
 ref|XP_011376981.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Pteropus 
vampyrus]
 ref|XP_011376982.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Pteropus 
vampyrus]
 gb|ELK10954.1| CD2 antigen cytoplasmic tail-binding protein 2 [Pteropus alecto]
Length=340

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_006977123.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Peromyscus maniculatus bairdii]
 ref|XP_006977124.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Peromyscus maniculatus bairdii]
Length=341

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_007612402.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Cricetulus griseus]
 ref|XP_007612403.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Cricetulus griseus]
 gb|ERE77641.1| CD2 antigen cytoplasmic tail-binding protein 2 [Cricetulus griseus]
Length=341

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_005351339.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Microtus ochrogaster]
 ref|XP_005351340.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Microtus ochrogaster]
 ref|XP_005351341.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Microtus ochrogaster]
Length=341

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_007612404.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Cricetulus griseus]
Length=340

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_007606013.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Cricetulus griseus]
Length=340

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>gb|EDL17505.1| mCG134114, isoform CRA_b [Mus musculus]
Length=369

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  92   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  149

Query  568  D  570
            D
Sbjct  150  D  150



>ref|NP_001099767.1| CD2 antigen cytoplasmic tail-binding protein 2 [Rattus norvegicus]
 ref|XP_006230313.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Rattus norvegicus]
 ref|XP_006230314.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Rattus norvegicus]
 ref|XP_008758101.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Rattus norvegicus]
 gb|EDM17308.1| CD2 antigen (cytoplasmic tail) binding protein 2 (predicted), 
isoform CRA_a [Rattus norvegicus]
 gb|EDM17309.1| CD2 antigen (cytoplasmic tail) binding protein 2 (predicted), 
isoform CRA_a [Rattus norvegicus]
 gb|EDM17311.1| CD2 antigen (cytoplasmic tail) binding protein 2 (predicted), 
isoform CRA_a [Rattus norvegicus]
 gb|AAI68174.1| Cd2bp2 protein [Rattus norvegicus]
Length=340

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEND-IKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDSQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_003515745.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Cricetulus griseus]
 ref|XP_007606012.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Cricetulus griseus]
 gb|EGW14602.1| CD2 antigen cytoplasmic tail-binding protein 2 [Cricetulus griseus]
Length=341

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004692044.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Condylura 
cristata]
Length=340

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N ++ I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDSQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>dbj|BAD32400.1| mKIAA1178 protein [Mus musculus]
Length=346

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  69   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  126

Query  568  D  570
            D
Sbjct  127  D  127



>ref|XP_004328717.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Tursiops 
truncatus]
Length=312

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 3/45 (7%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSID  570
            E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+ID
Sbjct  52   EGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNID  94



>ref|XP_005064429.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Mesocricetus auratus]
 ref|XP_005064430.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Mesocricetus auratus]
Length=340

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|NP_081629.1| CD2 antigen cytoplasmic tail-binding protein 2 [Mus musculus]
 ref|NP_001272836.1| CD2 antigen cytoplasmic tail-binding protein 2 [Mus musculus]
 ref|NP_001272835.1| CD2 antigen cytoplasmic tail-binding protein 2 [Mus musculus]
 ref|NP_001272834.1| CD2 antigen cytoplasmic tail-binding protein 2 [Mus musculus]
 ref|XP_006508260.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Mus musculus]
 ref|XP_006508261.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Mus musculus]
 ref|XP_011240200.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Mus musculus]
 sp|Q9CWK3.1|CD2B2_MOUSE RecName: Full=CD2 antigen cytoplasmic tail-binding protein 2; 
Short=CD2 cytoplasmic domain-binding protein 2; Short=CD2 tail-binding 
protein 2 [Mus musculus]
 dbj|BAB27044.1| unnamed protein product [Mus musculus]
 gb|AAH06920.1| CD2 antigen (cytoplasmic tail) binding protein 2 [Mus musculus]
 dbj|BAC26940.1| unnamed protein product [Mus musculus]
 dbj|BAC27518.1| unnamed protein product [Mus musculus]
 dbj|BAC28798.1| unnamed protein product [Mus musculus]
 dbj|BAE39370.1| unnamed protein product [Mus musculus]
 gb|EDL17504.1| mCG134114, isoform CRA_a [Mus musculus]
 gb|EDL17506.1| mCG134114, isoform CRA_a [Mus musculus]
 gb|EDL17507.1| mCG134114, isoform CRA_a [Mus musculus]
Length=342

