BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050G23

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99906.1|  unnamed protein product                                201   7e-59   Coffea canephora [robusta coffee]
ref|XP_011076935.1|  PREDICTED: protein trichome birefringence-li...    199   2e-58   Sesamum indicum [beniseed]
ref|XP_004249967.1|  PREDICTED: protein trichome birefringence-li...    189   1e-54   Solanum lycopersicum
ref|XP_006361471.1|  PREDICTED: uncharacterized protein LOC102605360    189   2e-54   Solanum tuberosum [potatoes]
ref|XP_009587659.1|  PREDICTED: protein trichome birefringence-li...    184   1e-52   Nicotiana tomentosiformis
ref|XP_009803690.1|  PREDICTED: protein trichome birefringence-li...    183   5e-52   Nicotiana sylvestris
ref|XP_008231948.1|  PREDICTED: protein trichome birefringence-li...    177   1e-49   Prunus mume [ume]
ref|XP_007211438.1|  hypothetical protein PRUPE_ppa007187mg             176   2e-49   Prunus persica
gb|EYU19805.1|  hypothetical protein MIMGU_mgv1a008074mg                176   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_002521169.1|  conserved hypothetical protein                     172   9e-49   
ref|XP_009356126.1|  PREDICTED: protein trichome birefringence-li...    172   4e-48   
ref|XP_002269148.1|  PREDICTED: protein trichome birefringence-li...    172   6e-48   Vitis vinifera
emb|CAN74465.1|  hypothetical protein VITISV_004134                     172   7e-48   Vitis vinifera
ref|XP_002521177.1|  conserved hypothetical protein                     171   1e-47   Ricinus communis
ref|XP_011469321.1|  PREDICTED: protein trichome birefringence-li...    168   7e-47   Fragaria vesca subsp. vesca
ref|XP_002311947.1|  hypothetical protein POPTR_0008s02180g             168   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011032863.1|  PREDICTED: protein trichome birefringence-li...    169   2e-46   Populus euphratica
gb|AFK36769.1|  unknown                                                 163   2e-46   Lotus japonicus
ref|XP_004308558.2|  PREDICTED: protein trichome birefringence-li...    168   2e-46   Fragaria vesca subsp. vesca
ref|XP_007142840.1|  hypothetical protein PHAVU_007G021300g             167   4e-46   Phaseolus vulgaris [French bean]
gb|KDP35804.1|  hypothetical protein JCGZ_10440                         167   5e-46   Jatropha curcas
gb|ACU13130.1|  unknown                                                 160   1e-45   Glycine max [soybeans]
ref|XP_006445722.1|  hypothetical protein CICLE_v10015623mg             165   4e-45   Citrus clementina [clementine]
ref|XP_010088792.1|  hypothetical protein L484_018353                   164   6e-45   Morus notabilis
gb|KDO44402.1|  hypothetical protein CISIN_1g017027mg                   163   1e-44   Citrus sinensis [apfelsine]
gb|KEH41400.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    163   1e-44   Medicago truncatula
ref|XP_010271679.1|  PREDICTED: protein trichome birefringence-li...    162   3e-44   Nelumbo nucifera [Indian lotus]
ref|XP_007010436.1|  Trichome birefringence-like 36                     160   2e-43   
gb|KEH44322.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    159   4e-43   Medicago truncatula
gb|KEH44323.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    159   5e-43   Medicago truncatula
ref|XP_003555875.1|  PREDICTED: protein YLS7-like                       159   5e-43   Glycine max [soybeans]
gb|KHN11469.1|  hypothetical protein glysoja_015364                     159   5e-43   Glycine soja [wild soybean]
gb|ACU24162.1|  unknown                                                 159   5e-43   Glycine max [soybeans]
ref|XP_003535878.1|  PREDICTED: protein YLS7                            159   6e-43   Glycine max [soybeans]
ref|XP_007145481.1|  hypothetical protein PHAVU_007G242600g             157   3e-42   Phaseolus vulgaris [French bean]
ref|XP_008446761.1|  PREDICTED: protein trichome birefringence-li...    157   4e-42   Cucumis melo [Oriental melon]
ref|XP_008375566.1|  PREDICTED: protein trichome birefringence-li...    157   4e-42   
gb|KJB78678.1|  hypothetical protein B456_013G011800                    156   5e-42   Gossypium raimondii
ref|XP_010032073.1|  PREDICTED: protein trichome birefringence-li...    153   8e-41   Eucalyptus grandis [rose gum]
ref|XP_004135033.1|  PREDICTED: uncharacterized protein LOC101204429    153   8e-41   Cucumis sativus [cucumbers]
ref|XP_004514721.1|  PREDICTED: uncharacterized protein LOC101494450    153   1e-40   Cicer arietinum [garbanzo]
ref|XP_010907119.1|  PREDICTED: protein trichome birefringence-li...    153   2e-40   Elaeis guineensis
gb|KHN09736.1|  hypothetical protein glysoja_049465                     151   2e-40   Glycine soja [wild soybean]
ref|XP_010536307.1|  PREDICTED: protein trichome birefringence-li...    151   8e-40   Tarenaya hassleriana [spider flower]
ref|XP_008784007.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Phoenix dactylifera
ref|XP_009139251.1|  PREDICTED: protein trichome birefringence-li...    147   1e-38   Brassica rapa
ref|XP_006391872.1|  hypothetical protein EUTSA_v10023527mg             147   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010515948.1|  PREDICTED: protein trichome birefringence-li...    146   6e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006291297.1|  hypothetical protein CARUB_v10017432mg             145   1e-37   
ref|XP_010912275.1|  PREDICTED: protein trichome birefringence-li...    145   2e-37   Elaeis guineensis
ref|XP_009404370.1|  PREDICTED: protein trichome birefringence-li...    144   2e-37   
ref|XP_008790903.1|  PREDICTED: protein trichome birefringence-li...    145   2e-37   
gb|KFK34680.1|  hypothetical protein AALP_AA5G177300                    144   4e-37   Arabis alpina [alpine rockcress]
ref|XP_002877964.1|  hypothetical protein ARALYDRAFT_485823             140   5e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_006836042.1|  hypothetical protein AMTR_s00114p00046060          140   7e-36   Amborella trichopoda
ref|XP_006403597.1|  hypothetical protein EUTSA_v10010451mg             140   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010504228.1|  PREDICTED: protein trichome birefringence-li...    139   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010427099.1|  PREDICTED: protein trichome birefringence-li...    139   1e-35   Camelina sativa [gold-of-pleasure]
ref|NP_566996.1|  protein TRICHOME BIREFRINGENCE-LIKE 36                138   3e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76156.1|  BnaA04g04200D                                          138   5e-35   
emb|CDY65398.1|  BnaCnng46890D                                          134   1e-33   Brassica napus [oilseed rape]
emb|CAB71000.1|  putative protein                                       123   2e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDP03007.1|  unnamed protein product                                123   4e-29   Coffea canephora [robusta coffee]
