BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050H22

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004171648.1|  PREDICTED: serine/threonine-protein phosphat...    266   1e-86   
gb|EYU44112.1|  hypothetical protein MIMGU_mgv1a025841mg                261   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_003591564.1|  Serine/threonine protein phosphatase               261   2e-84   
ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          276   5e-83   
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               274   1e-82   Gossypium arboreum [tree cotton]
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    275   1e-82   
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               274   1e-82   Gossypium arboreum [tree cotton]
gb|EYU38113.1|  hypothetical protein MIMGU_mgv1a0013161mg               271   2e-82   Erythranthe guttata [common monkey flower]
emb|CDP03570.1|  unnamed protein product                                272   9e-82   Coffea canephora [robusta coffee]
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    272   1e-81   Solanum tuberosum [potatoes]
ref|XP_010556800.1|  PREDICTED: serine/threonine-protein phosphat...    270   1e-81   
ref|NP_001266004.1|  Hop-interacting protein THI129                     272   1e-81   Solanum lycopersicum
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             272   1e-81   Prunus persica
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    271   2e-81   Prunus mume [ume]
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    271   2e-81   Cucumis melo [Oriental melon]
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  270   7e-81   Ricinus communis
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    270   7e-81   
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    270   7e-81   Nicotiana sylvestris
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    270   1e-80   
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    270   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    269   1e-80   Tarenaya hassleriana [spider flower]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    269   2e-80   Sesamum indicum [beniseed]
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    269   2e-80   
gb|KDO87445.1|  hypothetical protein CISIN_1g002713mg                   266   3e-80   Citrus sinensis [apfelsine]
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         268   3e-80   Jatropha curcas
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    267   6e-80   Nicotiana tomentosiformis
gb|KJB22560.1|  hypothetical protein B456_004G054500                    266   1e-79   Gossypium raimondii
gb|EPS69063.1|  serine/threonine-protein phosphatase                    254   1e-79   Genlisea aurea
ref|XP_006575099.1|  PREDICTED: serine/threonine-protein phosphat...    264   2e-79   
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    266   2e-79   
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    266   2e-79   Cicer arietinum [garbanzo]
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             266   3e-79   Citrus clementina [clementine]
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             266   3e-79   Citrus clementina [clementine]
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    265   4e-79   
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    265   5e-79   Tarenaya hassleriana [spider flower]
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Fragaria vesca subsp. vesca
gb|AES61845.2|  serine/threonine-protein phosphatase                    263   2e-78   Medicago truncatula
emb|CDY17964.1|  BnaC03g30360D                                          263   2e-78   Brassica napus [oilseed rape]
emb|CDX90906.1|  BnaA03g25860D                                          263   2e-78   
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Brassica rapa
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Vitis vinifera
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    263   3e-78   Morella rubra [Chinese arbutus]
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    263   3e-78   Glycine max [soybeans]
ref|XP_002321044.2|  phosphatase family protein                         263   3e-78   
gb|KJB42021.1|  hypothetical protein B456_007G132700                    262   4e-78   Gossypium raimondii
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             262   4e-78   Capsella rubella
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             262   4e-78   Phaseolus vulgaris [French bean]
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    262   5e-78   
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    262   5e-78   
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    261   8e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    261   1e-77   Eucalyptus grandis [rose gum]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    260   1e-77   Gossypium arboreum [tree cotton]
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    261   1e-77   Arabidopsis lyrata subsp. lyrata
gb|KJB22562.1|  hypothetical protein B456_004G054500                    261   2e-77   Gossypium raimondii
gb|AAM83219.1|  AT4g03080/T4I9_4                                        260   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    260   3e-77   Populus euphratica
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             260   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    260   3e-77   Populus euphratica
ref|XP_008813653.1|  PREDICTED: serine/threonine-protein phosphat...    248   3e-77   Phoenix dactylifera
ref|XP_008813652.1|  PREDICTED: serine/threonine-protein phosphat...    248   3e-77   
ref|XP_008813651.1|  PREDICTED: serine/threonine-protein phosphat...    248   3e-77   
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    260   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    259   6e-77   Glycine max [soybeans]
emb|CAN67846.1|  hypothetical protein VITISV_016669                     242   7e-77   Vitis vinifera
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    259   8e-77   Arabis alpina [alpine rockcress]
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    259   9e-77   Nelumbo nucifera [Indian lotus]
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             258   2e-76   Eutrema salsugineum [saltwater cress]
emb|CDX97296.1|  BnaA02g20870D                                          258   2e-76   
emb|CDY62088.1|  BnaC02g46770D                                          257   3e-76   Brassica napus [oilseed rape]
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    257   3e-76   Brassica rapa
ref|XP_011011094.1|  PREDICTED: serine/threonine-protein phosphat...    256   3e-76   Populus euphratica
ref|XP_010910522.1|  PREDICTED: serine/threonine-protein phosphat...    242   6e-76   Elaeis guineensis
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    256   1e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    256   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_002301559.1|  phosphatase family protein                         255   2e-75   
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    255   3e-75   Populus euphratica
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    255   3e-75   Populus euphratica
gb|AEK86563.1|  serine/threonine-protein phosphatase                    253   2e-74   Camellia sinensis [black tea]
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    249   4e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    248   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW82656.1|  hypothetical protein ZEAMMB73_760112                    225   6e-67   
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    229   7e-66   Elaeis guineensis
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...    228   1e-65   Setaria italica
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440          226   5e-65   Sorghum bicolor [broomcorn]
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...    224   2e-64   Phoenix dactylifera
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...    225   2e-64   Zea mays [maize]
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...    225   2e-64   Zea mays [maize]
gb|EEE62303.1|  hypothetical protein OsJ_17091                          224   3e-64   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054625.1|  Os05g0144400                                       224   4e-64   
ref|XP_006846753.1|  hypothetical protein AMTR_s00276p00018700          209   5e-64   
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...    222   2e-63   Brachypodium distachyon [annual false brome]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61   Brachypodium distachyon [annual false brome]
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61   Brachypodium distachyon [annual false brome]
gb|KGN47885.1|  hypothetical protein Csa_6G409910                       180   2e-50   Cucumis sativus [cucumbers]
gb|KHG00523.1|  Serine/threonine-protein phosphatase BSL3 -like p...    175   2e-49   Gossypium arboreum [tree cotton]
ref|XP_001760494.1|  predicted protein                                  182   5e-49   
gb|KGN66599.1|  hypothetical protein Csa_1G638460                       180   6e-49   Cucumis sativus [cucumbers]
gb|EYU25964.1|  hypothetical protein MIMGU_mgv1a0006242mg               174   1e-48   Erythranthe guttata [common monkey flower]
gb|EYU41291.1|  hypothetical protein MIMGU_mgv1a0202661mg               174   1e-48   Erythranthe guttata [common monkey flower]
dbj|BAK03675.1|  predicted protein                                      174   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009598633.1|  PREDICTED: serine/threonine-protein phosphat...    172   2e-48   Nicotiana tomentosiformis
ref|XP_009598634.1|  PREDICTED: serine/threonine-protein phosphat...    171   3e-48   Nicotiana tomentosiformis
ref|XP_001781021.1|  predicted protein                                  180   3e-48   
dbj|BAF00990.1|  putative phosphoprotein phosphatase                    178   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...    179   6e-48   
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...    179   7e-48   
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...    179   8e-48   Eucalyptus grandis [rose gum]
ref|XP_006367867.1|  PREDICTED: serine/threonine-protein phosphat...    172   8e-48   
gb|EPS67556.1|  serine/threonine-protein phosphatase                    168   9e-48   Genlisea aurea
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2          179   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2             179   1e-47   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19666.1|  AT1G08420                                              179   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...    178   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...    178   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...    178   2e-47   Prunus mume [ume]
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...    178   2e-47   Prunus mume [ume]
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...    178   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...    177   2e-47   
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg             177   2e-47   Prunus persica
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...    177   2e-47   
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g             177   2e-47   
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...    177   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1          178   2e-47   
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                    177   3e-47   Arabis alpina [alpine rockcress]
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...    177   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...    177   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...    177   3e-47   Populus euphratica
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...    177   3e-47   Camelina sativa [gold-of-pleasure]
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                   177   3e-47   Citrus sinensis [apfelsine]
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...    177   3e-47   Gossypium arboreum [tree cotton]
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...    177   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2          177   3e-47   
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...    177   3e-47   Fragaria vesca subsp. vesca
ref|XP_002889692.1|  kelch repeat-containing protein                    177   3e-47   Arabidopsis lyrata subsp. lyrata
gb|KJB55556.1|  hypothetical protein B456_009G082300                    177   4e-47   Gossypium raimondii
emb|CDY22684.1|  BnaC08g43180D                                          177   4e-47   Brassica napus [oilseed rape]
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...    177   4e-47   Brassica rapa
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg             177   4e-47   
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg             177   4e-47   Eutrema salsugineum [saltwater cress]
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg             177   5e-47   Citrus clementina [clementine]
gb|KJB35474.1|  hypothetical protein B456_006G116600                    177   5e-47   Gossypium raimondii
emb|CDY06313.1|  BnaA09g48900D                                          177   5e-47   
gb|KJB35473.1|  hypothetical protein B456_006G116600                    177   5e-47   Gossypium raimondii
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...    177   5e-47   Nelumbo nucifera [Indian lotus]
gb|KJB35470.1|  hypothetical protein B456_006G116600                    177   6e-47   Gossypium raimondii
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...    177   6e-47   Gossypium arboreum [tree cotton]
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...    177   6e-47   
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...    176   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...    176   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg             176   7e-47   
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...    177   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...    176   8e-47   Nicotiana sylvestris
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...    176   8e-47   Vitis vinifera
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg             176   8e-47   Capsella rubella
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...    176   8e-47   Nicotiana sylvestris
ref|XP_001765008.1|  predicted protein                                  176   8e-47   
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...    176   8e-47   Nicotiana sylvestris
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...    176   9e-47   Tarenaya hassleriana [spider flower]
emb|CBI24435.3|  unnamed protein product                                176   1e-46   Vitis vinifera
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...    176   1e-46   