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>dbj|BAE32530.1| unnamed protein product [Mus musculus]
Length=342

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004671133.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Jaculus 
jaculus]
Length=340

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEND-IKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDSKIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_007186462.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Balaenoptera acutorostrata scammoni]
 ref|XP_007186463.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007186464.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Balaenoptera acutorostrata scammoni]
 ref|XP_007186465.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X4 [Balaenoptera acutorostrata scammoni]
Length=340

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_007107443.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Physeter catodon]
 ref|XP_007107444.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Physeter catodon]
 ref|XP_007107445.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Physeter catodon]
 ref|XP_007107446.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X4 [Physeter catodon]
Length=340

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_004268728.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Orcinus 
orca]
Length=340

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_007452800.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Lipotes 
vexillifer]
Length=340

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N E  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNREAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_008151048.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Eptesicus 
fuscus]
Length=341

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_008822081.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nannospalax 
galili]
 ref|XP_008822082.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nannospalax 
galili]
 ref|XP_008822083.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nannospalax 
galili]
Length=340

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N++  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNQDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_006103519.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Myotis 
lucifugus]
Length=341

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004586938.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ochotona 
princeps]
Length=342

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_005405306.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Chinchilla lanigera]
Length=338

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_006070508.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Bubalus bubalis]
Length=369

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  93   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  150

Query  568  D  570
            D
Sbjct  151  D  151



>ref|XP_005405305.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Chinchilla lanigera]
Length=340

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_002951145.1| hypothetical protein VOLCADRAFT_91665 [Volvox carteri f. nagariensis]
 gb|EFJ47674.1| hypothetical protein VOLCADRAFT_91665 [Volvox carteri f. nagariensis]
Length=1938

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = +1

Query  409  EAYEDNETFVE--DGIQIEPFNLNKEREEGYFDANGNYV--EYVNE--NDIKDAWLDS  564
            E YE +   VE  DGI  EPFNL +EREEGYFD +GNYV  +   E  N+ +DAWL+S
Sbjct  101  ERYEKDTLEVEQEDGITFEPFNLKQEREEGYFDEDGNYVLRKQAGEEGNEGEDAWLNS  158



>gb|EHH60310.1| CD2 antigen cytoplasmic tail-binding protein 2 [Macaca fascicularis]
Length=341

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_003477917.2| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Cavia porcellus]
Length=369

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  94   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  151

Query  568  D  570
            D
Sbjct  152  D  152



>ref|XP_004479416.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
1 [Dasypus novemcinctus]
Length=376

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  382  MVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWL  558
            +   I + +   E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WL
Sbjct  97   LTEGICIFDSGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWL  154

Query  559  DSID  570
            D+ID
Sbjct  155  DNID  158



>ref|XP_005224960.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Bos taurus]
Length=340

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_006070509.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Bubalus bubalis]
 ref|XP_006070510.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Bubalus bubalis]
Length=340

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_010835623.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Bison bison bison]
 ref|XP_010835624.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Bison bison bison]
Length=341

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_005888877.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Bos 
mutus]
Length=341

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>gb|ELR61413.1| CD2 antigen cytoplasmic tail-binding protein 2, partial [Bos 
mutus]
Length=343

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  67   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  124

Query  568  D  570
            D
Sbjct  125  D  125



>ref|XP_010835625.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Bison bison bison]
Length=340

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_001415871.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94163.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=354

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +1

Query  313  AAKERAMRRSQITADLLDEGNRGMVHNIALAEEAYEDNETFVEDGIQIEPFNLNKEREEG  492
            AAK RA+ RS+  A + D  +     ++  AEEA   ++   E   +   FNL+KER+EG
Sbjct  8    AAKTRALLRSEWAAGVRDADDVDARDDVKDAEEALVGDDEGKES--EFMAFNLDKERQEG  65

Query  493  YFDANGNYVEYVNENDIKDAWLD  561
            YFD +GNYVEY  E D  D WL+
Sbjct  66   YFDDDGNYVEYAEEQDEADLWLE  88



>ref|XP_005963168.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Pantholops 
hodgsonii]
Length=345