gb|EPS60512.1|  hypothetical protein M569_14291                         122   5e-29   Genlisea aurea
gb|KJB82732.1|  hypothetical protein B456_013G211200                    121   8e-29   Gossypium raimondii
ref|XP_006845734.1|  hypothetical protein AMTR_s00019p00245310          119   2e-28   
gb|KHG05807.1|  Pyridoxal-phosphate-dependent serine hydroxymethy...    120   2e-28   Gossypium arboreum [tree cotton]
ref|XP_010535816.1|  PREDICTED: protein trichome birefringence-li...    119   7e-28   Tarenaya hassleriana [spider flower]
gb|ABK26918.1|  unknown                                                 115   1e-27   Picea sitchensis
ref|XP_010046898.1|  PREDICTED: protein trichome birefringence-li...    117   2e-27   Eucalyptus grandis [rose gum]
gb|KDP35862.1|  hypothetical protein JCGZ_10642                         118   2e-27   Jatropha curcas
gb|EYU37306.1|  hypothetical protein MIMGU_mgv1a022803mg                117   5e-27   Erythranthe guttata [common monkey flower]
ref|XP_007014486.1|  Trichome birefringence-like 5 isoform 1            116   5e-27   
ref|XP_002268396.1|  PREDICTED: protein trichome birefringence-li...    117   6e-27   Vitis vinifera
ref|XP_006840447.1|  hypothetical protein AMTR_s00045p00169080          115   6e-27   
gb|KJB22002.1|  hypothetical protein B456_004G024900                    116   8e-27   Gossypium raimondii
gb|KJB22001.1|  hypothetical protein B456_004G024900                    116   8e-27   Gossypium raimondii
ref|XP_002324663.2|  hypothetical protein POPTR_0018s13290g             116   8e-27   
gb|KJB22003.1|  hypothetical protein B456_004G024900                    116   8e-27   Gossypium raimondii
ref|XP_011017737.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    116   9e-27   Populus euphratica
gb|KHG14015.1|  CAS1 domain-containing 1                                115   1e-26   Gossypium arboreum [tree cotton]
ref|XP_011020096.1|  PREDICTED: protein trichome birefringence-li...    115   2e-26   Populus euphratica
ref|XP_002308095.2|  hypothetical protein POPTR_0006s07090g             115   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006846293.1|  hypothetical protein AMTR_s00012p00251740          114   2e-26   Amborella trichopoda
ref|XP_010999799.1|  PREDICTED: protein trichome birefringence-li...    114   3e-26   Populus euphratica
ref|XP_011069938.1|  PREDICTED: protein trichome birefringence-li...    115   3e-26   Sesamum indicum [beniseed]
gb|KHN22642.1|  hypothetical protein glysoja_027530                     114   3e-26   Glycine soja [wild soybean]
ref|XP_008223825.1|  PREDICTED: protein trichome birefringence-li...    114   3e-26   Prunus mume [ume]
ref|XP_007222250.1|  hypothetical protein PRUPE_ppa004735mg             114   3e-26   Prunus persica
ref|XP_004299786.1|  PREDICTED: protein trichome birefringence-li...    114   3e-26   Fragaria vesca subsp. vesca
ref|XP_002311234.2|  hypothetical protein POPTR_0008s070202g            112   4e-26   
ref|XP_003541536.1|  PREDICTED: protein YLS7-like                       114   4e-26   Glycine max [soybeans]
ref|XP_006474304.1|  PREDICTED: protein YLS7-like                       113   6e-26   Citrus sinensis [apfelsine]
ref|XP_006453211.1|  hypothetical protein CICLE_v10008256mg             113   7e-26   
ref|XP_006400622.1|  hypothetical protein EUTSA_v10013361mg             113   8e-26   Eutrema salsugineum [saltwater cress]
ref|XP_010687461.1|  PREDICTED: protein trichome birefringence-li...    113   8e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009388706.1|  PREDICTED: protein trichome birefringence-li...    112   8e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009342821.1|  PREDICTED: protein trichome birefringence-li...    112   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_010689958.1|  PREDICTED: protein trichome birefringence-li...    111   1e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY16546.1|  BnaC09g37270D                                          112   2e-25   Brassica napus [oilseed rape]
ref|XP_010265394.1|  PREDICTED: protein trichome birefringence-li...    112   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010259297.1|  PREDICTED: protein trichome birefringence-li...    112   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008386343.1|  PREDICTED: protein trichome birefringence-li...    109   3e-25   
ref|XP_004497886.1|  PREDICTED: uncharacterized protein LOC101512080    112   3e-25   Cicer arietinum [garbanzo]
ref|XP_010267993.1|  PREDICTED: protein trichome birefringence-li...    111   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010915622.1|  PREDICTED: protein trichome birefringence-li...    110   3e-25   Elaeis guineensis
ref|XP_003610012.1|  hypothetical protein MTR_4g126950                  111   4e-25   
gb|EPS67963.1|  hypothetical protein M569_06809                         110   4e-25   Genlisea aurea
emb|CBI17853.3|  unnamed protein product                                110   4e-25   Vitis vinifera
gb|KHN17657.1|  hypothetical protein glysoja_005854                     110   5e-25   Glycine soja [wild soybean]
ref|XP_003550638.1|  PREDICTED: protein YLS7-like                       110   5e-25   Glycine max [soybeans]
ref|XP_006469127.1|  PREDICTED: protein YLS7-like                       110   5e-25   
ref|XP_010267992.1|  PREDICTED: protein trichome birefringence-li...    111   5e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009763711.1|  PREDICTED: protein trichome birefringence-li...    111   5e-25   Nicotiana sylvestris
ref|XP_009340027.1|  PREDICTED: protein trichome birefringence-li...    110   5e-25   Pyrus x bretschneideri [bai li]
ref|NP_197559.1|  protein trichome birefringence-like 5                 110   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296433.1|  hypothetical protein CARUB_v10025613mg             110   5e-25   
ref|XP_009120795.1|  PREDICTED: protein trichome birefringence-li...    111   6e-25   Brassica rapa
ref|XP_010914510.1|  PREDICTED: protein trichome birefringence-li...    110   6e-25   
ref|XP_010493164.1|  PREDICTED: protein trichome birefringence-li...    110   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007154672.1|  hypothetical protein PHAVU_003G138100g             110   6e-25   Phaseolus vulgaris [French bean]
gb|AAM64322.1|  unknown                                                 110   7e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92451.1|  BnaA10g14900D                                          110   7e-25   
gb|KEH16599.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    111   8e-25   Medicago truncatula
gb|KDO63330.1|  hypothetical protein CISIN_1g043893mg                   110   8e-25   Citrus sinensis [apfelsine]
ref|XP_006446764.1|  hypothetical protein CICLE_v10017800mg             109   9e-25   