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...    176   1e-46   Tarenaya hassleriana [spider flower]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3             176   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg             176   1e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...    176   1e-46   Tarenaya hassleriana [spider flower]
gb|KDP42962.1|  hypothetical protein JCGZ_23904                         176   1e-46   Jatropha curcas
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...    176   1e-46   Camelina sativa [gold-of-pleasure]
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3          176   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...    176   1e-46   Populus euphratica
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Solanum tuberosum [potatoes]
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...    174   2e-46   
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Sesamum indicum [beniseed]
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like     175   2e-46   Solanum tuberosum [potatoes]
emb|CDP15567.1|  unnamed protein product                                175   2e-46   Coffea canephora [robusta coffee]
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Nicotiana tomentosiformis
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Sesamum indicum [beniseed]
ref|XP_002313501.2|  kelch repeat-containing family protein             175   2e-46   
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Solanum lycopersicum
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Nicotiana tomentosiformis
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Sesamum indicum [beniseed]
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Solanum lycopersicum
emb|CDY31148.1|  BnaA08g26980D                                          175   2e-46   Brassica napus [oilseed rape]
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690          176   2e-46   
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...    175   2e-46   Brassica rapa
gb|AAD26883.1|  putative phosphoprotein phosphatase                     173   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1             173   2e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97481.1|  BnaC08g13460D                                          175   2e-46   
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932             174   3e-46   
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371             174   3e-46   
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg                174   3e-46   Erythranthe guttata [common monkey flower]
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...    174   3e-46   Solanum tuberosum [potatoes]
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...    174   3e-46   Solanum tuberosum [potatoes]
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...    174   3e-46   Setaria italica
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850          174   4e-46   Sorghum bicolor [broomcorn]
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...    174   4e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...    174   4e-46   Zea mays [maize]
emb|CDY57791.1|  BnaCnng32470D                                          174   4e-46   Brassica napus [oilseed rape]
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...    174   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...    174   5e-46   Populus euphratica
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...    174   5e-46   Brassica rapa
emb|CDY57485.1|  BnaAnng14650D                                          174   5e-46   Brassica napus [oilseed rape]
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    174   6e-46   Nicotiana sylvestris
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...    174   6e-46   Cucumis melo [Oriental melon]
ref|XP_006594918.1|  PREDICTED: serine/threonine-protein phosphat...    172   8e-46   Glycine max [soybeans]
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...    173   8e-46   Sesamum indicum [beniseed]
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...    173   9e-46   Solanum lycopersicum
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g             173   9e-46   Phaseolus vulgaris [French bean]
ref|XP_009788953.1|  PREDICTED: serine/threonine-protein phosphat...    171   9e-46   Nicotiana sylvestris
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...    173   1e-45   
ref|XP_001769730.1|  predicted protein                                  173   1e-45   
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...    173   1e-45   Zea mays [maize]
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...    173   1e-45   Sesamum indicum [beniseed]
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...    173   1e-45   Solanum lycopersicum
gb|KJB21740.1|  hypothetical protein B456_004G011600                    173   1e-45   Gossypium raimondii
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...    172   1e-45   Glycine max [soybeans]
gb|EEC75832.1|  hypothetical protein OsI_12812                          172   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...    172   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...    172   2e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...    171   2e-45   Triticum urartu
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...    172   2e-45   Phoenix dactylifera
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...    172   2e-45   Phoenix dactylifera
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...    172   2e-45   Phoenix dactylifera
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...    172   2e-45   Cucumis sativus [cucumbers]
ref|NP_001266022.1|  Hop-interacting protein THI140                     171   4e-45   Solanum lycopersicum
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...    171   4e-45   
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...    171   4e-45   Oryza brachyantha
ref|XP_010658896.1|  PREDICTED: serine/threonine-protein phosphat...    171   4e-45   
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...    171   4e-45   
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...    171   5e-45   Glycine max [soybeans]
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...    171   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...    171   5e-45   Brachypodium distachyon [annual false brome]
ref|XP_010658894.1|  PREDICTED: serine/threonine-protein phosphat...    170   6e-45   
ref|XP_010658895.1|  PREDICTED: serine/threonine-protein phosphat...    170   7e-45   
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...    171   7e-45   Elaeis guineensis
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...    171   7e-45   Elaeis guineensis
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...    171   8e-45   Brachypodium distachyon [annual false brome]
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...    171   8e-45   Nicotiana tomentosiformis
emb|CBI24997.3|  unnamed protein product                                170   9e-45   Vitis vinifera
gb|EPS70499.1|  hypothetical protein M569_04238                         171   9e-45   Genlisea aurea
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...    170   1e-44   Vitis vinifera
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...    169   2e-44   
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1          168   2e-44   
ref|NP_001067290.1|  Os12g0617900                                       169   2e-44   
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...    169   2e-44   
ref|XP_003596905.1|  Serine/threonine protein phosphatase               169   3e-44   Medicago truncatula
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460          169   3e-44   Sorghum bicolor [broomcorn]
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...    169   3e-44   Cicer arietinum [garbanzo]
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...    169   4e-44   Setaria italica
gb|AAF22889.1|AC006932_6  T27G7.10                                      167   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577251.1|  PREDICTED: serine/threonine-protein phosphat...    165   7e-43   Brachypodium distachyon [annual false brome]
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2               164   1e-42   Glycine soja [wild soybean]
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...    162   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...    162   2e-42   
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg             161   5e-42   
ref|XP_010031570.1|  PREDICTED: serine/threonine-protein phosphat...    159   8e-41   Eucalyptus grandis [rose gum]
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...    154   1e-39
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g             155   1e-39   Phaseolus vulgaris [French bean]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-39   Glycine max [soybeans]
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-39   Glycine max [soybeans]
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...    154   5e-39   
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...    154   6e-39   
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...    154   7e-39   Glycine max [soybeans]
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...    153   1e-38   Medicago truncatula
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...    152   3e-38   Cicer arietinum [garbanzo]
ref|XP_010522673.1|  PREDICTED: serine/threonine-protein phosphat...    147   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_008679907.1|  PREDICTED: serine/threonine-protein phosphat...    134   7e-36   
gb|KDO87440.1|  hypothetical protein CISIN_1g002713mg                   143   2e-35   Citrus sinensis [apfelsine]
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...    140   3e-34   
gb|KHN03759.1|  Serine/threonine-protein phosphatase BSL1               140   3e-34   Glycine soja [wild soybean]
ref|XP_004173418.1|  PREDICTED: serine/threonine-protein phosphat...    136   3e-34   
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...    139   4e-34   Triticum urartu
gb|KFK42699.1|  hypothetical protein AALP_AA1G028300                    140   5e-34   Arabis alpina [alpine rockcress]
ref|XP_002513730.1|  bsu-protein phosphatase, putative                  139   9e-34   
ref|XP_002974662.1|  hypothetical protein SELMODRAFT_442608             139   1e-33   
gb|EEE59591.1|  hypothetical protein OsJ_11899                          139   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002963377.1|  hypothetical protein SELMODRAFT_438528             138   1e-33   Selaginella moellendorffii
gb|EMT33719.1|  Serine/threonine-phosphatase BSL2-like protein          139   1e-33   
gb|AAF86539.1|AC002560_32  F21B7.7                                      138   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002499734.1|  predicted protein                                  137   3e-33   Micromonas commoda
gb|EEE65895.1|  hypothetical protein OsJ_21718                          137   4e-33   
gb|KHN36505.1|  Serine/threonine-protein phosphatase BSL2               134   3e-32   
gb|KFK42698.1|  hypothetical protein AALP_AA1G028300                    135   4e-32   
ref|XP_003058098.1|  predicted protein                                  134   4e-32   
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...    132   2e-31   
gb|EMT11348.1|  Serine/threonine phosphatase BSL1-like protein          132   2e-31   
ref|XP_001689767.1|  protein phosphatase 1 beta                         132   2e-31   
ref|XP_006418234.1|  hypothetical protein EUTSA_v10009980mg             131   3e-31   
emb|CDY29598.1|  BnaA05g15720D                                          130   7e-31   
ref|XP_002958148.1|  hypothetical protein VOLCADRAFT_84366              130   8e-31   
ref|XP_009144944.1|  PREDICTED: serine/threonine-protein phosphat...    130   8e-31   
ref|XP_005846245.1|  hypothetical protein CHLNCDRAFT_135536             127   1e-29   
ref|XP_001785960.1|  predicted protein                                  120   2e-27   
gb|KJB22561.1|  hypothetical protein B456_004G054500                    120   3e-27   
gb|EMT08803.1|  Serine/threonine-phosphatase BSL2-like protein          117   2e-26   
ref|XP_003605992.1|  Serine/threonine protein phosphatase               117   2e-26   
ref|XP_005645525.1|  protein phosphatase 1 beta                         116   8e-26   
ref|XP_007510268.1|  predicted protein                                  115   2e-25   
gb|KHN46606.1|  Serine/threonine-protein phosphatase BSL1               110   4e-24   
gb|KIY99882.1|  hypothetical protein MNEG_8078                          109   5e-24   
tpg|DAA36009.1|  TPA: hypothetical protein ZEAMMB73_169463              106   2e-23   
ref|XP_001420111.1|  predicted protein                                  108   5e-23   
gb|KDD72504.1|  hypothetical protein H632_c3260p0                       100   1e-22   
gb|KHN47652.1|  Serine/threonine-protein phosphatase BSL1             94.7    3e-21   
emb|CEF99328.1|  Serine/threonine-specific protein phosphatase/bi...  99.4    5e-20   
ref|XP_004166312.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    5e-20   
ref|XP_011402161.1|  Serine/threonine-protein phosphatase BSL3        97.1    2e-19   
gb|AFW68154.1|  hypothetical protein ZEAMMB73_166373                  92.4    2e-19   
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...  95.9    4e-19   
ref|XP_001782643.1|  predicted protein                                91.7    7e-18   
ref|XP_007015660.1|  BRI1 suppressor 1 (BSU1)-like 3 isoform 4        91.7    2e-17   
gb|EMS49544.1|  Serine/threonine-protein phosphatase BSL2-like pr...  90.1    5e-17   
ref|XP_008787777.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    5e-17   
ref|XP_008787776.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    5e-17   
ref|XP_004982315.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    5e-17   
ref|XP_008677859.1|  PREDICTED: serine/threonine-protein phosphat...  75.5    4e-14   
ref|XP_008664401.1|  PREDICTED: serine/threonine-protein phosphat...  76.3    5e-14   
ref|XP_764058.1|  serine/threonine protein phosphatase                77.8    6e-13   
gb|EJY69834.1|  Serine/threonine-protein phosphatase                  72.4    3e-11   
ref|XP_004036424.1|  protein serine threonine phosphatase alpha, ...  72.4    3e-11   
emb|CDW79491.1|  ser thr protein phosphatase family                   72.0    5e-11   
ref|XP_004030178.1|  ser thr protein phosphatase family protein, ...  71.6    5e-11   
ref|XP_009692418.1|  serine/threonine protein phosphatase             71.6    5e-11   
ref|XP_953085.1|  serine/threonine phosphatase                        70.9    1e-10   
gb|KHN03760.1|  Serine/threonine-protein phosphatase BSL1             63.9    2e-10   
gb|EJY66618.1|  Serine/threonine-protein phosphatase                  68.6    5e-10   
ref|XP_001022531.2|  Ser/Thr protein phosphatase family protein       67.8    1e-09   