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_005007633.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Cavia porcellus]
Length=337

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  62   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  119

Query  568  D  570
            D
Sbjct  120  D  120



>ref|XP_003795854.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Otolemur 
garnettii]
Length=338

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 11/87 (13%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  DVHPKAAVKTRVITANEDXARDLTSEE  648
            D      VK R    ++    DL  E+
Sbjct  123  DW-----VKIRERPPDQRQVSDLEEED  144



>ref|XP_006753014.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Myotis 
davidii]
 gb|ELK38398.1| CD2 antigen cytoplasmic tail-binding protein 2 [Myotis davidii]
Length=341

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004020948.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ovis 
aries]
Length=341

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004902872.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004902873.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Heterocephalus glaber]
 ref|XP_004856209.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004856210.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Heterocephalus glaber]
Length=366

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|NP_001270359.1| uncharacterized protein LOC101865010 [Macaca fascicularis]
 dbj|BAE89272.1| unnamed protein product [Macaca fascicularis]
Length=339

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_010615683.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Fukomys 
damarensis]
 ref|XP_010615684.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Fukomys 
damarensis]
 ref|XP_010615685.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Fukomys 
damarensis]
 gb|KFO36298.1| CD2 antigen cytoplasmic tail-binding protein 2 [Fukomys damarensis]
Length=340

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N    I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRGAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_005697757.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Capra hircus]
Length=340

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_007948423.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Orycteropus 
afer afer]
Length=339

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_003918731.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Papio 
anubis]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|NP_001247625.1| CD2 antigen cytoplasmic tail-binding protein 2 [Macaca mulatta]
 gb|EHH31582.1| CD2 antigen cytoplasmic tail-binding protein 2 [Macaca mulatta]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_007988171.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Chlorocebus 
sabaeus]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004773950.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Mustela 
putorius furo]
 ref|XP_004816875.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Mustela putorius furo]
Length=339

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +1

Query  337  RSQITADLLDEGNRGMVHNIALAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDAN  507
            +  + +D  D+  R   ++I LA E  E  E      E G++I PFNL +E EEG+FDA+
Sbjct  42   KHSLDSDEEDDAERPSKYDI-LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDAD  100

Query  508  GNYVEYVNEN-DIKDAWLDSID  570
            GNY  ++N +  I+D+WLD+ID
Sbjct  101  GNY--FLNRDAQIRDSWLDNID  120



>ref|NP_001077151.1| CD2 antigen cytoplasmic tail-binding protein 2 [Bos taurus]
 ref|XP_005224958.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Bos taurus]
 gb|AAI34721.1| CD2BP2 protein [Bos taurus]
 tpg|DAA15390.1| TPA: CD2 (cytoplasmic tail) binding protein 2 [Bos taurus]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_005697756.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Capra hircus]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004623024.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Octodon 
degus]
Length=339

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  63   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  120

Query  568  D  570
            D
Sbjct  121  D  121



>ref|XP_010386147.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Rhinopithecus 
roxellana]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_009248910.1| PREDICTED: LOW QUALITY PROTEIN: CD2 antigen cytoplasmic tail-binding 
protein 2 isoform X1 [Pongo abelii]
Length=340

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>ref|XP_004902874.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Heterocephalus glaber]
 ref|XP_004856211.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Heterocephalus glaber]
 gb|EHB14382.1| CD2 antigen cytoplasmic tail-binding protein 2 [Heterocephalus 
glaber]
Length=339

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_003807513.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Pan 
paniscus]
 ref|XP_008957840.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Pan 
paniscus]
 ref|XP_008957841.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Pan 
paniscus]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>ref|XP_008246967.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Oryctolagus 
cuniculus]
 ref|XP_008246968.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Oryctolagus 
cuniculus]
Length=340

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIQDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_010338989.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Saimiri 
boliviensis boliviensis]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004057546.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Gorilla 
gorilla gorilla]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>ref|XP_004816876.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Mustela putorius furo]
Length=337

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +1

Query  337  RSQITADLLDEGNRGMVHNIALAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDAN  507
            +  + +D  D+  R   ++I LA E  E  E      E G++I PFNL +E EEG+FDA+
Sbjct  40   KHSLDSDEEDDAERPSKYDI-LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDAD  98