ref|XP_002871948.1|  hypothetical protein ARALYDRAFT_488963             110   9e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_008369046.1|  PREDICTED: protein trichome birefringence-li...    110   1e-24   
gb|ACN40917.1|  unknown                                                 109   1e-24   Picea sitchensis
ref|XP_006287593.1|  hypothetical protein CARUB_v10000803mg             110   1e-24   Capsella rubella
ref|XP_011098382.1|  PREDICTED: protein trichome birefringence-li...    106   1e-24   Sesamum indicum [beniseed]
ref|XP_009378730.1|  PREDICTED: protein trichome birefringence-li...    110   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_009610815.1|  PREDICTED: protein trichome birefringence-li...    110   1e-24   Nicotiana tomentosiformis
ref|XP_011044590.1|  PREDICTED: protein trichome birefringence-li...    107   1e-24   Populus euphratica
gb|KFK26286.1|  hypothetical protein AALP_AA8G228100                    110   1e-24   Arabis alpina [alpine rockcress]
ref|XP_006366199.1|  PREDICTED: uncharacterized protein LOC102583...    110   1e-24   
ref|XP_004243016.1|  PREDICTED: protein trichome birefringence-li...    110   1e-24   Solanum lycopersicum
ref|XP_010454365.1|  PREDICTED: protein trichome birefringence-li...    110   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010921033.1|  PREDICTED: protein trichome birefringence-li...    109   2e-24   Elaeis guineensis
ref|XP_010273482.1|  PREDICTED: protein trichome birefringence-li...    108   2e-24   Nelumbo nucifera [Indian lotus]
gb|ABR16389.1|  unknown                                                 109   2e-24   Picea sitchensis
ref|XP_002283620.1|  PREDICTED: protein trichome birefringence-li...    108   2e-24   Vitis vinifera
ref|XP_010513188.1|  PREDICTED: protein trichome birefringence-li...    108   2e-24   
ref|XP_009414283.1|  PREDICTED: protein ESKIMO 1-like                   109   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006366198.1|  PREDICTED: uncharacterized protein LOC102583...    110   2e-24   Solanum tuberosum [potatoes]
ref|NP_001168900.1|  uncharacterized protein LOC100382706               110   2e-24   Zea mays [maize]
emb|CAN60202.1|  hypothetical protein VITISV_036403                     108   2e-24   Vitis vinifera
emb|CBI30668.3|  unnamed protein product                                108   2e-24   Vitis vinifera
gb|ABA29158.1|  unknown                                                 108   2e-24   Pisum sativum [garden pea]
gb|AAP22495.1|  hypothetical protein At2g30900                          106   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274664.1|  PREDICTED: protein trichome birefringence-li...    108   2e-24   Vitis vinifera
gb|KEH39261.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    108   2e-24   Medicago truncatula
gb|AGC11114.1|  LRR receptor-like protein kinase                        107   2e-24   Larix sibirica
gb|AGC11123.1|  LRR receptor-like protein kinase                        107   2e-24   Larix sibirica
ref|NP_001183316.1|  uncharacterized protein LOC100501717               107   2e-24   
gb|ABA29157.1|  unknown                                                 108   2e-24   Pisum sativum [garden pea]
ref|XP_006349183.1|  PREDICTED: uncharacterized protein LOC102598625    109   2e-24   Solanum tuberosum [potatoes]
gb|AGC11105.1|  LRR receptor-like protein kinase                        107   2e-24   Larix sibirica
gb|EPS71829.1|  hypothetical protein M569_02929                         107   2e-24   Genlisea aurea
ref|XP_010272738.1|  PREDICTED: protein trichome birefringence-li...    108   3e-24   Nelumbo nucifera [Indian lotus]
gb|KJB46924.1|  hypothetical protein B456_008G001700                    109   3e-24   Gossypium raimondii
ref|XP_004305820.2|  PREDICTED: protein trichome birefringence-li...    108   3e-24   Fragaria vesca subsp. vesca
gb|AGC11129.1|  LRR receptor-like protein kinase                        107   3e-24   Larix sibirica
ref|XP_008781812.1|  PREDICTED: protein trichome birefringence-li...    108   3e-24   Phoenix dactylifera
ref|XP_002525125.1|  conserved hypothetical protein                     107   3e-24   
gb|AGC11130.1|  LRR receptor-like protein kinase                        107   3e-24   Larix sibirica
ref|XP_010272737.1|  PREDICTED: protein trichome birefringence-li...    108   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_007200128.1|  hypothetical protein PRUPE_ppa017879mg             110   3e-24   Prunus persica
ref|XP_004507925.1|  PREDICTED: uncharacterized protein LOC101489...    108   3e-24   Cicer arietinum [garbanzo]
ref|XP_004251923.1|  PREDICTED: protein trichome birefringence-li...    107   3e-24   
gb|AFK49604.1|  unknown                                                 107   3e-24   Lotus japonicus
ref|XP_009631911.1|  PREDICTED: protein trichome birefringence-li...    107   4e-24   Nicotiana tomentosiformis
emb|CDP17066.1|  unnamed protein product                                109   4e-24   Coffea canephora [robusta coffee]
ref|XP_008783972.1|  PREDICTED: protein trichome birefringence-li...    107   4e-24   
ref|XP_009132768.1|  PREDICTED: protein trichome birefringence-li...    107   4e-24   Brassica rapa
ref|XP_006344054.1|  PREDICTED: uncharacterized protein LOC102598924    107   4e-24   Solanum tuberosum [potatoes]
emb|CDY23962.1|  BnaC03g17290D                                          107   4e-24   Brassica napus [oilseed rape]
gb|AFW81662.1|  putative DUF231 domain containing family protein        107   5e-24   
ref|XP_004229386.1|  PREDICTED: protein trichome birefringence-li...    108   5e-24   Solanum lycopersicum
ref|XP_002862622.1|  hypothetical protein ARALYDRAFT_333274             107   5e-24   Arabidopsis lyrata subsp. lyrata
gb|KHN36688.1|  hypothetical protein glysoja_001419                     107   5e-24   Glycine soja [wild soybean]
ref|XP_003543309.1|  PREDICTED: protein YLS7                            107   5e-24   Glycine max [soybeans]
gb|AFW81659.1|  putative DUF231 domain containing family protein        107   5e-24   
ref|XP_004487169.1|  PREDICTED: uncharacterized protein LOC101503983    107   5e-24   Cicer arietinum [garbanzo]
ref|XP_006854129.1|  hypothetical protein AMTR_s00048p00162020          108   5e-24   
ref|XP_008355473.1|  PREDICTED: protein trichome birefringence-li...    106   6e-24   
gb|KDO71838.1|  hypothetical protein CISIN_1g045325mg                   107   6e-24   Citrus sinensis [apfelsine]
gb|AFW81661.1|  putative DUF231 domain containing family protein        107   6e-24   
ref|XP_004137306.1|  PREDICTED: uncharacterized protein LOC101210661    107   6e-24   Cucumis sativus [cucumbers]
ref|XP_011044589.1|  PREDICTED: protein trichome birefringence-li...    107   6e-24   Populus euphratica
ref|XP_007216490.1|  hypothetical protein PRUPE_ppa025085mg             103   6e-24   
gb|AFW84205.1|  putative DUF231 domain containing family protein        105   6e-24   