ref|XP_001443631.1|  hypothetical protein                             67.4    1e-09   
emb|CDW91130.1|  ser thr protein phosphatase family protein           67.0    2e-09   
ref|XP_004036618.1|  ser thr protein phosphatase family protein, ...  66.6    3e-09   
ref|XP_010106779.1|  hypothetical protein L484_020801                 61.6    3e-09   
ref|XP_001458952.1|  hypothetical protein                             65.9    4e-09   
gb|AFW82657.1|  hypothetical protein ZEAMMB73_760112                  63.2    4e-09   
ref|XP_010098907.1|  hypothetical protein L484_006545                 60.5    8e-09   
ref|XP_006596155.1|  PREDICTED: serine/threonine-protein phosphat...  61.2    1e-08   
ref|XP_006596156.1|  PREDICTED: serine/threonine-protein phosphat...  60.8    1e-08   
ref|XP_004034580.1|  ser thr protein phosphatase family protein, ...  63.9    2e-08   
ref|XP_001457219.1|  hypothetical protein                             63.9    2e-08   
ref|XP_001431503.1|  hypothetical protein                             63.5    3e-08   
ref|XP_001442092.1|  hypothetical protein                             63.2    3e-08   
ref|XP_001446805.1|  hypothetical protein                             62.8    4e-08   
ref|XP_004023911.1|  ser thr protein phosphatase family protein, ...  62.4    5e-08   
gb|KHG13462.1|  Acyl-CoA-binding domain-containing 4 -like protein    62.4    6e-08   
ref|XP_001447213.1|  hypothetical protein                             62.0    6e-08   
tpg|DAA48983.1|  TPA: hypothetical protein ZEAMMB73_811880            61.2    9e-08   
tpg|DAA46907.1|  TPA: hypothetical protein ZEAMMB73_094953            61.6    1e-07   
tpg|DAA48783.1|  TPA: hypothetical protein ZEAMMB73_808698            61.2    1e-07   
ref|XP_001438977.1|  hypothetical protein                             61.2    1e-07   
ref|XP_001429774.1|  hypothetical protein                             61.2    1e-07   
gb|KJB45986.1|  hypothetical protein B456_007G342000                  60.8    2e-07   
gb|KJB45987.1|  hypothetical protein B456_007G342000                  60.5    2e-07   
ref|XP_001454844.1|  hypothetical protein                             60.5    2e-07   
ref|XP_001760924.1|  predicted protein                                60.1    3e-07   
dbj|GAM25989.1|  hypothetical protein SAMD00019534_091640             60.1    3e-07   
ref|XP_743286.1|  protein serine/threonine phosphatase                59.7    5e-07   
gb|KIO08443.1|  hypothetical protein M404DRAFT_997371                 59.7    5e-07   
emb|CDO67125.1|  protein phosphatase containing kelch-like domain...  59.3    5e-07   
gb|EAR82584.2|  serine/threonine-protein phosphatase                  59.3    5e-07   
ref|XP_001030247.1|  Ser/Thr protein phosphatase family protein       59.3    5e-07   
ref|XP_009609103.1|  PREDICTED: rab9 effector protein with kelch ...  59.3    5e-07   
ref|XP_004831147.1|  Ser/Thr protein phosphatase family member pr...  59.3    6e-07   
ref|XP_003081555.1|  Serine/threonine specific protein phosphatas...  59.3    6e-07   
ref|XP_006344772.1|  PREDICTED: tip elongation aberrant protein 1...  59.3    6e-07   
gb|KIM66365.1|  hypothetical protein SCLCIDRAFT_370635                59.3    6e-07   
ref|XP_004231294.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.9    6e-07   
ref|XP_008622216.1|  protein phosphatase                              59.3    6e-07   
ref|XP_009609100.1|  PREDICTED: host cell factor 2-like isoform X2    58.9    7e-07   
ref|XP_009609099.1|  PREDICTED: host cell factor 2-like isoform X1    58.9    7e-07   
ref|XP_009609101.1|  PREDICTED: uncharacterized protein LOC104102...  58.9    7e-07   
ref|XP_009609102.1|  PREDICTED: host cell factor 2-like isoform X4    58.9    7e-07   
gb|KIJ21929.1|  hypothetical protein PAXINDRAFT_165264                59.3    7e-07   
gb|EUD70469.1|  protein phosphatase                                   58.9    7e-07   
emb|CDR15635.1|  protein phosphatase containing kelch-like domain...  58.9    7e-07   
emb|CDX96712.1|  BnaA08g22550D                                        58.9    7e-07   
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505           58.9    8e-07   
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315           58.9    8e-07   
ref|XP_009110336.1|  PREDICTED: rab9 effector protein with kelch ...  58.5    8e-07   
gb|AAC69437.1|  protein serine/threonine phosphatase alpha            58.9    8e-07   
ref|XP_008785617.1|  PREDICTED: dynein alpha chain, flagellar out...  58.5    9e-07   
gb|EWC73527.1|  hypothetical protein C923_05783                       58.5    9e-07   
gb|ETW46597.1|  hypothetical protein PFMALIP_05500                    58.5    9e-07   
ref|XP_001348804.1|  protein serine/threonine phosphatase             58.5    9e-07   
gb|KIK30328.1|  hypothetical protein PISMIDRAFT_26779                 58.9    9e-07   
emb|CBJ30351.1|  conserved unknown protein                            58.2    9e-07   
ref|XP_001018236.1|  Kelch motif family protein                       58.5    1e-06   
gb|EAR97991.2|  kelch motif protein                                   58.5    1e-06   
ref|XP_009373292.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.5    1e-06   
dbj|GAM28083.1|  hypothetical protein SAMD00019534_112590             58.2    1e-06   
emb|CDX83831.1|  BnaC08g18140D                                        58.2    1e-06   
ref|XP_009106076.1|  PREDICTED: tip elongation aberrant protein 1...  58.2    1e-06   
emb|CDX96521.1|  BnaA07g31320D                                        58.2    1e-06   
ref|XP_011092157.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.2    1e-06   
ref|XP_011092154.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.2    1e-06   
ref|XP_009106075.1|  PREDICTED: tip elongation aberrant protein 1...  57.8    1e-06   
ref|XP_009106074.1|  PREDICTED: host cell factor 2 isoform X1         57.8    2e-06   
ref|XP_006307166.1|  hypothetical protein CARUB_v10008756mg           57.8    2e-06   
ref|XP_011092156.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.8    2e-06   
ref|XP_004035870.1|  kelch motif family protein, putative             57.8    2e-06   
ref|XP_006307165.1|  hypothetical protein CARUB_v10008756mg           57.8    2e-06   
ref|XP_009790949.1|  PREDICTED: rab9 effector protein with kelch ...  57.8    2e-06   
ref|XP_003057702.1|  flagellar outer arm dynein alpha chain           57.8    2e-06   
ref|XP_009790950.1|  PREDICTED: host cell factor 2-like isoform X2    57.4    2e-06   
emb|CDS50472.1|  protein phosphatase containing kelch-like domains    57.8    2e-06   
ref|XP_678280.1|  protein serine/threonine phosphatase                57.8    2e-06   
ref|XP_001031447.1|  Ser/Thr protein phosphatase family protein       57.4    2e-06   
gb|ETB63046.1|  hypothetical protein YYC_00643                        57.4    2e-06   
ref|XP_727284.1|  protein serine/threonine phosphatase alpha          57.4    2e-06   
ref|XP_008246027.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.4    3e-06   
ref|XP_001759823.1|  predicted protein                                57.4    3e-06   
ref|XP_004144782.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    3e-06   
ref|XP_008246033.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    3e-06   
ref|XP_010939198.1|  PREDICTED: uncharacterized protein LOC105058101  56.6    4e-06   
ref|XP_002114565.1|  hypothetical protein TRIADDRAFT_58524            56.2    4e-06   
ref|XP_007265300.1|  hypothetical protein FOMMEDRAFT_105816           56.6    4e-06   
ref|XP_002501033.1|  predicted protein                                54.7    4e-06   
gb|KIL00556.1|  hypothetical protein PAXRUDRAFT_821548                56.6    5e-06   
ref|XP_002513729.1|  hypothetical protein RCOM_1754260                53.9    5e-06   
ref|XP_006433544.1|  hypothetical protein CICLE_v10000538mg           56.2    5e-06   
gb|KIP12569.1|  hypothetical protein PHLGIDRAFT_97993                 56.6    5e-06   
gb|EMG45998.1|  hypothetical protein G210_3771                        56.6    5e-06   
emb|CCF73649.1|  unnamed protein product                              56.2    5e-06   
ref|XP_008370603.1|  PREDICTED: tip elongation aberrant protein 1...  56.2    5e-06   
ref|XP_006472216.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    6e-06   
ref|XP_006472215.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    6e-06   
ref|XP_006472214.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    6e-06   
emb|CDJ60037.1|  protein serine/threonine phosphatase, putative /...  52.4    7e-06   
ref|XP_006851311.1|  hypothetical protein AMTR_s00050p00180490        55.8    7e-06   
ref|XP_004166313.1|  PREDICTED: serine/threonine-protein phosphat...  53.9    7e-06   
ref|XP_002992132.1|  hypothetical protein SELMODRAFT_134811           55.8    7e-06   
emb|CDR94993.1|  kelch repeat domain containing/Serine/threonine ...  55.8    8e-06   
gb|KIJ65005.1|  hypothetical protein HYDPIDRAFT_27741                 55.8    8e-06   
gb|EDK39526.2|  hypothetical protein PGUG_03624                       55.8    8e-06   
ref|XP_001484243.1|  hypothetical protein PGUG_03624                  55.8    8e-06   
gb|EFA80233.1|  WW domain-containing protein                          55.8    9e-06   
emb|CBI39602.3|  unnamed protein product                              55.5    9e-06   
emb|CAN71813.1|  hypothetical protein VITISV_023418                   55.5    1e-05   
ref|XP_010659707.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  55.5    1e-05   
ref|XP_008781141.1|  PREDICTED: uncharacterized protein LOC103700...  55.5    1e-05   
ref|XP_008781142.1|  PREDICTED: rab9 effector protein with kelch ...  55.5    1e-05   
ref|XP_002977136.1|  hypothetical protein SELMODRAFT_52725            55.1    1e-05   
ref|XP_008781143.1|  PREDICTED: rab9 effector protein with kelch ...  55.5    1e-05   
emb|CDS10881.1|  hypothetical protein LRAMOSA11367                    55.1    1e-05   
gb|KHG10768.1|  Acyl-CoA-binding domain-containing 4 -like protein    55.1    1e-05   
ref|XP_001751751.1|  predicted protein                                55.1    1e-05   
gb|KJB82618.1|  hypothetical protein B456_013G205300                  55.1    1e-05   
ref|XP_002512412.1|  acyl-CoA binding protein, putative               55.1    1e-05   
ref|XP_007360381.1|  hypothetical protein DICSQDRAFT_164746           55.1    1e-05   
ref|XP_002260205.1|  protein serine/threonine phosphatase             55.1    1e-05   
ref|XP_011129275.1|  serine/threonine-protein phosphatase             54.7    2e-05   
ref|XP_008454347.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.1    2e-05   
ref|XP_008454338.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.1    2e-05   
ref|XP_001609688.1|  kelch repeat domain containing/Serine/threon...  54.7    2e-05   
gb|KHN22340.1|  Rab9 effector protein with kelch motifs               54.7    2e-05   
ref|XP_008808697.1|  PREDICTED: acyl-CoA-binding domain-containin...  54.7    2e-05   
gb|KHN19606.1|  Rab9 effector protein with kelch motifs               54.7    2e-05   
ref|XP_010477041.1|  PREDICTED: kelch domain-containing protein 3...  54.3    2e-05   
ref|XP_001615727.1|  protein serine/threonine phosphatase             54.7    2e-05   
ref|XP_006578524.1|  PREDICTED: uncharacterized protein LOC100785...  54.7    2e-05   
ref|XP_007298021.1|  hypothetical protein STEHIDRAFT_46843            54.7    2e-05   
ref|XP_008813960.1|  protein phosphatase                              54.7    2e-05   
ref|XP_007207197.1|  hypothetical protein PRUPE_ppa002989mg           54.3    2e-05   
gb|EYU38418.1|  hypothetical protein MIMGU_mgv1a003167mg              54.3    2e-05   
gb|EGO04494.1|  hypothetical protein SERLA73DRAFT_82409               54.7    2e-05   
gb|EPS66303.1|  hypothetical protein M569_08473                       53.9    2e-05   
ref|XP_004302233.1|  PREDICTED: RING finger protein B-like            54.3    2e-05   
sp|Q39610.2|DYHA_CHLRE  RecName: Full=Dynein alpha chain, flagell...  54.7    2e-05   
ref|XP_009057728.1|  hypothetical protein LOTGIDRAFT_121915           53.9    2e-05   
ref|XP_001695733.1|  flagellar outer dynein arm heavy chain alpha     54.7    2e-05   
ref|XP_006649738.1|  PREDICTED: acyl-CoA-binding domain-containin...  51.6    3e-05   
ref|XP_006302087.1|  hypothetical protein CARUB_v10020076mg           54.3    3e-05   
emb|CDX74147.1|  BnaA03g29000D                                        54.3    3e-05   
ref|NP_173296.3|  galactose oxidase/kelch repeat domain-containin...  54.3    3e-05   
ref|XP_010938234.1|  PREDICTED: rab9 effector protein with kelch ...  54.3    3e-05   
ref|XP_006649737.1|  PREDICTED: acyl-CoA-binding domain-containin...  52.0    3e-05   
ref|XP_003284707.1|  hypothetical protein DICPUDRAFT_75664            54.3    3e-05   
emb|CDY26745.1|  BnaA06g12770D                                        53.9    3e-05   
ref|XP_009134825.1|  PREDICTED: acyl-CoA-binding domain-containin...  54.3    3e-05   
ref|XP_010938233.1|  PREDICTED: rab9 effector protein with kelch ...  53.9    3e-05   
gb|KJB82620.1|  hypothetical protein B456_013G205300                  53.9    3e-05   
ref|XP_004301107.1|  PREDICTED: RING finger protein B                 53.9    3e-05   
ref|XP_009791118.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.9    3e-05   
ref|XP_009149338.1|  PREDICTED: rab9 effector protein with kelch ...  53.9    3e-05   
gb|KJB19439.1|  hypothetical protein B456_003G102300                  53.9    3e-05   
gb|KJB19441.1|  hypothetical protein B456_003G102300                  53.9    3e-05   
ref|XP_007312266.1|  hypothetical protein SERLADRAFT_364466           54.3    3e-05   
gb|KJB82619.1|  hypothetical protein B456_013G205300                  53.9    3e-05   
ref|XP_004335700.1|  Rab9 effector protein, putative                  53.9    3e-05   
gb|KFD56026.1|  hypothetical protein M513_03150                       53.5    3e-05   
ref|XP_010259671.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.9    3e-05   
ref|XP_006345112.1|  PREDICTED: tip elongation aberrant protein 1...  53.9    3e-05   
ref|XP_010259670.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.9    4e-05   
ref|XP_004338385.1|  BTB/POZ domain containing protein                53.9    4e-05   
ref|XP_004223870.1|  protein serine/threonine phosphatase             53.9    4e-05   
gb|KFD65976.1|  hypothetical protein M514_03150                       53.5    4e-05   
gb|KIK70799.1|  hypothetical protein GYMLUDRAFT_66014                 53.9    4e-05   
gb|KDQ30988.1|  hypothetical protein PLEOSDRAFT_1075193               53.5    5e-05   
emb|CDH57752.1|  kelch domain-containing protein                      53.5    5e-05   
ref|XP_010103362.1|  Acyl-CoA-binding domain-containing protein 4     53.1    5e-05   
ref|XP_010259260.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.5    5e-05   
ref|XP_010088948.1|  Acyl-CoA-binding domain-containing protein 4     53.5    5e-05   
ref|XP_010259261.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.5    5e-05   