Query  508  GNYVEYVNEN-DIKDAWLDSID  570
            GNY  ++N +  I+D+WLD+ID
Sbjct  99   GNY--FLNRDAQIRDSWLDNID  118



>ref|XP_005648710.1| hypothetical protein COCSUDRAFT_47170 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24166.1| hypothetical protein COCSUDRAFT_47170 [Coccomyxa subellipsoidea 
C-169]
Length=476

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = +1

Query  445  GIQIEPFNLNKEREEGYFDANGNYVEYVNEND---IKDAWL-DSIDVHPKAAVKTRV  603
            G+ +EPFNL +ER EGYFD  G+YVE+ N+++    KDAWL  S D    AAV+ ++
Sbjct  111  GVTLEPFNLAQERREGYFDEGGHYVEHRNKDEEELEKDAWLASSKDAVVSAAVRRKI  167



>ref|XP_003280476.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nomascus 
leucogenys]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>gb|ELT91715.1| hypothetical protein CAPTEDRAFT_148353 [Capitella teleta]
Length=349

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  409  EAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E  ED    +E+GI+  PFN+ +E EEG+FD+ G Y+ +  E +I+D W+D+ID
Sbjct  63   EGQEDGGVDIEEGIRFTPFNMEEEMEEGHFDSEGTYI-FTKEKEIRDNWMDNID  115



>ref|XP_008065868.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Tarsius 
syrichta]
 ref|XP_008065873.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Tarsius 
syrichta]
Length=341

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004615931.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Sorex 
araneus]
Length=340

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|NP_006101.1| CD2 antigen cytoplasmic tail-binding protein 2 [Homo sapiens]
 ref|NP_001230575.1| CD2 antigen cytoplasmic tail-binding protein 2 [Homo sapiens]
 sp|O95400.1|CD2B2_HUMAN RecName: Full=CD2 antigen cytoplasmic tail-binding protein 2; 
Short=CD2 cytoplasmic domain-binding protein 2; Short=CD2 tail-binding 
protein 2; AltName: Full=U5 snRNP 52K protein; Short=U5-52K 
[Homo sapiens]
 gb|AAC84141.1| CD2 cytoplasmic domain binding protein [Homo sapiens]
 gb|AAH00495.1| CD2 (cytoplasmic tail) binding protein 2 [Homo sapiens]
 gb|AAH01947.1| CD2 (cytoplasmic tail) binding protein 2 [Homo sapiens]
 gb|EAW52260.1| CD2 antigen (cytoplasmic tail) binding protein 2, isoform CRA_a 
[Homo sapiens]
 gb|EAW52261.1| CD2 antigen (cytoplasmic tail) binding protein 2, isoform CRA_a 
[Homo sapiens]
 gb|ABM84500.1| CD2 (cytoplasmic tail) binding protein 2 [synthetic construct]
 gb|ABW03431.1| CD2 (cytoplasmic tail) binding protein 2 [synthetic construct]
 dbj|BAG38069.1| unnamed protein product [Homo sapiens]
 gb|AIC50614.1| CD2BP2, partial [synthetic construct]
Length=341

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>ref|XP_004439483.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ceratotherium 
simum simum]
Length=341

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_001501595.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Equus caballus]
 ref|XP_005598835.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Equus caballus]
 ref|XP_005598836.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Equus caballus]
 ref|XP_008512514.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Equus 
przewalskii]
 ref|XP_008512515.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Equus 
przewalskii]
 ref|XP_008512516.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Equus 
przewalskii]
Length=341

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLSSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_006896590.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Elephantulus 
edwardii]
Length=341

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|NP_001125729.1| CD2 antigen cytoplasmic tail-binding protein 2 [Pongo abelii]
 emb|CAH91235.1| hypothetical protein [Pongo abelii]
Length=341

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>emb|CAH91742.1| hypothetical protein [Pongo abelii]
Length=341

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>ref|XP_003998707.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Felis 
catus]
Length=342

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>ref|XP_005882088.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Myotis 
brandtii]
Length=340

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_006201352.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Vicugna 
pacos]
Length=341

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_006181576.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Camelus 
ferus]
 ref|XP_010970776.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Camelus 
bactrianus]
 ref|XP_010994466.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Camelus 
dromedarius]
Length=341