ref|XP_008783902.1|  PREDICTED: protein trichome birefringence-li...    107   6e-24   Phoenix dactylifera
ref|XP_006488998.1|  PREDICTED: protein YLS7-like                       107   6e-24   Citrus sinensis [apfelsine]
ref|XP_002285609.1|  PREDICTED: protein trichome birefringence-li...    107   6e-24   Vitis vinifera
ref|XP_006419433.1|  hypothetical protein CICLE_v10006676mg             107   6e-24   
ref|XP_008451714.1|  PREDICTED: protein trichome birefringence-li...    107   6e-24   Cucumis melo [Oriental melon]
gb|AGC11112.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11215.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11119.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11208.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11125.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
ref|XP_008456435.1|  PREDICTED: protein trichome birefringence-li...    103   7e-24   Cucumis melo [Oriental melon]
emb|CAN82331.1|  hypothetical protein VITISV_007322                     107   7e-24   Vitis vinifera
ref|XP_009359366.1|  PREDICTED: protein trichome birefringence-li...    107   7e-24   Pyrus x bretschneideri [bai li]
gb|AGC11120.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11115.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11122.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
ref|XP_004240405.1|  PREDICTED: protein PMR5                            107   7e-24   Solanum lycopersicum
gb|AGC11192.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
ref|XP_010913702.1|  PREDICTED: protein trichome birefringence-li...    107   7e-24   Elaeis guineensis
gb|AGC11164.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11104.1|  LRR receptor-like protein kinase                        105   7e-24   Larix sibirica
gb|AGC11109.1|  LRR receptor-like protein kinase                        105   8e-24   Larix sibirica
ref|XP_010240099.1|  PREDICTED: protein trichome birefringence-li...    107   8e-24   Brachypodium distachyon [annual false brome]
ref|XP_002271893.1|  PREDICTED: protein trichome birefringence-li...    107   8e-24   Vitis vinifera
ref|XP_010544965.1|  PREDICTED: protein trichome birefringence-li...    107   8e-24   Tarenaya hassleriana [spider flower]
ref|XP_006451732.1|  hypothetical protein CICLE_v10009228mg             105   8e-24   
ref|XP_007133303.1|  hypothetical protein PHAVU_011G168300g             106   8e-24   Phaseolus vulgaris [French bean]
ref|XP_004295668.1|  PREDICTED: protein trichome birefringence-li...    107   8e-24   Fragaria vesca subsp. vesca
ref|XP_006410237.1|  hypothetical protein EUTSA_v10016834mg             107   8e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010420901.1|  PREDICTED: protein trichome birefringence-li...    107   9e-24   Camelina sativa [gold-of-pleasure]
gb|KFK31236.1|  hypothetical protein AALP_AA6G086200                    106   9e-24   Arabis alpina [alpine rockcress]
gb|AFW70396.1|  hypothetical protein ZEAMMB73_344849                    105   9e-24   
ref|XP_006302323.1|  hypothetical protein CARUB_v10020376mg             107   9e-24   Capsella rubella
ref|XP_007149752.1|  hypothetical protein PHAVU_005G096200g             106   9e-24   Phaseolus vulgaris [French bean]
ref|XP_004970447.1|  PREDICTED: uncharacterized protein LOC101759...    108   9e-24   Setaria italica
ref|XP_010038289.1|  PREDICTED: protein trichome birefringence-li...    108   1e-23   Eucalyptus grandis [rose gum]
ref|XP_004970448.1|  PREDICTED: uncharacterized protein LOC101759...    108   1e-23   
ref|XP_008450807.1|  PREDICTED: protein trichome birefringence-li...    107   1e-23   Cucumis melo [Oriental melon]
ref|NP_180647.2|  protein TRICHOME BIREFRINGENCE-LIKE 43                106   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410189.1|  hypothetical protein EUTSA_v10017902mg             106   1e-23   
emb|CBI20118.3|  unnamed protein product                                110   1e-23   Vitis vinifera
gb|AAP22494.1|  hypothetical protein At2g30900                          106   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783901.1|  PREDICTED: protein trichome birefringence-li...    106   1e-23   Phoenix dactylifera
gb|AAC20724.1|  hypothetical protein                                    106   1e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05987.1|  unnamed protein product                                106   1e-23   Coffea canephora [robusta coffee]
ref|XP_003564532.1|  PREDICTED: protein trichome birefringence-li...    107   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_008235216.1|  PREDICTED: protein trichome birefringence-li...    107   1e-23   Prunus mume [ume]
dbj|BAK06236.1|  predicted protein                                      106   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002527690.1|  conserved hypothetical protein                     107   1e-23   
ref|XP_007217300.1|  hypothetical protein PRUPE_ppa018693mg             106   1e-23   Prunus persica
ref|XP_010473941.1|  PREDICTED: protein trichome birefringence-li...    106   1e-23   
ref|XP_010911005.1|  PREDICTED: protein trichome birefringence-li...    102   2e-23   
emb|CDY24924.1|  BnaC03g22480D                                          106   2e-23   Brassica napus [oilseed rape]
ref|XP_010917266.1|  PREDICTED: protein trichome birefringence          108   2e-23   Elaeis guineensis
ref|XP_008655378.1|  PREDICTED: uncharacterized protein LOC100501...    107   2e-23   
ref|XP_009802920.1|  PREDICTED: protein trichome birefringence-li...    105   2e-23   Nicotiana sylvestris
ref|XP_006451733.1|  hypothetical protein CICLE_v10008349mg             106   2e-23   
ref|XP_003540392.1|  PREDICTED: protein YLS7 isoform 1                  105   2e-23   Glycine max [soybeans]
ref|XP_010108265.1|  hypothetical protein L484_018686                   106   2e-23   Morus notabilis
ref|XP_006485831.1|  PREDICTED: protein YLS7-like                       105   2e-23   Citrus sinensis [apfelsine]
gb|ABK22287.1|  unknown                                                 105   2e-23   Picea sitchensis
gb|KDO48340.1|  hypothetical protein CISIN_1g015036mg                   105   2e-23   Citrus sinensis [apfelsine]
gb|ABK25068.1|  unknown                                                 105   2e-23   Picea sitchensis
dbj|BAK03305.1|  predicted protein                                      105   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004150389.1|  PREDICTED: uncharacterized protein LOC101212427    106   2e-23   Cucumis sativus [cucumbers]
ref|XP_009604954.1|  PREDICTED: protein trichome birefringence-li...    107   2e-23   Nicotiana tomentosiformis
ref|XP_010060667.1|  PREDICTED: protein trichome birefringence-li...    105   2e-23   Eucalyptus grandis [rose gum]
gb|AAC63839.1|  unknown protein                                         102   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451728.1|  PREDICTED: protein trichome birefringence-li...    105   2e-23   Cucumis melo [Oriental melon]