>ref|XP_004171648.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like, partial 
[Cucumis sativus]
Length=173

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDL+VLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLFVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>gb|EYU44112.1| hypothetical protein MIMGU_mgv1a025841mg [Erythranthe guttata]
Length=207

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
            +GG    + LAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVG+MVVFQGGIGP
Sbjct  61   SGGLSPFLGLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGSMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_003591564.1| Serine/threonine protein phosphatase, partial [Medicago truncatula]
Length=203

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN++H+YDV ++KWTR++PAG+PPSPRAAHAAA VGTMVVFQGGIGPA
Sbjct  61   STSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAGDPPSPRAAHAAATVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_010112705.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
 gb|EXC34663.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
Length=883

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR LET+WDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAA VGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAATVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>gb|EYU38113.1| hypothetical protein MIMGU_mgv1a0013161mg, partial [Erythranthe 
guttata]
Length=696

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +GG  GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVG+MVVFQGGIGPA
Sbjct  61   SGGAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGSMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   272 bits (696),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 159/165 (96%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYRSLETFW TD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSLETFWATDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            NGG  GIRLAGVTN+IHSYDVLTRKW RL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NGGAPGIRLAGVTNSIHSYDVLTRKWIRLRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 158/165 (96%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            NG   GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_010556800.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X3 [Tarenaya hassleriana]
Length=756

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 158/165 (96%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            NG   GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   270 bits (690),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT THGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   GSSSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQR+L
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRFL  166



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   270 bits (690),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   AASAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   270 bits (690),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 158/165 (96%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +G   GIRLAGVTN +HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDL+VLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLFVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYD+LTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   GPSSAPGIRLAGVTNSVHSYDILTRKWTRMRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL PAPTYR+LE++WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLCPAPTYRTLESYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            NGG  GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NGGAPGIRLAGVTNSVHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCSHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYD+LTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDILTRKWTRMRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDL NDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLANDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>gb|KDO87445.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=769

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVSQRYL  166



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT +HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNSHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   GSSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQR+L
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRFL  166



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   267 bits (683),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATK HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKIHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +G   GIRLAGVTN +HSYDVLTRKWTR++PAG+PPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAGDPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>gb|EPS69063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=348

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR LE+FWD ++D+PGPRCGHTLTAV+ATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLESFWDAEDDSPGPRCGHTLTAVSATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWT-RLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
            NG   GIRLAGVTN++HSYDVLTRKWT RLQPAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   NGAAPGIRLAGVTNSVHSYDVLTRKWTSRLQPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD++++K KWHRVVVQGQGPGPRYGH MDLVAQRYL
Sbjct  121  AGHSTDDLYVLDMSHNKFKWHRVVVQGQGPGPRYGHAMDLVAQRYL  166



>ref|XP_006575099.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Glycine max]
Length=753

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYDV +RKWT ++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_004496005.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Cicer arietinum]
Length=885

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN++HSYD+ T+KWTR++PAG+PPSPRAAHAAA VGTMVVFQGGIGPA
Sbjct  61   SSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAGDPPSPRAAHAAATVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN++HSYD+ T+KWTR++PAG+PPSPRAAHAAA VGTMVVFQGGIGPA
Sbjct  61   SSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAGDPPSPRAAHAAATVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVSQRYL  166



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVSQRYL  166



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAG  530
                   + GVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPAG
Sbjct  61   AASAPG-ITGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAG  119

Query  531  HSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            HSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  120  HSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  163



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWDT+EDAPGPRC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYQALETFWDTEEDAPGPRCAHTLTAVAATKTRGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDL+VLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLFVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 4/166 (2%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M++KPWLYPAPTYR+LET+WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MSSKPWLYPAPTYRTLETYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD+  DK KWHRVVVQGQGPGPRYGHVMDLV QRYL
Sbjct  121  AGHSTDDLYVLDM--DKFKWHRVVVQGQGPGPRYGHVMDLVGQRYL  164



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN++H+YDV ++KWTR++PAG+PPSPRAAHAAA VGTMVVFQGGIGPA
Sbjct  61   STSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAGDPPSPRAAHAAATVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKYKWHRVVVQGEGPGPRYGHVMDLVSQRYL  165



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKYKWHRVVVQGEGPGPRYGHVMDLVSQRYL  165



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKYKWHRVVVQGEGPGPRYGHVMDLVSQRYL  165



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 154/164 (94%), Gaps = 2/164 (1%)
 Frame = +3

Query  177  AKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggng  356
            +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILFGGATAIEGG  
Sbjct  4    SKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILFGGATAIEGGAS  63

Query  357  gpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAG  530
                 IRLAGVTN++HSYDVLTRKWTRL+PAGEPPS RAAHAAAAVGTMVVFQGGIGPAG
Sbjct  64   SSAPGIRLAGVTNSVHSYDVLTRKWTRLRPAGEPPSVRAAHAAAAVGTMVVFQGGIGPAG  123

Query  531  HSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            HSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHV+DLVAQRYL
Sbjct  124  HSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVIDLVAQRYL  167



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL PAPTYR+LET+WDTDEDAPGPRCGHTLTAVAATK+HG RLILFGGATAIEGG
Sbjct  1    MGSKPWLSPAPTYRTLETYWDTDEDAPGPRCGHTLTAVAATKSHGARLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTR++PAG+PPS RAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGDPPSLRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  166



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYDV +RKWT ++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAPTYR+LET+WD+D+DAPG RC HTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRTLETYWDSDDDAPGSRCAHTLTAVAATKSQGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGH MDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHAMDLVAQRYL  165



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQSPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPRAAHAA  VGTMVVFQGGIGP
Sbjct  61   ASSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPRAAHAATVVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTN K KWHRVVVQGQGPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDLTNYKFKWHRVVVQGQGPGPRYGHVMDLVSQRYL  166



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN++HSYDVLTRKWTRL PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSVPGIRLAGVTNSVHSYDVLTRKWTRLVPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGEGPGPRYGHVMDLVSQRYL  165



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPA TYR+LETFWDTDED PGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPASTYRNLETFWDTDEDGPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYDV TRKW  ++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQTRKWISIKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   GSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDMTNDKFKWHRVVVQGEGPGPRYGHVMDLVSQRYL  166



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   GSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDMTNDKFKWHRVVVQGEGPGPRYGHVMDLVSQRYL  166



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   261 bits (668),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
            +      IRLAGVTN++HSYDVLTR+WTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   STSSVPGIRLAGVTNSVHSYDVLTRRWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDMTNDKFKWHRVVVQGEGPGPRYGHVMDLVSQRYL  166



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR+LET+WD DEDAP PR GHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRNLETYWDADEDAPLPRVGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYD+LT+KWTR++PAG+PPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   AASSAPGIRLAGVTNSVHSYDILTKKWTRMKPAGDPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRV+VQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVLVQGQGPGPRYGHVMDLVAQRYL  166



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQPPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
            +      IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPRAAHAA  VGTMVVFQGGIGP
Sbjct  61   SSSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPRAAHAATVVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTN K KWHRVVVQGQGPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDLTNYKFKWHRVVVQGQGPGPRYGHVMDLVSQRYL  166



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGDGPGPRYGHVMDLVSQRYL  165



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 155/170 (91%), Gaps = 6/170 (4%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTR----LQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   IRLAGVTN++HSYDVLTRKWTR    ++PAGEPPSPRAAHAAAAVGTMVVFQG
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRFLLIIRPAGEPPSPRAAHAAAAVGTMVVFQG  120

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GIGPAGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  170



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGDGPGPRYGHVMDLVSQRYL  165



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGH MDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHAMDLVAQRYL  165



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGDGPGPRYGHVMDLVSQRYL  165



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGH MDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHAMDLVAQRYL  165



>ref|XP_008813653.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Phoenix dactylifera]
Length=349

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGPGPGPRYGHTMDLVAQRYL  166



>ref|XP_008813652.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Phoenix dactylifera]
Length=350

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGPGPGPRYGHTMDLVAQRYL  166



>ref|XP_008813651.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Phoenix dactylifera]
Length=351

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGPGPGPRYGHTMDLVAQRYL  166



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGDGPGPRYGHVMDLVSQRYL  165



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYR++ET WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETVWDTDEDAPGPRCGHTLTAVAATKTLGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +H+YDV +RKWT ++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSAPGIRLAGVTNTVHAYDVQSRKWTSVKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRYGH MDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRYGHAMDLVAQRYL  165



>emb|CAN67846.1| hypothetical protein VITISV_016669 [Vitis vinifera]
Length=208

 Score =   242 bits (618),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 144/192 (75%), Gaps = 30/192 (16%)
 Frame = +3

Query  177  AKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF-----------  323
            +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILF           
Sbjct  4    SKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILFGGATAIEGGAS  63

Query  324  -------------------ggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAG  446
                                    +        + LAGVTN++HSYDVLTRKWTRL+PAG
Sbjct  64   SSAPGIRTPHPIRFFFFVWIRVCVVASLCVVCFLGLAGVTNSVHSYDVLTRKWTRLRPAG  123

Query  447  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRY  626
            EPPS RAAHAAAAV TMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQGQGPGPRY
Sbjct  124  EPPSVRAAHAAAAVXTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQGQGPGPRY  183

Query  627  GHVMDLVAQRYL  662
            GHV+DLVAQRYL
Sbjct  184  GHVIDLVAQRYL  195



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            MA KP+L+PAP Y+SLETFWD ++DAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MATKPFLHPAPQYKSLETFWDEEDDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKYKWHRVVVQGEGPGPRYGHVMDLVSQRYL  165



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   259 bits (661),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWLYPAPTYRS+ET W+TDEDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSVETSWETDEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRLAGVT+++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   GPSAPGIRLAGVTSSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLTN+K KWHRVVVQG GPGPRYGH MDLV QRYL
Sbjct  121  GHSTDDLYVLDLTNEKFKWHRVVVQGPGPGPRYGHAMDLVGQRYL  165



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  K WL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKQWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
            +    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   SSSLPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  GHSTDDLYVLDMTNDKFKWHRVVVQGEGPGPRYGHVMDLVSQRYL  165



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   NSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDMTNDKYKWHRVVVQGEGPGPRYGHVMDLVSQRYL  166



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   NSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDMTNDKYKWHRVVVQGEGPGPRYGHVMDLVSQRYL  166



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   NSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLD+TNDK KWHRVVVQG+GPGPRYGHVMDLV+QRYL
Sbjct  121  AGHSTDDLYVLDMTNDKYKWHRVVVQGEGPGPRYGHVMDLVSQRYL  166



>ref|XP_011011094.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X3 [Populus euphratica]
Length=781

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLT DK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTTDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_010910522.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Elaeis guineensis]
Length=278

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M  K W  PAPTYR L+  WD D+DAPGPRCGH+LT VAATK+HGPRL+LFGGATAIEGG
Sbjct  1    MGTKSWTIPAPTYRPLDASWDNDDDAPGPRCGHSLTTVAATKSHGPRLVLFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  61   ASSAVPGIRLAGVTNSVHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGPGPGPRYGHAMDLVAQRYL  166