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_002924816.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ailuropoda 
melanoleuca]
 ref|XP_011230067.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ailuropoda 
melanoleuca]
 gb|EFB28310.1| hypothetical protein PANDA_014239 [Ailuropoda melanoleuca]
Length=342

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_003761631.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Sarcophilus 
harrisii]
Length=334

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +1

Query  394  IALAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDS  564
            + LA E  E  E      E G++I PFNL +E EEG+FD++GNY  +  +  I+D+WLD+
Sbjct  61   VILASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDSDGNYFLH-RDAQIRDSWLDN  119

Query  565  ID  570
            ID
Sbjct  120  ID  121



>ref|XP_003354584.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Sus scrofa]
 ref|XP_005653070.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Sus scrofa]
 ref|XP_005653071.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Sus scrofa]
 ref|XP_005653072.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X4 [Sus scrofa]
 ref|XP_005653073.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X5 [Sus scrofa]
Length=340

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_005323906.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ictidomys 
tridecemlineatus]
Length=341

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004479417.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
2 [Dasypus novemcinctus]
Length=341

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_008683515.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ursus 
maritimus]
 ref|XP_008683516.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Ursus 
maritimus]
Length=342

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_004397271.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
1 [Odobenus rosmarus divergens]
 ref|XP_004397272.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
2 [Odobenus rosmarus divergens]
Length=343

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_002756099.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Callithrix 
jacchus]
 ref|XP_009007674.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Callithrix 
jacchus]
Length=341

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 3/45 (7%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSID  570
            E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+ID
Sbjct  81   EGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNID  123



>ref|XP_007094815.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Panthera 
tigris altaica]
Length=342

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  66   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  123

Query  568  D  570
            D
Sbjct  124  D  124



>ref|XP_006148232.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Tupaia 
chinensis]
 gb|ELW66361.1| CD2 antigen cytoplasmic tail-binding protein 2 [Tupaia chinensis]
Length=341

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_547057.2| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Canis lupus familiaris]
 ref|XP_005621389.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Canis lupus familiaris]
Length=344

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_005621390.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Canis lupus familiaris]
Length=342

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_006738047.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Leptonychotes 
weddellii]
Length=343

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>ref|XP_007432293.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X3 [Python bivittatus]
Length=370

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            EDGI+I PFNL +E EEG+FD+ GNY     E  I+D WLD+ID
Sbjct  80   EDGIRITPFNLQEEMEEGHFDSEGNYF-LKKEAVIRDNWLDNID  122



>ref|XP_007432291.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Python bivittatus]
 ref|XP_007432292.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Python bivittatus]
Length=371

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            EDGI+I PFNL +E EEG+FD+ GNY     E  I+D WLD+ID
Sbjct  80   EDGIRITPFNLQEEMEEGHFDSEGNYF-LKKEAVIRDNWLDNID  122



>ref|XP_008327573.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Cynoglossus semilaevis]
Length=347

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  409  EAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E  ED     ++G+ I PFNL++E EEG+FDA GNY     + +IKD WLD+ID
Sbjct  69   EGQEDATVNYDEGVSITPFNLDEEMEEGHFDAEGNYF-IKKDKEIKDNWLDNID  121



>ref|XP_008119203.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Anolis 
carolinensis]
Length=373

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = +1

Query  373  NRGMVHNIALAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDI  543
             RG  ++I LA +  E  E+     EDG++I PFNL +E EEG+FD+ GNY     E  I
Sbjct  56   GRGSKYDI-LASDDVEGQESATIDYEDGVRITPFNLQEEMEEGHFDSEGNYF-LKKEAMI  113

Query  544  KDAWLDSID  570
            +D WLD+ID
Sbjct  114  RDNWLDNID  122



>emb|CAA08790.1| SMC2orf, partial [Podocoryna carnea]
Length=326

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            ++GI + PFNL +E EEG+FDA GNY+    + ++ D WL+S+D
Sbjct  88   DEGITVTPFNLREELEEGHFDAQGNYIANKTDENVTDGWLESVD  131



>ref|NP_957255.1| CD2 antigen cytoplasmic tail-binding protein 2 [Danio rerio]
 gb|AAH45960.1| CD2 antigen (cytoplasmic tail) binding protein 2 [Danio rerio]
 gb|AAI64209.1| Cd2bp2 protein [Danio rerio]
Length=378