ref|XP_002975529.1|  hypothetical protein SELMODRAFT_52381              105   2e-23   
ref|XP_008810174.1|  PREDICTED: protein trichome birefringence-li...    106   2e-23   
ref|XP_010531925.1|  PREDICTED: protein trichome birefringence-li...    105   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_006486305.1|  PREDICTED: protein YLS7-like isoform X2            106   2e-23   Citrus sinensis [apfelsine]
ref|XP_010523922.1|  PREDICTED: protein trichome birefringence-li...    106   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_008245550.1|  PREDICTED: protein trichome birefringence-li...    105   3e-23   Prunus mume [ume]
gb|EYU31623.1|  hypothetical protein MIMGU_mgv1a017870mg                105   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_009418065.1|  PREDICTED: protein trichome birefringence-li...    103   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435757.1|  hypothetical protein CICLE_v10031403mg             106   3e-23   Citrus clementina [clementine]
gb|KCW67468.1|  hypothetical protein EUGRSUZ_F01211                     106   3e-23   Eucalyptus grandis [rose gum]
ref|XP_008783904.1|  PREDICTED: protein trichome birefringence-li...    105   3e-23   Phoenix dactylifera
ref|XP_009334009.1|  PREDICTED: protein trichome birefringence-li...    105   3e-23   Pyrus x bretschneideri [bai li]
ref|XP_006477896.1|  PREDICTED: protein YLS7-like                       105   3e-23   
ref|NP_001055286.1|  Os05g0354400                                       107   3e-23   
ref|XP_009384431.1|  PREDICTED: protein trichome birefringence-li...    107   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008811067.1|  PREDICTED: protein trichome birefringence-li...    102   3e-23   
ref|XP_010685528.1|  PREDICTED: protein PMR5-like                       105   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010414204.1|  PREDICTED: protein trichome birefringence-li...    105   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002456582.1|  hypothetical protein SORBIDRAFT_03g038800          106   3e-23   
gb|AFK40281.1|  unknown                                                 105   3e-23   
ref|XP_009386636.1|  PREDICTED: protein trichome birefringence-li...    105   3e-23   
ref|XP_006852457.1|  hypothetical protein AMTR_s00021p00115070          105   3e-23   
ref|XP_009394133.1|  PREDICTED: protein trichome birefringence-li...    105   4e-23   
gb|AGC11158.1|  LRR receptor-like protein kinase                        103   4e-23   
ref|NP_001044698.1|  Os01g0830700                                       106   4e-23   
gb|KDO48341.1|  hypothetical protein CISIN_1g041668mg                   103   4e-23   
ref|XP_010684255.1|  PREDICTED: protein trichome birefringence-li...    105   4e-23   
gb|ACU14578.1|  unknown                                                 103   4e-23   
ref|XP_002440930.1|  hypothetical protein SORBIDRAFT_09g017080          106   4e-23   
gb|EAY76370.1|  hypothetical protein OsI_04301                          106   4e-23   
ref|XP_009411213.1|  PREDICTED: protein trichome birefringence-li...    104   4e-23   
ref|XP_010915624.1|  PREDICTED: protein trichome birefringence-li...    105   4e-23   
ref|XP_010510274.1|  PREDICTED: protein trichome birefringence-li...    104   5e-23   
ref|XP_007132901.1|  hypothetical protein PHAVU_011G1346001g            102   5e-23   
ref|XP_009356765.1|  PREDICTED: protein trichome birefringence-li...    105   5e-23   
gb|AAV43889.1|  unknown protein                                         105   5e-23   
gb|EPS70682.1|  hypothetical protein M569_04078                         104   5e-23   
ref|XP_010913162.1|  PREDICTED: protein trichome birefringence-li...    105   5e-23   
ref|XP_009393476.1|  PREDICTED: protein YLS7                            105   5e-23   
gb|KDP31784.1|  hypothetical protein JCGZ_12245                         104   5e-23   
gb|KHN09728.1|  hypothetical protein glysoja_045768                     104   6e-23   
ref|XP_010416101.1|  PREDICTED: protein trichome birefringence-li...    104   6e-23   
gb|KHG08135.1|  putative U95                                            105   6e-23   
ref|XP_010091711.1|  hypothetical protein L484_001474                   101   6e-23   
ref|XP_011098189.1|  PREDICTED: protein trichome birefringence-li...    104   6e-23   
gb|KHG18741.1|  CAS1 domain-containing 1                                105   6e-23   
ref|XP_010272739.1|  PREDICTED: protein trichome birefringence-li...    104   6e-23   
ref|XP_009590818.1|  PREDICTED: protein trichome birefringence-li...    104   6e-23   
ref|XP_010093461.1|  hypothetical protein L484_017522                   104   6e-23   
ref|XP_009590824.1|  PREDICTED: protein trichome birefringence-li...    104   6e-23   
ref|XP_007162412.1|  hypothetical protein PHAVU_001G150000g             105   6e-23   
ref|XP_003520540.1|  PREDICTED: protein YLS7-like                       106   6e-23   
ref|XP_002467977.1|  hypothetical protein SORBIDRAFT_01g037455          105   6e-23   
gb|ADE76095.1|  unknown                                                 105   6e-23   
ref|XP_003535066.1|  PREDICTED: protein YLS7-like                       104   6e-23   
gb|KJB61643.1|  hypothetical protein B456_009G372400                    104   6e-23   
ref|XP_001784106.1|  predicted protein                                  104   6e-23   
ref|XP_009622720.1|  PREDICTED: protein PMR5-like                       104   7e-23   
ref|XP_010510241.1|  PREDICTED: protein trichome birefringence-li...    104   7e-23   
gb|KJB77027.1|  hypothetical protein B456_012G118800                    104   7e-23   
emb|CDM82949.1|  unnamed protein product                                105   7e-23   
ref|XP_011095070.1|  PREDICTED: protein trichome birefringence-li...    104   7e-23   
ref|XP_004252117.1|  PREDICTED: protein trichome birefringence-li...    104   7e-23   
ref|XP_006477834.1|  PREDICTED: protein YLS7-like                       104   7e-23   
ref|XP_006442366.1|  hypothetical protein CICLE_v10024135mg             104   7e-23   
ref|XP_006390590.1|  hypothetical protein EUTSA_v10018630mg             104   7e-23   
emb|CDO98793.1|  unnamed protein product                                104   7e-23   
ref|XP_006358947.1|  PREDICTED: uncharacterized protein LOC102605235    104   7e-23   
ref|XP_002300940.2|  hypothetical protein POPTR_0002s07270g             104   7e-23   
ref|XP_009359359.1|  PREDICTED: protein trichome birefringence-li...    103   7e-23   
ref|XP_010915618.1|  PREDICTED: protein trichome birefringence-li...    103   8e-23   
ref|XP_010552824.1|  PREDICTED: protein trichome birefringence-li...    103   9e-23   
gb|EPS74217.1|  hypothetical protein M569_00536                         103   9e-23   
ref|XP_007021953.1|  Trichome birefringence-like 42                     103   9e-23   