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +3

Query  168  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  347
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  348  gnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIG  521
            G       IRLAGVTN++HSYDVLTRKWTR+QP GEPPSPRAAHAAAAVG+MVVFQGGIG
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPVGEPPSPRAAHAAAAVGSMVVFQGGIG  121

Query  522  PAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            PAGHSTDDLYVLDLTN+K KWHRVVVQG GPGPRYGHVMDLVAQRYL
Sbjct  122  PAGHSTDDLYVLDLTNEKFKWHRVVVQGPGPGPRYGHVMDLVAQRYL  168



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +3

Query  168  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  347
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  348  gnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIG  521
            G       IRLAGVTN++HSYDVLTRKWTR+QP GEPPSPRAAHAAAAVG+MVVFQGGIG
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPVGEPPSPRAAHAAAAVGSMVVFQGGIG  121

Query  522  PAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            PAGHSTDDLYVLDLTN+K KWHRVVVQG GPGPRYGHVMDLVAQRYL
Sbjct  122  PAGHSTDDLYVLDLTNEKFKWHRVVVQGPGPGPRYGHVMDLVAQRYL  168



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRALETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  351  nggp---giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIG  521
                     RL G TN++HSYDVLTRKWTR+Q AGEPPSPRAAHAAAAVGTMVVFQGGIG
Sbjct  61   ASSAPGISYRLDGATNSVHSYDVLTRKWTRIQAAGEPPSPRAAHAAAAVGTMVVFQGGIG  120

Query  522  PAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            PAGHSTDDLYVLDL+ DK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  PAGHSTDDLYVLDLSTDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  167



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLT DK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTTDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHSTDDLYVLDLT DK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  121  GHSTDDLYVLDLTTDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  165



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +    YPAPTYR+LET+WD+D+D+PGPRC HTLTAV+ATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSNRQFYPAPTYRTLETYWDSDDDSPGPRCSHTLTAVSATKSQGPRLILFGGATAIEGG  60

Query  351  nggpgi---RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIG  521
                     RLAGVTNAIHSYDVLTRKWTRL+PAGEPPSPRAAH A AVGTMVVFQGGIG
Sbjct  61   ASSSSAPGIRLAGVTNAIHSYDVLTRKWTRLRPAGEPPSPRAAHTAVAVGTMVVFQGGIG  120

Query  522  PAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            PAGHSTDDLYVLDL +DK KWHRVVVQGQGPGPRYGHVMDLV QRYL
Sbjct  121  PAGHSTDDLYVLDLASDKFKWHRVVVQGQGPGPRYGHVMDLVGQRYL  167



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 3/166 (2%)
 Frame = +3

Query  174  AAKPWLYPAPTYRSL-ETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            ++KPWL PAP+Y  L ++FWD+DEDAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  3    SSKPWLQPAPSYTPLLDSFWDSDEDAPGPRCGHTLTAVAATKSQGPRLILFGGATAIEGG  62

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPRAAHAAAAVGTMVVFQGGIGP
Sbjct  63   ASSSAPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPRAAHAAAAVGTMVVFQGGIGP  122

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGHVMDLVAQRYL
Sbjct  123  AGHSTDDLYVLDLTNDKYKWHRVVVQGPGPGPRYGHVMDLVAQRYL  168



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 145/166 (87%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +KPWL PAP YR L++ W+TD+DAPGPRCGH+LTAV A+K+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLIPAPNYRRLDSSWETDDDAPGPRCGHSLTAVDASKSRGPRLILFGGATAIEGG  60

Query  351  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
                   IRLAGVTN++HSYDV TRKWTR+ P GEPPSPRAAHAAA VGTMVVFQGGIGP
Sbjct  61   ASSAVPGIRLAGVTNSVHSYDVNTRKWTRIHPVGEPPSPRAAHAAAVVGTMVVFQGGIGP  120

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  121  AGHSTDDLYVLDLTNDKFKWHRVVVQGPGPGPRYGHTMDLVAQRYL  166



>gb|AFW82656.1| hypothetical protein ZEAMMB73_760112 [Zea mays]
Length=491

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMVVFQGGI
Sbjct  62   TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGI  121

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  122  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  169



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 140/165 (85%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M +K  L PAP+YR +E  W+   D+PGPRC HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSKTRLVPAPSYRPVEASWEAAGDSPGPRCSHTLTAVPATGSHGPRLILFGGTTAIEGS  60

Query  351  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
                 GIRLAGVTN++HS+DV TRKWTR+QPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
Sbjct  61   XPPAPGIRLAGVTNSVHSFDVQTRKWTRIQPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA  120

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GHS+DDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVA RYL
Sbjct  121  GHSSDDLYVLDLTNDKFKWHRVVVQGPGPGPRYGHAMDLVAHRYL  165



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    EDAPG RCGH+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKNAWVVPAPAYREVEGWEGVGEDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV  R+WTRL PAGEPPSPRAAH+AAAVGTMVVFQGGI
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRRWTRLHPAGEPPSPRAAHSAAAVGTMVVFQGGI  121

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  122  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  169



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +DAPG RCGH+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGVGDDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV  RKWTRL PAGEPPSPRAAHAAAAVGTMVVFQGGI
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRKWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGI  121

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  122  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  169



>ref|XP_008795124.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=867

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  171  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  350
            M ++  L PAP+YR +E  W+   DAPGPR  HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSRTRLVPAPSYRPVEASWEAAGDAPGPRYAHTLTAVPATGSHGPRLILFGGGTAIEGS  60

Query  351  nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAG  530
              GPGIRLAGVTN +HS+DV TRKWTR QPAG+PPSPRAAHAAAAVGTMVVFQGGIGPAG
Sbjct  61   PCGPGIRLAGVTNWVHSFDVRTRKWTRAQPAGQPPSPRAAHAAAAVGTMVVFQGGIGPAG  120

Query  531  HSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            HS+DDLYVLDLTNDK KWHRVVVQG GPGPRYGHVMDLVA RYL
Sbjct  121  HSSDDLYVLDLTNDKFKWHRVVVQGPGPGPRYGHVMDLVAHRYL  164



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  94   GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  153

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMVVFQGGI
Sbjct  154  TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGI  213

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  214  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  261



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  94   GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  153

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMVVFQGGI
Sbjct  154  TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGI  213

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  214  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  261



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIE  61

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMVVFQGGI
Sbjct  62   AGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGI  121

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  122  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  169



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIE  61

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMVVFQGGI
Sbjct  62   AGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGI  121

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  122  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  169



>ref|XP_006846753.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
 gb|ERN08334.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
Length=218

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 141/178 (79%), Gaps = 14/178 (8%)
 Frame = +3

Query  171  MAAKPWLYPAP----TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH----------GP  308
            M +K  L PAP     YR ++T W+TDED+PGPRCGHTLT V+               GP
Sbjct  1    MGSKLRLCPAPLPASAYRVVDTSWETDEDSPGPRCGHTLTPVSTPSNSSSSSGSHHYVGP  60

Query  309  RLILFggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaV  488
            RLILFGGATAIE  + G GIRLAGVTN++HSYDVLTRKWTRLQP+GEPPSPRAAHAAAAV
Sbjct  61   RLILFGGATAIEMSSTGAGIRLAGVTNSVHSYDVLTRKWTRLQPSGEPPSPRAAHAAAAV  120

Query  489  GTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GTMVV QGGIGPAGHSTDD+YVLD+T+ K +WHRVVVQG GPGPRYGH MDLV QRYL
Sbjct  121  GTMVVIQGGIGPAGHSTDDIYVLDITSAKSRWHRVVVQGPGPGPRYGHAMDLVFQRYL  178



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 138/168 (82%), Gaps = 3/168 (2%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIE  61

Query  345  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGI  518
             G       IRLAGVTN++HSYDV  R+WTR+ PAG+PPSPRAAH+AAAVGTMVVFQGGI
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPRAAHSAAAVGTMVVFQGGI  121

Query  519  GPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  122  GPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  169



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 134/172 (78%), Gaps = 13/172 (8%)
 Frame = +3

Query  186  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggngg--  359
            W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIEAGASSGL  68

Query  360  -----------pgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVF  506
                          RLAGVTN++HSYDV  R+WTR+ PAG+PPSPRAAH+AAAVGTMVVF
Sbjct  69   PGISSVPPPSLAPPRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPRAAHSAAAVGTMVVF  128

Query  507  QGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            QGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  129  QGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  180



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 137/179 (77%), Gaps = 14/179 (8%)
 Frame = +3

Query  168  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  344
            G A K  W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIE  61

Query  345  ggngg-------------pgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaa  485
             G                   RLAGVTN++HSYDV  R+WTR+ PAG+PPSPRAAH+AAA
Sbjct  62   AGASSGLPGISSVPPPSLAPPRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPRAAHSAAA  121

Query  486  VGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            VGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  122  VGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  180



>gb|KGN47885.1| hypothetical protein Csa_6G409910 [Cucumis sativus]
Length=416

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +3

Query  372  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  551
            LAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDL+
Sbjct  3    LAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLF  62

Query  552  VLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            VLDLTNDK KWHRVVVQGQGPGPRYGHVMDLVAQRYL
Sbjct  63   VLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVAQRYL  99



>gb|KHG00523.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=315

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  ++   +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  78   APPYSVVDAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  197

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  198  GIGPAGLSAEDLHVLDLTQPRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  247



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 123/172 (72%), Gaps = 16/172 (9%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAP +R +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  7    PAPAFRMVSAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYVGPRLILFGGATALEGNSS  66

Query  357  gpg----------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVF  506
              G          IRLAG T  +H YDV +RKW+RL P G+PPSPRAAHAA AVGTMVV 
Sbjct  67   AAGGPQTAAAGAGIRLAGATADVHCYDVTSRKWSRLIPVGDPPSPRAAHAATAVGTMVVI  126

Query  507  QGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            QGGIGPAG STDDL+VLDLT  K +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  127  QGGIGPAGLSTDDLHVLDLTQAKPRWHRVVVQGAGPGPRYGHVMSLVGQRFL  178



>gb|KGN66599.1| hypothetical protein Csa_1G638460 [Cucumis sativus]
Length=736

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 120/170 (71%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  359
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  360  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S++DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSSEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>gb|EYU25964.1| hypothetical protein MIMGU_mgv1a0006242mg, partial [Erythranthe 
guttata]
Length=340

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 111/170 (65%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP+Y  +    D  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YD LT KWTR+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYDALTNKWTRVTPIGEPPTPRAAHVATAVGTMVVIQG  188

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVV G GPGPRYGHVM LV QRYL
Sbjct  189  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVHGPGPGPRYGHVMALVGQRYL  238



>gb|EYU41291.1| hypothetical protein MIMGU_mgv1a0202661mg, partial [Erythranthe 
guttata]
Length=340

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 111/170 (65%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP+Y  +    D  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YD LT KWTR+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYDALTNKWTRVTPIGEPPTPRAAHVATAVGTMVVIQG  188

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVV G GPGPRYGHVM LV QRYL
Sbjct  189  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVHGPGPGPRYGHVMALVGQRYL  238



>dbj|BAK03675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y ++    D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTAVNAVIDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGG  180

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  181  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  229



>ref|XP_009598633.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=305

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 111/170 (65%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  +    +  ED PG RCGHTLTAV A    G      PRLILF           A
Sbjct  63   APAYSVVHAVLEKKEDGPGSRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAA  122

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  123  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  182

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  183  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  232



>ref|XP_009598634.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=289

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 111/170 (65%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  +    +  ED PG RCGHTLTAV A    G      PRLILF           A
Sbjct  63   APAYSVVHAVLEKKEDGPGSRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAA  122

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  123  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  182

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  183  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  232



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 119/170 (70%), Gaps = 14/170 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF--------gga  332
            PAPTYR + +  +  +D PGPRCGHTLTAVA+    G      PRLILF          A
Sbjct  106  PAPTYRVVNSVIEKRDDGPGPRCGHTLTAVASVNEEGSPGYIGPRLILFGGATALEGSSA  165