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSID  570
            ++G++I PFNL++E +EG+FD+ GNY  +VN E DI+D WLD+ID
Sbjct  79   DEGVRITPFNLDEEMQEGHFDSEGNY--FVNKEKDIRDNWLDNID  121



>ref|XP_007235412.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Astyanax mexicanus]
Length=382

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +1

Query  436  VEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
             ++G+ I PFNL++E +EG+FD+ GNY     ENDI+D WLD+ID
Sbjct  78   CDEGVPITPFNLHEEMQEGHFDSEGNYF-IKKENDIRDNWLDNID  121



>gb|EQB77973.1| TBC1 domain family, member 10B [Camelus ferus]
Length=1006

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  730  LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  787

Query  568  D  570
            D
Sbjct  788  D  788



>gb|ACO08847.1| CD2 antigen cytoplasmic tail-binding protein 2 [Osmerus mordax]
Length=378

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +1

Query  436  VEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
             ++G+ I PFNL++E EEGYFD+ GNY    +E DI+D WLD+ID
Sbjct  79   CDEGVPITPFNLDEEMEEGYFDSEGNYFIKKDE-DIRDNWLDNID  122



>gb|KHN80241.1| CD2 antigen cytoplasmic tail-binding protein 2 [Toxocara canis]
Length=345

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 3/58 (5%)
 Frame = +1

Query  427  ETFVE-DG-IQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID-VHPKAAV  591
            ET VE DG  +I PFN+ ++ EEG+FD +GN++    E +IKDAWLD+ID  H K A 
Sbjct  85   ETGVEFDGNTKITPFNMEEDLEEGHFDTDGNFIFNKKERNIKDAWLDNIDWAHIKKAA  142



>ref|XP_005164061.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Danio rerio]
Length=353

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVN-ENDIKDAWLDSID  570
            ++G++I PFNL++E +EG+FD+ GNY  +VN E DI+D WLD+ID
Sbjct  54   DEGVRITPFNLDEEMQEGHFDSEGNY--FVNKEKDIRDNWLDNID  96



>ref|XP_004386718.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Trichechus 
manatus latirostris]
Length=338

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG+FDA+GNY  ++N +  I+D WLD+I
Sbjct  64   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDNWLDNI  121

Query  568  D  570
            D
Sbjct  122  D  122



>ref|XP_008327571.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Cynoglossus semilaevis]
 ref|XP_008327572.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Cynoglossus semilaevis]
Length=382

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  409  EAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E  ED     ++G+ I PFNL++E EEG+FDA GNY     + +IKD WLD+ID
Sbjct  69   EGQEDATVNYDEGVSITPFNLDEEMEEGHFDAEGNYF-IKKDKEIKDNWLDNID  121



>gb|ETE71829.1| CD2 antigen cytoplasmic tail-binding protein 2 [Ophiophagus hannah]
Length=317

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSIDVHPKAAVK  594
            EDGI+I PFNL +E EEG+FD  GNY     E  I+D WLD+ID     A++
Sbjct  80   EDGIRITPFNLQEEMEEGHFDTEGNYF-LKKEAMIRDNWLDNIDWTVARAIQ  130



>ref|XP_003141874.1| hypothetical protein LOAG_06290 [Loa loa]
Length=156

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E   +I PFN+ ++ EEG+FDA+GN++    E +IKDAWLD+ID
Sbjct  86   EGNTKIMPFNMKEDLEEGHFDADGNFIFDKKETEIKDAWLDNID  129



>gb|EJD75662.1| hypothetical protein LOAG_17242 [Loa loa]
Length=346

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E   +I PFN+ ++ EEG+FDA+GN++    E +IKDAWLD+ID
Sbjct  86   EGNTKIMPFNMKEDLEEGHFDADGNFIFDKKETEIKDAWLDNID  129



>ref|XP_003370683.1| putative GYF domain protein [Trichinella spiralis]
 gb|EFV50459.1| putative GYF domain protein [Trichinella spiralis]
Length=384

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  448  IQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            I+I PFN+ +E +EG+FD+ GN++   N  D+KDAWLD+ID
Sbjct  106  IKITPFNMLEEMDEGHFDSEGNFIFNRNSEDMKDAWLDNID  146



>ref|XP_010596815.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Loxodonta africana]
 ref|XP_010596816.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Loxodonta africana]
Length=350