ref|XP_002524265.1|  conserved hypothetical protein                     102   9e-23   
ref|XP_006644950.1|  PREDICTED: protein YLS7-like                       105   9e-23   
ref|XP_002311402.2|  hypothetical protein POPTR_0008s10790g             103   9e-23   
ref|XP_010428217.1|  PREDICTED: protein trichome birefringence-li...    104   9e-23   
ref|XP_009794595.1|  PREDICTED: protein trichome birefringence-li...    104   9e-23   
ref|XP_007212437.1|  hypothetical protein PRUPE_ppa016768mg             103   9e-23   
ref|XP_010552884.1|  PREDICTED: protein trichome birefringence-li...    103   9e-23   
gb|KDO68937.1|  hypothetical protein CISIN_1g047865mg                   103   9e-23   
ref|XP_011464795.1|  PREDICTED: protein trichome birefringence-li...    103   9e-23   
ref|XP_010558437.1|  PREDICTED: protein trichome birefringence-li...    104   9e-23   
ref|XP_008371453.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
gb|KJB12973.1|  hypothetical protein B456_002G048100                    103   1e-22   
ref|XP_009386635.1|  PREDICTED: protein trichome birefringence-li...    105   1e-22   
gb|KJB12976.1|  hypothetical protein B456_002G048100                    103   1e-22   
ref|XP_002448144.1|  hypothetical protein SORBIDRAFT_06g022030          106   1e-22   
ref|XP_002973496.1|  hypothetical protein SELMODRAFT_53072              103   1e-22   
gb|KJB12975.1|  hypothetical protein B456_002G048100                    103   1e-22   
emb|CDY48039.1|  BnaA02g16320D                                          103   1e-22   
ref|XP_008228902.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_010552686.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_009790373.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
gb|KJB49817.1|  hypothetical protein B456_008G139200                    105   1e-22   
gb|EEE51654.1|  hypothetical protein OsJ_32966                          104   1e-22   
ref|XP_009127972.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_011469946.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_007044711.1|  Uncharacterized protein TCM_010432                 105   1e-22   
ref|XP_009783488.1|  PREDICTED: protein trichome birefringence-li...    105   1e-22   
ref|XP_010552766.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_007201163.1|  hypothetical protein PRUPE_ppa004056mg             105   1e-22   
ref|XP_006843601.1|  hypothetical protein AMTR_s00007p00135110          103   1e-22   
emb|CDP10632.1|  unnamed protein product                                103   1e-22   
ref|XP_011027378.1|  PREDICTED: protein trichome berefringence-li...    103   1e-22   
gb|KJB12974.1|  hypothetical protein B456_002G048100                    103   1e-22   
ref|XP_007211024.1|  hypothetical protein PRUPE_ppa019892mg           99.8    1e-22   
gb|ABA91480.2|  expressed protein                                       104   1e-22   
ref|XP_003558153.1|  PREDICTED: protein trichome birefringence-li...    105   1e-22   
ref|XP_009378729.1|  PREDICTED: protein trichome birefringence-li...    104   1e-22   
ref|XP_010942466.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_006485832.1|  PREDICTED: protein YLS7-like                       103   1e-22   
ref|XP_007133190.1|  hypothetical protein PHAVU_011G159100g             103   1e-22   
ref|XP_006657213.1|  PREDICTED: protein YLS7-like                       103   1e-22   
ref|XP_002317443.1|  hypothetical protein POPTR_0011s10740g             103   1e-22   
ref|XP_010277749.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
gb|KJB76674.1|  hypothetical protein B456_012G100000                    104   1e-22   
ref|XP_010553117.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_010534606.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_009590179.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
emb|CBX25505.1|  hypothetical_protein                                   104   1e-22   
ref|XP_004307688.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_011005287.1|  PREDICTED: protein trichome birefringence-like     105   1e-22   
ref|XP_010107044.1|  hypothetical protein L484_003589                   104   1e-22   
ref|XP_006407039.1|  hypothetical protein EUTSA_v10021040mg             103   1e-22   
ref|XP_003525992.2|  PREDICTED: protein YLS7-like                       103   1e-22   
ref|XP_010052546.1|  PREDICTED: protein trichome birefringence-li...    103   1e-22   
ref|XP_006294274.1|  hypothetical protein CARUB_v10023271mg             103   1e-22   
ref|NP_001130739.1|  putative DUF231 domain containing family pro...    104   2e-22   
gb|KDO42403.1|  hypothetical protein CISIN_1g017556mg                   103   2e-22   
ref|XP_004962376.1|  PREDICTED: uncharacterized protein LOC101758227    104   2e-22   
ref|XP_004303340.1|  PREDICTED: protein trichome birefringence-like     105   2e-22   
ref|XP_009133417.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
ref|XP_010471362.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
gb|ACG46935.1|  hypothetical protein                                    104   2e-22   
emb|CDX82104.1|  BnaC02g21860D                                          103   2e-22   
ref|XP_004301795.1|  PREDICTED: protein trichome birefringence-li...    104   2e-22   
ref|XP_009418554.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
ref|XP_004978124.1|  PREDICTED: uncharacterized protein LOC101771038    105   2e-22   
ref|XP_009133416.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
ref|XP_002279857.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
ref|XP_006398600.1|  hypothetical protein EUTSA_v10013544mg             103   2e-22   
ref|XP_009591917.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
emb|CAB82278.1|  putative protein                                       103   2e-22   
ref|XP_002879850.1|  hypothetical protein ARALYDRAFT_483062             103   2e-22   
gb|KHN19485.1|  hypothetical protein glysoja_026100                     103   2e-22   
gb|KDO86992.1|  hypothetical protein CISIN_1g009237mg                   102   2e-22   
ref|NP_568093.1|  protein trichome birefringence-like 35                103   2e-22   
ref|XP_008792962.1|  PREDICTED: protein PMR5                            103   2e-22   
ref|XP_002301513.2|  hypothetical protein POPTR_0002s19680g             104   2e-22   
emb|CDY20089.1|  BnaA01g29130D                                          102   2e-22   
ref|NP_001168473.1|  uncharacterized protein LOC100382249               104   2e-22   
ref|XP_004984615.1|  PREDICTED: uncharacterized protein LOC101785375    105   2e-22   
emb|CDY32336.1|  BnaC01g36550D                                          102   2e-22   
ref|XP_009588819.1|  PREDICTED: protein trichome berefringence-li...    103   2e-22   
ref|XP_008791924.1|  PREDICTED: protein trichome birefringence-li...    105   2e-22   
ref|XP_009116583.1|  PREDICTED: protein trichome birefringence-li...    102   2e-22   