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
               +  + G GIRLAG T  +H YDV + +WTR+ P G+PPSPRAAHAA AVGTMVV QG
Sbjct  166  AGPQAASSGAGIRLAGATADVHCYDVQSNQWTRITPVGDPPSPRAAHAATAVGTMVVIQG  225

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG STDDL+VLDLT  K +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  226  GIGPAGLSTDDLHVLDLTQAKPRWHRVVVQGPGPGPRYGHVMSLVGQRFL  275



>dbj|BAF00990.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=707

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  193

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  194  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  243



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 120/170 (71%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  359
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  45   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  104

Query  360  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  105  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPRAAHVATAVGTMVVIQG  164

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S++DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  165  GIGPAGLSSEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  214



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 120/170 (71%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  359
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  360  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S++DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSSEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 121/171 (71%), Gaps = 15/171 (9%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAPTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  64   PAPTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSA  123

Query  357  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV Q
Sbjct  124  ASGAPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVACAVGTMVVIQ  183

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  184  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  234



>ref|XP_006367867.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=367

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 123/171 (72%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY ++++  +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  51   APTYTAVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  110

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   GG GIRLAG T  +HSYDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  111  AAAPSSPGGAGIRLAGATADVHSYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  170

Query  513  GIGPAGHSTDDLYVLDLTND-KLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT   + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  171  GIGPAGLSAEDLHVLDLTQQHRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  221



>gb|EPS67556.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=238

 Score =   168 bits (426),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 115/170 (68%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGP------RLILFggataie-----  344
            AP Y  +    +  ED PGPRCGHTLTAV A    G       R+ILFGGATA+E     
Sbjct  5    APMYNVVNAVMEKKEDGPGPRCGHTLTAVTAVGEEGSPGYIGARMILFGGATALEGNSGG  64

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDV T KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  65   TGTPTSAGSAGIRLAGATADVHCYDVSTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  124

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  125  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  174



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 128/195 (66%), Gaps = 17/195 (9%)
 Frame = +3

Query  123  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  302
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  303  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  437
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  438  PAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPG  617
            P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPG
Sbjct  180  PFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPG  239

Query  618  PRYGHVMDLVAQRYL  662
            PRYGHVM LV QRYL
Sbjct  240  PRYGHVMALVGQRYL  254



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 128/195 (66%), Gaps = 17/195 (9%)
 Frame = +3

Query  123  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  302
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  303  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  437
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  438  PAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPG  617
            P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPG
Sbjct  180  PFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPG  239

Query  618  PRYGHVMDLVAQRYL  662
            PRYGHVM LV QRYL
Sbjct  240  PRYGHVMALVGQRYL  254



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 128/195 (66%), Gaps = 17/195 (9%)
 Frame = +3

Query  123  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  302
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  303  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  437
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  438  PAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPG  617
            P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPG
Sbjct  180  PFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPG  239

Query  618  PRYGHVMDLVAQRYL  662
            PRYGHVM LV QRYL
Sbjct  240  PRYGHVMALVGQRYL  254



>gb|ABV91338.1| kelch repeat-containing protein /serine/threonine phosphoesterase 
family protein [Arabidopsis thaliana]
Length=1018

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 128/195 (66%), Gaps = 17/195 (9%)
 Frame = +3

Query  123  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  302
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  303  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  437
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATPDVHCYDVLSNKWTRLT  179

Query  438  PAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPG  617
            P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPG
Sbjct  180  PFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPG  239

Query  618  PRYGHVMDLVAQRYL  662
            PRYGHVM LV QRYL
Sbjct  240  PRYGHVMALVGQRYL  254



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  189

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  190  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  239



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  192

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  193  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  242



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  192

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  193  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  242



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  192

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  193  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  242



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYFGPRLILFGGATALEGNSAA  129

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  189

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  190  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  239



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  192

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  193  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  242



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  71   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  190

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  191  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  240



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    D  ED PGPRCGHTLT VAA    G      PRLILF           +
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            T      G  GIRLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWTRITPFGEPPTPRAAHVATAVGTMVVIQG  196

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  197  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  246



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  189

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  190  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  239



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  143

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRISPFGEPPTPRAAHVATAVGTMVVIQG  203

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  204  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  253



>gb|KFK43163.1| hypothetical protein AALP_AA1G088000 [Arabis alpina]
Length=1016

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 119/171 (70%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  83   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  142

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                    G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV Q
Sbjct  143  TGTPTSAAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQ  202

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  203  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  253



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 129/196 (66%), Gaps = 19/196 (10%)
 Frame = +3

Query  126  NQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG  305
            +  S  ++G  +L      P    APTY  ++   D  ED PGPRCGHTLTAV A    G
Sbjct  65   SSQSAPVVGQEQLQAQVVGPRC--APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEG  122

Query  306  ------PRLILFggataieggng-----------gpgiRLAGVTNAIHSYDVLTRKWTRL  434
                  PRL+LFGGATA+EG +G             GIRLAG T  +H YDVL+ KWTRL
Sbjct  123  TPGYIGPRLVLFGGATALEGNSGGGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRL  182

Query  435  QPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGP  614
             P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GP
Sbjct  183  TPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGP  242

Query  615  GPRYGHVMDLVAQRYL  662
            GPRYGHVM LV QRYL
Sbjct  243  GPRYGHVMALVGQRYL  258



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  81   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  140

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  141  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  200

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  201  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  250



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    D  ED PGPRCGHTLT VAA    G      PRLILF           +
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALGGNSAS  136

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            T      G  GIRLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWTRITPFGEPPTPRAAHVATAVGTMVVIQG  196

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  197  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  246



>ref|XP_010419412.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1003

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  133

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  193

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  194  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  243



>gb|KDO46578.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=975

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           +
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  203

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  204  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  253



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 120/171 (70%), Gaps = 15/171 (9%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAPTY  +E   +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E    
Sbjct  81   PAPTYSVVEANIEKKEDGPGPRCGHTLTAVAAVGEEGTAGYIGPRLILFGGATALEGNSA  140

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                    G  GIRLAG T  +H YDV + KW+RL P GEPPSPRAAH A AVGTMVV Q
Sbjct  141  ASGPPSSAGSAGIRLAGATADVHCYDVNSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQ  200

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  201  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  251



>ref|XP_010101992.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
 gb|EXB91212.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
Length=1084

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  86   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  145

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  146  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  205

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  206  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  255



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  64   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALEGNSAA  123

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YD+LT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDILTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  233



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 119/170 (70%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  84   APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  143

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QG
Sbjct  144  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQG  203

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  204  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  253



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           +
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  144  AGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  203

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  204  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  253



>emb|CDY22684.1| BnaC08g43180D [Brassica napus]
Length=995

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 118/171 (69%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  65   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGAPGYIGPRLVLFGGATALEGNSGG  124

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV Q
Sbjct  125  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQ  184

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  185  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  235



>ref|XP_009118376.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Brassica 
rapa]
Length=992

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 118/171 (69%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV Q
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQ  181

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  232



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSGG  132

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  133  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  192

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  193  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  242



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  199

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  200  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  249



>emb|CDY06313.1| BnaA09g48900D [Brassica napus]
Length=992

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 118/171 (69%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV Q
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQ  181

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  232



>gb|KJB35473.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1001

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  199

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  200  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  249



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 120/171 (70%), Gaps = 15/171 (9%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAPTY  +E   +  ED PG RCGHTLTA+AA    G      PRLILFGGATA+E    
Sbjct  84   PAPTYSVVEAIIEKKEDGPGSRCGHTLTAIAAVGEEGTPGYIGPRLILFGGATALEGNAA  143

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                    G  GIRLAG T  +H YDV++ KW+RL P GEPPSPRAAH A AVGTMVV Q
Sbjct  144  ASGPPSSAGSAGIRLAGATADVHCYDVISNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQ  203

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  204  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  254



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  199

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  200  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  249



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  199

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  200  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  249



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  70   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSGYIGPRLILFGGATALEGNSGG  129

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  130  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  189

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  190  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  239



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 124/181 (69%), Gaps = 15/181 (8%)
 Frame = +3

Query  159  ELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLIL  320
            E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA    G      PRLIL
Sbjct  42   EAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLIL  99

Query  321  Fggataie-------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaa  479
            FGGATA+E          G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A
Sbjct  100  FGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVA  159

Query  480  aaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRY  659
             AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+
Sbjct  160  TAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRF  219

Query  660  L  662
            L
Sbjct  220  L  220



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 124/181 (69%), Gaps = 15/181 (8%)
 Frame = +3

Query  159  ELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLIL  320
            E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA    G      PRLIL
Sbjct  42   EAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLIL  99

Query  321  Fggataie-------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaa  479
            FGGATA+E          G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A
Sbjct  100  FGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVA  159

Query  480  aaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRY  659
             AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+
Sbjct  160  TAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRF  219

Query  660  L  662
            L
Sbjct  220  L  220



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  131

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  132  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  136

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  137  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  196

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  197  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  246



>ref|XP_009770254.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana sylvestris]
Length=982

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  71   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDV+T KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYDVITNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  190

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  191  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  240



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 119/170 (70%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  85   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPSYIGPRLVLFGGATALEGNSGG  144

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPP+PRAAH A AVGTMVV QG
Sbjct  145  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQG  204

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  205  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  254



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 122/171 (71%), Gaps = 15/171 (9%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAP ++++    +  +D PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  34   PAPAFKAITAICERKDDGPGPRCGHTLTAVAAVGEEGSPAYIGPRLILFGGATALEGNSS  93

Query  357  gpg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
              G         IRLAG T  +H YD  T KW+RL P G+PPSPRAAHAA AVGTMVV Q
Sbjct  94   QAGPQTAVAGAGIRLAGATADVHCYDAHTNKWSRLIPVGDPPSPRAAHAATAVGTMVVIQ  153

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG ST+DL+VLDLT  K +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  154  GGIGPAGLSTEDLHVLDLTQAKPRWHRVVVQGTGPGPRYGHVMSLVGQRFL  204



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score =   176 bits (446),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  81   APTYSVVNAIIENKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  140

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QG
Sbjct  141  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPRAAHVATAVGTMVVIQG  200

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  201  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  250



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  43   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  102

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDV+T KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  103  SGTPSSAGSAGIRLAGATADVHCYDVITNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  162

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  163  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  212



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 121/172 (70%), Gaps = 17/172 (10%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  356
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  82   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  141

Query  357  ----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVF  506
                        GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV 
Sbjct  142  GGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVI  201

Query  507  QGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  202  QGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  253



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QG
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPRAAHVATAVGTMVVIQG  201

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  202  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  251



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  193

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  194  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  243



>ref|XP_006417691.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
 gb|ESQ36044.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
Length=1012

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 118/171 (69%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            AP Y  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  78   APNYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  137

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                    G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV Q
Sbjct  138  TGTPTSAAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQ  197

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  198  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  248



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QG
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPRAAHVATAVGTMVVIQG  201

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  202  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  251



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 119/170 (70%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  133

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  134  SGAPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  193

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  194  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  243



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 121/173 (70%), Gaps = 18/173 (10%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  356
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  87   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  146

Query  357  -----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVV  503
                         GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV
Sbjct  147  GGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVV  206

Query  504  FQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
             QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  207  IQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  259



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  193

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  194  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  243



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           +
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            T      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  196

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  197  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  246



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  233



>ref|XP_006654987.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Oryza brachyantha]
Length=829

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  372  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  551
            LAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLY
Sbjct  11   LAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLY  70

Query  552  VLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            VLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  71   VLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  107



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  233



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  82   APTYTVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  141

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  142  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  201

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  202  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  251



>ref|XP_009587046.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=989

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           +
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            T      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  196

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  197  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  246



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  191

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  192  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  241



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  231



>emb|CDY31148.1| BnaA08g26980D [Brassica napus]
Length=990

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 121/188 (64%), Gaps = 16/188 (9%)
 Frame = +3

Query  147  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  308
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTNGYIGP  106

Query  309  RLILFggataie----------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  458
            RL+LFGGATA+E                GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  107  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  166

Query  459  PRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVM  638
            PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM
Sbjct  167  PRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVM  226