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG FDA+GNY  ++N +  I+D WLD+I
Sbjct  67   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGRFDADGNY--FLNRDAQIRDNWLDNI  124

Query  568  D  570
            D
Sbjct  125  D  125



>ref|XP_009053028.1| hypothetical protein LOTGIDRAFT_144141 [Lottia gigantea]
 gb|ESO96291.1| hypothetical protein LOTGIDRAFT_144141 [Lottia gigantea]
Length=318

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E+G+QI PFN+ +E EEG+FD NG Y+ +  ++ I+D W+D+ID
Sbjct  51   EEGVQITPFNMREEMEEGHFDKNGMYI-FDKKDQIQDNWMDNID  93



>gb|ACQ58674.1| CD2 antigen cytoplasmic tail-binding protein 2 [Anoplopoma fimbria]
Length=382

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +1

Query  436  VEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
             ++G+ I PFNL++E +EGYFD+ GNY     E  I+D WLD+ID
Sbjct  78   FDEGVSITPFNLDEEMQEGYFDSEGNYF-IKKEEQIRDNWLDNID  121



>ref|XP_005831089.1| hypothetical protein GUITHDRAFT_109893 [Guillardia theta CCMP2712]
 gb|EKX44109.1| hypothetical protein GUITHDRAFT_109893 [Guillardia theta CCMP2712]
Length=337

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFD-ANGNYVEYVNENDIKDAWLDSID  570
            E GI+IEPFN + EREEG+FD A+G+YVE   +   +DAWLD ++
Sbjct  65   ESGIRIEPFNTDMEREEGHFDAASGHYVEDKFKMSQRDAWLDEVN  109



>ref|XP_003418899.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Loxodonta africana]
Length=343

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNETFV---EDGIQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E      E G++I PFNL +E EEG FDA+GNY  ++N +  I+D WLD+I
Sbjct  67   LASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGRFDADGNY--FLNRDAQIRDNWLDNI  124

Query  568  D  570
            D
Sbjct  125  D  125



>gb|AAH75535.1| CAP-GLY domain containing linker protein family, member 4 [Xenopus 
(Silurana) tropicalis]
Length=400

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +1

Query  409  EAYEDNETFVEDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E  E++    E G+ I PFNL +E EEG+FD+ GNY     E  I+D WLD+ID
Sbjct  69   EGQENSTLESEGGVPITPFNLKEEMEEGHFDSEGNYF-LRKEAQIRDHWLDNID  121



>ref|XP_010767594.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Notothenia 
coriiceps]
Length=382

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            ++G+ I PFNL++E +EGYFD+ GNY     E +I+D WLD+ID
Sbjct  79   DEGVSITPFNLDEEMQEGYFDSEGNYF-VKKEEEIRDNWLDNID  121



>ref|XP_008592062.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Galeopterus 
variegatus]
Length=341

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +1

Query  400  LAEEAYEDNE--TFVEDG-IQIEPFNLNKEREEGYFDANGNYVEYVNEN-DIKDAWLDSI  567
            LA E  E  E  T   +G ++I PFNL +E EEG+FDA+GNY  ++N +  I+D+WLD+I
Sbjct  65   LASEDVEGQEAATLPSEGDVRITPFNLQEEMEEGHFDADGNY--FLNRDAQIRDSWLDNI  122

Query  568  D  570
            D
Sbjct  123  D  123



>gb|AAH45270.1| Cd2bp2 protein [Xenopus laevis]
Length=403

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E G+ I PFNL +E EEG+FD+ GNY     E+ I+D WLD+ID
Sbjct  79   EGGVPITPFNLKEEMEEGHFDSEGNYF-LRKEDQIRDHWLDNID  121



>ref|NP_001080561.1| CD2 (cytoplasmic tail) binding protein 2 [Xenopus laevis]
 gb|AAI08871.1| Cd2bp2 protein [Xenopus laevis]
Length=403

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +1

Query  439  EDGIQIEPFNLNKEREEGYFDANGNYVEYVNENDIKDAWLDSID  570
            E G+ I PFNL +E EEG+FD+ GNY     E+ I+D WLD+ID
Sbjct  79   EGGVPITPFNLKEEMEEGHFDSEGNYF-LRKEDQIRDHWLDNID  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875