ref|XP_011042254.1|  PREDICTED: protein trichome birefringence-li...    104   2e-22   
gb|KJB76673.1|  hypothetical protein B456_012G100000                    105   2e-22   
gb|KJB49815.1|  hypothetical protein B456_008G139200                    102   2e-22   
ref|XP_010912702.1|  PREDICTED: protein trichome birefringence-li...    102   2e-22   
ref|XP_010094001.1|  hypothetical protein L484_007347                   103   2e-22   
emb|CDX84181.1|  BnaC04g09430D                                          102   2e-22   
ref|NP_001190201.1|  protein trichome birefringence-like 35             103   2e-22   
ref|XP_004247157.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
ref|XP_007216008.1|  hypothetical protein PRUPE_ppa014688mg             102   2e-22   
gb|KCW84266.1|  hypothetical protein EUGRSUZ_B01121                     102   2e-22   
ref|XP_011095058.1|  PREDICTED: protein ESKIMO 1-like                   103   2e-22   
gb|KHN19883.1|  hypothetical protein glysoja_033515                     103   2e-22   
ref|XP_004137309.1|  PREDICTED: uncharacterized protein LOC101211401    102   2e-22   
gb|KJB71444.1|  hypothetical protein B456_011G124000                    102   2e-22   
ref|XP_011020489.1|  PREDICTED: protein trichome birefringence-li...    103   2e-22   
ref|XP_007019395.1|  Trichome birefringence-like 7 isoform 2            102   2e-22   
ref|XP_002323026.1|  hypothetical protein POPTR_0016s13340g             103   2e-22   
ref|XP_003625280.1|  hypothetical protein MTR_7g093450                  104   2e-22   
ref|XP_010920821.1|  PREDICTED: protein PMR5                            102   2e-22   
ref|XP_006576890.1|  PREDICTED: protein YLS7-like isoform X2            102   2e-22   
gb|KEH23742.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    102   2e-22   
gb|EPS60303.1|  hypothetical protein M569_14501                         101   2e-22   
gb|EAY89710.1|  hypothetical protein OsI_11248                          104   2e-22   
ref|XP_007021671.1|  F3N23.34 protein                                   102   2e-22   
ref|XP_009143638.1|  PREDICTED: protein trichome birefringence-li...    102   2e-22   
ref|XP_010087235.1|  hypothetical protein L484_009744                   104   2e-22   
ref|XP_009603133.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
ref|XP_004494426.1|  PREDICTED: uncharacterized protein LOC101501...    103   3e-22   
gb|KJB76676.1|  hypothetical protein B456_012G100000                    104   3e-22   
ref|XP_009412789.1|  PREDICTED: protein trichome birefringence-li...    103   3e-22   
gb|AGC11221.1|  LRR receptor-like protein kinase                        101   3e-22   
ref|XP_007200669.1|  hypothetical protein PRUPE_ppa015700mg             105   3e-22   
gb|AGC11216.1|  LRR receptor-like protein kinase                        101   3e-22   
gb|AGC11220.1|  LRR receptor-like protein kinase                        101   3e-22   
gb|AGC11218.1|  LRR receptor-like protein kinase                        101   3e-22   
ref|XP_007021950.1|  Trichome birefringence-like 41                     102   3e-22   
ref|XP_009392067.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
ref|XP_011039468.1|  PREDICTED: protein trichome birefringence-like     104   3e-22   
ref|XP_006346586.1|  PREDICTED: uncharacterized protein LOC102604720    102   3e-22   
ref|XP_011007574.1|  PREDICTED: protein trichome berefringence-li...    102   3e-22   
ref|XP_011080615.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
ref|XP_010673529.1|  PREDICTED: protein trichome birefringence-like     102   3e-22   
ref|NP_001049898.2|  Os03g0307700                                       104   3e-22   
gb|KJB76211.1|  hypothetical protein B456_012G077600                    102   3e-22   
ref|XP_004493599.1|  PREDICTED: uncharacterized protein LOC101511851    104   3e-22   
ref|XP_002515280.1|  conserved hypothetical protein                     104   3e-22   
ref|XP_010052993.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
gb|KJB33739.1|  hypothetical protein B456_006G028300                    102   3e-22   
gb|KJB76212.1|  hypothetical protein B456_012G077600                    102   3e-22   
ref|NP_565924.1|  protein TRICHOME BIREFRINGENCE-LIKE 30                102   3e-22   
ref|XP_008802906.1|  PREDICTED: protein YLS7-like                       104   3e-22   
ref|NP_177457.2|  uncharacterized protein                               102   3e-22   
ref|XP_011101136.1|  PREDICTED: protein YLS7-like                       104   3e-22   
ref|XP_010517784.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
ref|XP_003520562.2|  PREDICTED: protein YLS7-like isoform X1            103   3e-22   
ref|XP_001752383.1|  predicted protein                                  102   3e-22   
ref|XP_008804143.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
gb|KHG17263.1|  Alanine--tRNA ligase                                    102   3e-22   
gb|KJB31200.1|  hypothetical protein B456_005G180600                    102   3e-22   
emb|CDP04726.1|  unnamed protein product                                102   3e-22   
gb|KDP28262.1|  hypothetical protein JCGZ_14033                         103   3e-22   
ref|XP_010557124.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
gb|ABK28465.1|  unknown                                                 102   3e-22   
ref|XP_009141359.1|  PREDICTED: protein trichome birefringence-li...    102   3e-22   
gb|AAG52129.1|AC010556_11  hypothetical protein; 63994-65574            102   3e-22   
ref|NP_001189720.1|  protein TRICHOME BIREFRINGENCE-LIKE 30             102   3e-22   
gb|EEC82737.1|  hypothetical protein OsI_27441                          104   3e-22   
ref|XP_006352779.1|  PREDICTED: uncharacterized protein LOC102598...    102   4e-22   
ref|XP_009369217.1|  PREDICTED: protein trichome birefringence-li...    102   4e-22   
gb|KCW60835.1|  hypothetical protein EUGRSUZ_H03574                     102   4e-22   
ref|XP_008805163.1|  PREDICTED: protein ESKIMO 1-like                   102   4e-22   
ref|XP_010915619.1|  PREDICTED: protein trichome birefringence-li...    102   4e-22   
ref|XP_007019394.1|  Trichome birefringence-like 7 isoform 1            102   4e-22   
ref|XP_006477835.1|  PREDICTED: protein YLS7-like                       102   4e-22   
ref|XP_002888908.1|  hypothetical protein ARALYDRAFT_316264             102   4e-22   
gb|KHN19212.1|  hypothetical protein glysoja_041564                     102   4e-22   
ref|XP_007142244.1|  hypothetical protein PHAVU_008G264500g             102   4e-22   
ref|XP_009776665.1|  PREDICTED: protein trichome berefringence-li...    102   4e-22   
ref|XP_004493658.1|  PREDICTED: uncharacterized protein LOC101501781    102   4e-22   
ref|XP_011095067.1|  PREDICTED: protein trichome birefringence-li...    102   4e-22   
ref|XP_010035521.1|  PREDICTED: protein trichome birefringence-li...    102   4e-22   