Query  639  DLVAQRYL  662
             LV QRYL
Sbjct  227  ALVGQRYL  234



>ref|XP_006826448.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
 gb|ERM93685.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
Length=1423

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 119/174 (68%), Gaps = 18/174 (10%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAPTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  66   PAPTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSS  125

Query  357  gpg------------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  500
                           IRLAG T  +H YDVL+ KW+RL P GE PSPRAAH A AVGTMV
Sbjct  126  STAPSGPPSSGGNAGIRLAGATADVHCYDVLSNKWSRLTPLGEQPSPRAAHVATAVGTMV  185

Query  501  VFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            V QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  186  VIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  239



>ref|XP_009110896.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Brassica 
rapa]
Length=990

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 121/188 (64%), Gaps = 16/188 (9%)
 Frame = +3

Query  147  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  308
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  106

Query  309  RLILFggataie----------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  458
            RL+LFGGATA+E                GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  107  RLVLFGGATALEDNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  166

Query  459  PRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVM  638
            PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM
Sbjct  167  PRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVM  226

Query  639  DLVAQRYL  662
             LV QRYL
Sbjct  227  ALVGQRYL  234



>gb|AAD26883.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=715

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 115/170 (68%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  50   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  109

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                  +      LAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QG
Sbjct  110  TGTPTSSNVSYAGLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQG  169

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  170  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  219



>ref|NP_171844.6| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
 sp|Q9LR78.2|BSU1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSU1; AltName: 
Full=Bri1 suppressor protein 1 [Arabidopsis thaliana]
 gb|AAR19789.1| BSU1 Ser/Thr phosphatase [Arabidopsis thaliana]
 gb|AEE27572.1| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
Length=793

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 119/163 (73%), Gaps = 6/163 (4%)
 Frame = +3

Query  180  KPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF--ggataieggn  353
            + + YP+P+Y S++TF+DTDED PGPRCGHTLTAV    +H  +LILF           +
Sbjct  5    QSYQYPSPSYESIQTFYDTDEDWPGPRCGHTLTAVFVNNSH--QLILFGGSTTAVANHNS  62

Query  354  ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGH  533
              P I L GVTN++HS+DVLTRKWTRL P G+ PSPRA HAAA  GT+++ QGGIGP+G 
Sbjct  63   SLPEISLDGVTNSVHSFDVLTRKWTRLNPIGDVPSPRACHAAALYGTLILIQGGIGPSGP  122

Query  534  STDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            S  D+Y+LD+TN+  KW + +V G+ P PRYGHVMD+ AQR+L
Sbjct  123  SDGDVYMLDMTNN--KWIKFLVGGETPSPRYGHVMDIAAQRWL  163



>emb|CDX97481.1| BnaC08g13460D [Brassica napus]
Length=992

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 121/188 (64%), Gaps = 16/188 (9%)
 Frame = +3

Query  147  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  308
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  49   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  108

Query  309  RLILFggataie----------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  458
            RL+LFGGATA+E                GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  109  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  168

Query  459  PRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVM  638
            PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM
Sbjct  169  PRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVM  228

Query  639  DLVAQRYL  662
             LV QRYL
Sbjct  229  ALVGQRYL  236



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 123/171 (72%), Gaps = 15/171 (9%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAP+YR +    +  ED PGPRCGHTLT+VAA    G      PRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  357  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H +D+++ KW+RL   GEPPSPRAAHAA AVG+MVV Q
Sbjct  122  AAPTPPPAGNAGIRLAGATADVHCFDIISNKWSRLNAVGEPPSPRAAHAATAVGSMVVIQ  181

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S++DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  182  GGIGPAGVSSEDLHVLDLTQARPRWHRVVVQGPGPGPRYGHVMALVGQRFL  232



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 121/172 (70%), Gaps = 16/172 (9%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggn-  353
            PAP+YR +    +  ED PGPRCGHTLT+VAA    G      PRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  354  ---------ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVF  506
                          RLAG T  +H +D+++ KW+RL   GEPPSPRAAHAA AVG+MVV 
Sbjct  122  AAPTPPPAGNAGISRLAGATADVHCFDIISNKWSRLNAVGEPPSPRAAHAATAVGSMVVI  181

Query  507  QGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            QGGIGPAG S++DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  182  QGGIGPAGVSSEDLHVLDLTQARPRWHRVVVQGPGPGPRYGHVMALVGQRFL  233



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 116/170 (68%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            AP Y  +    D  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  73   APMYTVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSGA  132

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A  VGTMVV QG
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATTVGTMVVIQG  192

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  193  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  242



>ref|XP_006340328.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=994

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  233



>ref|XP_006340327.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum tuberosum]
Length=996

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  233



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  63   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  122

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  123  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGG  182

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  183  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  231



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  74   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  133

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  134  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGG  193

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  194  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  242



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 111/170 (65%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP+Y  +    D  ED  GPRCGHTLTAV A    G      PRLILF           A
Sbjct  85   APSYSVVNAIIDKKEDGAGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  144

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  IH YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  145  AGTPSSAGSAGIRLAGATADIHCYDVLTNKWSRIAPIGEPPTPRAAHVATAVGTMVVIQG  204

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  K +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  205  GIGPAGLSAEDLHVLDLTQQKPRWHRVVVQGPGPGPRYGHVMALVGQRYL  254



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 123/178 (69%), Gaps = 15/178 (8%)
 Frame = +3

Query  168  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFgg  329
            G+ A P   PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGG
Sbjct  57   GLVAGP--RPAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGG  114

Query  330  ataieggng-------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaV  488
            ATA+EG +          GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AV
Sbjct  115  ATALEGNSATPPSPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAV  174

Query  489  GTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  175  GTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  232



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 116/171 (68%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  65   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  124

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV Q
Sbjct  125  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLSPHGEPPSPRAAHVATAVGTMVVIQ  184

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  185  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  235



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 120/169 (71%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAPTYR + +  +  ED  G RCGHTLTAV A    G      PRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNSIIEKKEDGAGCRCGHTLTAVPAVGEEGTPGFIGPRLILFGGATALEGNSA  106

Query  357  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                     GIRLAG T  +H YDVL+ +WTRL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  107  APPSPAGSAGIRLAGATADVHCYDVLSNRWTRLMPLGEPPSPRAAHVATAVGTMVVIQGG  166

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  167  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  215



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           +
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            T      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  196

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S ++L+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  197  GIGPAGLSAEELHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  246



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 116/171 (68%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  344
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEERSANYIGPRLILFGGATALEGNSGG  125

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV Q
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLTPHGEPPSPRAAHVATAVGTMVVIQ  185

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  186  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  236



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 116/171 (68%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  125

Query  345  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMVV Q
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLTPHGEPPSPRAAHVATAVGTMVVIQ  185

Query  510  GGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  186  GGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  236



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 117/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            APTY       +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVAHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  PGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  233



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    D  ED PGPRCGHTLTAV +    G      PRLILF           A
Sbjct  69   APTYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H +DVL  KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFDVLANKWSRITPLGEPPTPRAAHVATAVGTMVVIQG  188

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  189  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  238



>ref|XP_006594918.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=877

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT    +WHRV VQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQWPRWHRVSVQGPGPGPRYGHVMALVGQRYL  233



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRVTPIGEPPTPRAAHVATAVGTMVVIQG  200

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  201  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  250



>ref|XP_010313488.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum lycopersicum]
Length=995

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDV T KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYDVFTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  184

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  185  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  234



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  62   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  121

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMVV QG
Sbjct  122  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQG  181

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT    +WHRV VQG GPGPRYGHVM LV QRYL
Sbjct  182  GIGPAGLSAEDLHVLDLTQQWPRWHRVSVQGPGPGPRYGHVMALVGQRYL  231



>ref|XP_009788953.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
 ref|XP_009788954.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=709

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 118/172 (69%), Gaps = 17/172 (10%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  359
            APTY  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGTSNYIGPRLILFGGATALEGNSAA  106

Query  360  pgi----------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                         RLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMVV Q
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYDVLTNKWSRLTPIGEPPTPRAAHVATAVGTMVVIQ  166

Query  510  GGIGPAGHSTDDLYVLDLTNDKL-KWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  +  +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  167  GGIGPAGLSAEDLHVLDLTQQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  218



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 117/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGG  180

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGP G S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  181  IGPTGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  229



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 121/170 (71%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  359
            AP Y+++    +  +D PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  25   APAYKAITAICERKDDGPGPRCGHTLTAVAAVGEEGKLAYVGPRLILFGGATALEGNSSQ  84

Query  360  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
             G         IRLAG T  +H YD+ + KW+RL P G+PPSPRAAHAA  VGTMVV QG
Sbjct  85   AGPQMAVAGAGIRLAGATADVHCYDIHSNKWSRLIPVGDPPSPRAAHAATTVGTMVVIQG  144

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG ST++L+VLDLT  K +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  145  GIGPAGLSTEELHVLDLTQAKPRWHRVVVQGTGPGPRYGHVMSLVGQRFL  194



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 117/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGG  180

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGP G S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  181  IGPTGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  229



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRVTPIGEPPTPRAAHVATAVGTMVVIQG  200

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  201  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  250



>ref|XP_004251224.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum lycopersicum]
Length=997

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDV T KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYDVFTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  184

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  185  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  234



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  78   APPYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  197

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  198  GIGPAGLSAEDLHVLDLTQPRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  247



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT    +WHRV VQG GPGPRYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQWPRWHRVSVQGPGPGPRYGHVMALVGQRYL  233



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y ++    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPRAAHVATAVGTMVVIQGG  187

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  188  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  236



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 123/182 (68%), Gaps = 15/182 (8%)
 Frame = +3

Query  156  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLI  317
            AE   +AA P   PAP Y  +    +  ED PG RCGHTLTAVAA    G      PRLI
Sbjct  40   AEAQPVAAGP--RPAPGYSVVNAVIERKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  97

Query  318  LFggataieggnggpgi-------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaaha  476
            LFGGATA+EG +  P         RLAG T  +H YDVL+ KWTR+ P GEPPSPRAAH 
Sbjct  98   LFGGATALEGNSAAPASPTGSAGIRLAGATADVHCYDVLSNKWTRVTPLGEPPSPRAAHV  157

Query  477  aaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQR  656
            A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHRVVVQG GPG RYGHVM LV QR
Sbjct  158  ATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGARYGHVMALVGQR  217

Query  657  YL  662
            +L
Sbjct  218  FL  219



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y ++    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPRAAHVATAVGTMVVIQGG  187

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  188  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  236



>gb|EMS55151.1| Serine/threonine-protein phosphatase BSL1-like protein [Triticum 
urartu]
Length=770

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  372  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  551
            LAGVTN +HSYDV  R+WTRL PAG+PPSPRAAH+AAAVGTMVVFQGGIGPAGHSTDDLY
Sbjct  25   LAGVTNTVHSYDVDKRRWTRLHPAGDPPSPRAAHSAAAVGTMVVFQGGIGPAGHSTDDLY  84

Query  552  VLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            VLDLTNDK KWHRVVVQG GPGPRYGH MDLVAQRYL
Sbjct  85   VLDLTNDKFKWHRVVVQGAGPGPRYGHCMDLVAQRYL  121



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 117/166 (70%), Gaps = 13/166 (8%)
 Frame = +3

Query  204  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  344
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  345  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGP
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGP  180

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  181  AGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  226



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 117/166 (70%), Gaps = 13/166 (8%)
 Frame = +3

Query  204  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  344
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  345  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGP
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGP  180

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  181  AGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  226



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 117/166 (70%), Gaps = 13/166 (8%)
 Frame = +3

Query  204  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  344
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  345  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGP
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGP  180

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  181  AGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  226



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 111/170 (65%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  +    D  ED PGPRCGHTLTAV +    G      PRLILF           A
Sbjct  69   APAYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H +DVL  KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFDVLANKWSRITPLGEPPTPRAAHVATAVGTMVVIQG  188

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  189  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  238



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 121/171 (71%), Gaps = 16/171 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  359
            APTY  +++  +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  50   APTYTVVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  109

Query  360  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                       IRLAG T  +HSYDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  110  AAAPSSPGGAGIRLAGATADVHSYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQG  169

Query  513  GIGPAGHSTDDLYVLDLTND-KLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT   + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  170  GIGPAGLSAEDLHVLDLTQQHRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  220



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 116/166 (70%), Gaps = 13/166 (8%)
 Frame = +3

Query  204  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  344
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  43   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAAPP  102

Query  345  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGP
Sbjct  103  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGP  162

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  163  AGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  208



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 117/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  +    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  5    PAPGYTVVSAVIEKKEDGPGCRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSA  64

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  65   TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPRAAHVATAVGTMVVIQGG  124

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  125  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  173



>ref|XP_010658896.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X4 [Vitis vinifera]
Length=869

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 117/169 (69%), Gaps = 15/169 (9%)
 Frame = +3

Query  201  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  356
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  357  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGG
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGG  161

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S++DL+ LDLT  + +WH+V VQG GPGPRYGHVM LV QR+L
Sbjct  162  IGPAGLSSEDLHALDLTQQQPRWHKVAVQGSGPGPRYGHVMALVEQRFL  210



>ref|XP_006592783.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=998

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP+Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            T      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  186

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT    +WHRV VQG GPGPRYGHVM LV QRYL
Sbjct  187  GIGPAGLSAEDLHVLDLTQQWPRWHRVSVQGPGPGPRYGHVMALVGQRYL  236



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP+Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            T      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMVV QG
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQG  186

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT    +WHRV VQG GPGPRYGHVM LV QRYL
Sbjct  187  GIGPAGLSAEDLHVLDLTQQWPRWHRVSVQGPGPGPRYGHVMALVGQRYL  236



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAPTYR +    +  ED  G RCGHTLTAV      G      PRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNAIIEKKEDGAGCRCGHTLTAVPPVGEEGTPGYIGPRLILFGGATALEGNSA  106

Query  357  g-------pgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                     GIRLAG T  +H YD+L+ KWTRL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  107  APPSPAGTAGIRLAGATADVHCYDMLSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGG  166

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  167  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  215



>ref|XP_003561867.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X2 [Brachypodium distachyon]
Length=993

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y ++    +  ED PG RCGHTLT+V A    G      PRLILFGGATA+E    
Sbjct  60   PAPGYTAVTAVIEKKEDGPGCRCGHTLTSVPAVGEEGSQSYVGPRLILFGGATALEGNSA  119

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  120  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGG  179

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  180  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  228



>ref|XP_010658894.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Vitis vinifera]
Length=884

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 117/169 (69%), Gaps = 15/169 (9%)
 Frame = +3

Query  201  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  356
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  357  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGG
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGG  161

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S++DL+ LDLT  + +WH+V VQG GPGPRYGHVM LV QR+L
Sbjct  162  IGPAGLSSEDLHALDLTQQQPRWHKVAVQGSGPGPRYGHVMALVEQRFL  210



>ref|XP_010658895.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Vitis vinifera]
Length=875

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 117/169 (69%), Gaps = 15/169 (9%)
 Frame = +3

Query  201  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  356
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  357  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGG
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGG  161

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S++DL+ LDLT  + +WH+V VQG GPGPRYGHVM LV QR+L
Sbjct  162  IGPAGLSSEDLHALDLTQQQPRWHKVAVQGSGPGPRYGHVMALVEQRFL  210



>ref|XP_010907354.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Elaeis guineensis]
Length=1028

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 117/166 (70%), Gaps = 13/166 (8%)
 Frame = +3

Query  204  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  344
            +Y  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  95   SYSVVNAVIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  154

Query  345  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGP
Sbjct  155  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGP  214

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  215  AGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  260



>ref|XP_010907353.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Elaeis guineensis]
Length=1029

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 117/166 (70%), Gaps = 13/166 (8%)
 Frame = +3

Query  204  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  344
            +Y  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  95   SYSVVNAVIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  154

Query  345  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGP  524
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGP
Sbjct  155  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGP  214

Query  525  AGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            AG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  215  AGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  260



>ref|XP_010232097.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X1 [Brachypodium distachyon]
Length=1021

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y ++    +  ED PG RCGHTLT+V A    G      PRLILFGGATA+E    
Sbjct  60   PAPGYTAVTAVIEKKEDGPGCRCGHTLTSVPAVGEEGSQSYVGPRLILFGGATALEGNSA  119

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  120  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGG  179

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  180  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  228



>ref|XP_009587594.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
tomentosiformis]
Length=978

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 119/172 (69%), Gaps = 17/172 (10%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  359
            APTY  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGSSNYIGPRLILFGGATALEGNSAA  106

Query  360  pg----------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQ  509
                        IRLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMVV Q
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYDVLTNKWSRLTPIGEPPTPRAAHVATAVGTMVVIQ  166

Query  510  GGIGPAGHSTDDLYVLDLTNDKL-KWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GGIGPAG S +DL+VLDLT  +  +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  167  GGIGPAGLSAEDLHVLDLTQQQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  218



>emb|CBI24997.3| unnamed protein product [Vitis vinifera]
Length=928

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 117/169 (69%), Gaps = 15/169 (9%)
 Frame = +3

Query  201  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  356
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  357  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGG
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGG  161

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S++DL+ LDLT  + +WH+V VQG GPGPRYGHVM LV QR+L
Sbjct  162  IGPAGLSSEDLHALDLTQQQPRWHKVAVQGSGPGPRYGHVMALVEQRFL  210



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 116/170 (68%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  344
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PR+ILFGGATA+E     
Sbjct  74   APMYNVVNVIIEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRMILFGGATALEGNSGG  133

Query  345  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
                   G  GIRLAG T  IH YDV+T KW+R+ P GEPP+PRAAH A +VGTMVV QG
Sbjct  134  TGTPTSAGSAGIRLAGATADIHCYDVMTNKWSRMTPIGEPPTPRAAHVATSVGTMVVIQG  193

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT  + +WHRVVV G GPGPRYGHVM LV QRYL
Sbjct  194  GIGPAGLSAEDLHVLDLTQQRPRWHRVVVHGPGPGPRYGHVMALVGQRYL  243



>ref|XP_002262846.2| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
 ref|XP_010658893.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
Length=976

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 117/169 (69%), Gaps = 15/169 (9%)
 Frame = +3

Query  201  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  356
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  357  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGG
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGG  161

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S++DL+ LDLT  + +WH+V VQG GPGPRYGHVM LV QR+L
Sbjct  162  IGPAGLSSEDLHALDLTQQQPRWHKVAVQGSGPGPRYGHVMALVEQRFL  210



>tpg|DAA50299.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=924

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y ++    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  67   PAPGYTAVNAVIEKKEDGPGCRCGHTLTAVPAVGEEGAPGYIGPRLILFGGATALEGNSA  126

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDV   KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  127  TPPSSAGSAGIRLAGATADVHCYDVSLNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGG  186

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  187  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  235



>ref|XP_002892160.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68419.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
Length=795

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 116/159 (73%), Gaps = 6/159 (4%)
 Frame = +3

Query  192  YPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF--ggataieggnggpg  365
            YP+P+Y S++TF+DTDE  PGPRCGHTLT V    +H  +LILF           +  P 
Sbjct  11   YPSPSYESIQTFYDTDEGWPGPRCGHTLTGVFVNNSH--QLILFGGSSTAVTTHDSSLPE  68

Query  366  iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDD  545
            I L GVTN++HS+DVLTRKWTRL P G+ PSPRA HAAA  GT+++ QGGIGP+G S  D
Sbjct  69   ISLEGVTNSVHSFDVLTRKWTRLNPDGDVPSPRACHAAALYGTLLLIQGGIGPSGPSDGD  128

Query  546  LYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            +Y+LD+TN+  KW +++V G+ P PRYGHVMD+ AQR+L
Sbjct  129  VYMLDITNN--KWLKLLVGGEAPSPRYGHVMDIAAQRWL  165



>ref|NP_001067290.1| Os12g0617900 [Oryza sativa Japonica Group]
 sp|Q2QM47.2|BSL2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL2 homolog; 
AltName: Full=BSU1-like protein 2 homolog [Oryza sativa 
Japonica Group]
 gb|ABA99873.2| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30309.1| Os12g0617900 [Oryza sativa Japonica Group]
 dbj|BAG89347.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69687.1| hypothetical protein OsI_39138 [Oryza sativa Indica Group]
Length=1009

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  +    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  73   PAPGYTVVNAAMEKKEDGPGCRCGHTLTAVPAVGEEGAPGYVGPRLILFGGATALEGNSA  132

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDV + KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  133  TPPSSAGSAGIRLAGATADVHCYDVSSNKWSRLTPVGEPPSPRAAHVATAVGTMVVIQGG  192

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  193  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  241



>ref|XP_006664752.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=941

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 117/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  356
            PAP Y  +    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+EG + 
Sbjct  5    PAPGYTVVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  64

Query  357  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                     GIRLAG T  +H YDV + KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  65   TPPSPAGSAGIRLAGATADVHCYDVSSNKWSRLTPVGEPPSPRAAHVATAVGTMVVIQGG  124

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  125  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  173



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 110/170 (65%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  332
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  64   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  333  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
            +      G  GIRLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMVV QG
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQG  183

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT    +WHRV VQG GPG RYGHVM LV QRYL
Sbjct  184  GIGPAGLSAEDLHVLDLTQQWPRWHRVSVQGPGPGSRYGHVMALVGQRYL  233



>ref|XP_002464169.1| hypothetical protein SORBIDRAFT_01g013460 [Sorghum bicolor]
 gb|EER91167.1| hypothetical protein SORBIDRAFT_01g013460 [Sorghum bicolor]
Length=998

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  +    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  64   PAPGYTVVNAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  123

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDV + KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  124  TPPSSAGSAGIRLAGATADVHCYDVSSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGG  183

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  184  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  232



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 115/170 (68%), Gaps = 15/170 (9%)
 Frame = +3

Query  198  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  359
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  70   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  129

Query  360  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQG  512
             G          RLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMVV QG
Sbjct  130  SGTPTSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQG  189

Query  513  GIGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            GIGPAG S +DL+VLDLT    +WHRV VQG GPG RYGHVM LV QRYL
Sbjct  190  GIGPAGLSAEDLHVLDLTQQWPRWHRVSVQGPGPGSRYGHVMALVGQRYL  239



>ref|XP_004982314.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X1 [Setaria italica]
Length=998

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = +3

Query  195  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  344
            PAP Y  +    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  64   PAPGYTVVNAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  123

Query  345  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGG  515
                  G  GIRLAG T  +H YDV + KW+RL P GEPPSPRAAH A AVGTMVV QGG
Sbjct  124  TPPSSAGSAGIRLAGATADVHCYDVSSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGG  183

Query  516  IGPAGHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            IGPAG S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  184  IGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  232



>gb|AAF22889.1|AC006932_6 T27G7.10 [Arabidopsis thaliana]
Length=1088

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 129/212 (61%), Gaps = 34/212 (16%)
 Frame = +3

Query  123  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  302
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  303  G------PRLILFggataieggnggpgiR--------------------------LAGVT  386
            G      PRL+LFGGATA+EG +GG G                            LAG T
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGILLKASHLLNLTGNLRWQWLAGAT  179

Query  387  NAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLT  566
              +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT
Sbjct  180  ADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLT  239

Query  567  NDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
              + +WHRVVVQG GPGPRYGHVM LV QRYL
Sbjct  240  QQRPRWHRVVVQGPGPGPRYGHVMALVGQRYL  271



>ref|XP_003577251.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Brachypodium distachyon]
Length=988

 Score =   165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 114/165 (69%), Gaps = 13/165 (8%)
 Frame = +3

Query  207  YRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGP------RLILFggataie-------g  347
            Y  ++   D  ED PG RCGHTLTAV A    G       RLILFGGATA+E        
Sbjct  59   YTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYIGQRLILFGGATALEGNSATPPS  118

Query  348  gnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPA  527
              G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPA
Sbjct  119  SAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPA  178

Query  528  GHSTDDLYVLDLTNDKLKWHRVVVQGQGPGPRYGHVMDLVAQRYL  662
            G S +DL+VLDLT  + +WHRVVVQG GPGPRYGHVM LV QR+L
Sbjct  179  GLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFL  223



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140