>emb|CDO99906.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 2/116 (2%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYL  452
             ESS YE EELSWL   D+DDEI+M+Q RHASLR CD ++GKWV+DQ+YPLYDP+ CPYL
Sbjct  27   GESSRYEQEELSWLA--DNDDEINMIQGRHASLRRCDLTSGKWVYDQTYPLYDPSTCPYL  84

Query  453  STAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +TAV+C KNGRPDSDY+KW+WKPDGCTIPRFDALEFLGRMRR+RIMLVGDSIMRNQ
Sbjct  85   TTAVTCQKNGRPDSDYEKWRWKPDGCTIPRFDALEFLGRMRRRRIMLVGDSIMRNQ  140



>ref|XP_011076935.1| PREDICTED: protein trichome birefringence-like 36 [Sesamum indicum]
Length=383

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 2/116 (2%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYL  452
            AESS Y+ EEL WLD  D DDEISMVQSRH++L +CDFS GKWV+DQ+YPLYD A CPYL
Sbjct  27   AESSRYDQEELQWLD--DKDDEISMVQSRHSALTTCDFSKGKWVYDQTYPLYDAATCPYL  84

Query  453  STAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            STAV+C KNGRPDSDY+KW+WKPDGC+IPRFDAL+FLGRMRRKRIMLVGDSIMRNQ
Sbjct  85   STAVTCRKNGRPDSDYEKWRWKPDGCSIPRFDALDFLGRMRRKRIMLVGDSIMRNQ  140



>ref|XP_004249967.1| PREDICTED: protein trichome birefringence-like 36 [Solanum lycopersicum]
Length=378

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 3/113 (3%)
 Frame = +3

Query  282  SPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTA  461
            S YE+EEL+WLD  D DDEISM  S+H+S+R CDF++GKWVFDQSYPLYD + CPYLSTA
Sbjct  26   SQYELEELTWLD--DKDDEISMFHSQHSSMRRCDFTSGKWVFDQSYPLYD-STCPYLSTA  82

Query  462  VSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            V+C+KNGRPDSDY+KW+WKP GC IPRF+ALEFLGRMR+KRIMLVGDSIMRNQ
Sbjct  83   VTCTKNGRPDSDYEKWRWKPHGCEIPRFNALEFLGRMRKKRIMLVGDSIMRNQ  135



>ref|XP_006361471.1| PREDICTED: uncharacterized protein LOC102605360 [Solanum tuberosum]
Length=378

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 3/113 (3%)
 Frame = +3

Query  282  SPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTA  461
            S YE+EEL+WLD  D DDEISM  S+H+S+R CDF++GKWVFDQSYPLYD + CPYLSTA
Sbjct  26   SQYELEELTWLD--DKDDEISMFHSQHSSMRKCDFTSGKWVFDQSYPLYDSS-CPYLSTA  82

Query  462  VSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            V+C+KNGRPDSDY+KW+WKP GC IPRF+ALEFLG+MR+KRIMLVGDSIMRNQ
Sbjct  83   VTCTKNGRPDSDYEKWRWKPHGCEIPRFNALEFLGKMRKKRIMLVGDSIMRNQ  135



>ref|XP_009587659.1| PREDICTED: protein trichome birefringence-like 36 [Nicotiana 
tomentosiformis]
Length=374

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 3/113 (3%)
 Frame = +3

Query  282  SPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTA  461
            S YE+EEL WLD  D DDEISM  S+H+++R CD ++GKWV+DQSYPLYD + CPYLSTA
Sbjct  22   SQYELEELKWLD--DRDDEISMFHSQHSAMRRCDLTSGKWVYDQSYPLYDSS-CPYLSTA  78

Query  462  VSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            V+C+KNGRPDSDY+KWKWKP GC IPRF+ALEFLGRMR+KRIMLVGDSI+RNQ
Sbjct  79   VTCTKNGRPDSDYEKWKWKPHGCEIPRFNALEFLGRMRKKRIMLVGDSIVRNQ  131



>ref|XP_009803690.1| PREDICTED: protein trichome birefringence-like 36 [Nicotiana 
sylvestris]
Length=374

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 101/113 (89%), Gaps = 3/113 (3%)
 Frame = +3

Query  282  SPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTA  461
            S YE+EEL+WLD  D DDEISM  ++H+++R CD ++GKWV+DQSYPLYD + CPYLSTA
Sbjct  22   SQYELEELTWLD--DRDDEISMFHNQHSAMRRCDLTSGKWVYDQSYPLYDSS-CPYLSTA  78

Query  462  VSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            V+C+KNGRPDSDY+KW+WKP GC IPRF+ALEFLGRMR+KRIMLVGDSI+RNQ
Sbjct  79   VTCTKNGRPDSDYEKWRWKPHGCEIPRFNALEFLGRMRKKRIMLVGDSIVRNQ  131



>ref|XP_008231948.1| PREDICTED: protein trichome birefringence-like 36 [Prunus mume]
Length=379

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYL  452
             +SS +E+E+ SWL+  D DDE++MVQS+  S   CDFS GKWV+DQSYPLYD + CPYL
Sbjct  24   GKSSDFELEDDSWLN--DEDDEVNMVQSQQNSRSRCDFSVGKWVYDQSYPLYD-SNCPYL  80

Query  453  STAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            STAV+C KNGRPDSDY+KW+WKP+ C+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  81   STAVTCQKNGRPDSDYEKWRWKPNSCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  136



>ref|XP_007211438.1| hypothetical protein PRUPE_ppa007187mg [Prunus persica]
 gb|EMJ12637.1| hypothetical protein PRUPE_ppa007187mg [Prunus persica]
Length=379

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 3/116 (3%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYL  452
             +SS +E+E+ SWL+  D DDE++MVQS+  S   CDFS GKWV+DQSYPLYD   CPYL
Sbjct  24   GKSSDFELEDDSWLN--DEDDEVNMVQSQQNSRSRCDFSVGKWVYDQSYPLYDSG-CPYL  80

Query  453  STAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            STAV+C KNGRPDSDY+KW+WKP+ C+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  81   STAVTCQKNGRPDSDYEKWRWKPNSCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  136



>gb|EYU19805.1| hypothetical protein MIMGU_mgv1a008074mg [Erythranthe guttata]
Length=385

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYL  452
            +E S Y+ EEL WLD  + DDE++M+Q+RH+SLR+CDF+ GKWV DQ+YPLY  A CPYL
Sbjct  24   SEPSRYDQEELQWLD--NKDDEVNMLQTRHSSLRNCDFTKGKWVSDQTYPLYSAATCPYL  81

Query  453  STAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            S+AVSC +NGRPDS Y+ +KW PD C+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  82   SSAVSCRRNGRPDSHYENFKWVPDSCSIPRFDALDFLGKMRRKRIMLVGDSIMRNQ  137



>ref|XP_002521169.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41200.1| conserved hypothetical protein [Ricinus communis]
Length=289

 Score =   172 bits (435),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = +3

Query  270  CAESSPYEIEE-LSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCP  446
            C +SS + +E+ LSWL+  + D E+ MVQ+RH S  SCDF++GKWV+DQSYPLYD + CP
Sbjct  30   CGKSSQFGLEDGLSWLN--EEDSEVDMVQTRHDSSNSCDFTSGKWVYDQSYPLYDSS-CP  86

Query  447  YLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            YLST+V+C +NGRPDSDY+KW+WKP  C++PRFDAL FLG+MR+KRIMLVGDSIMRNQ
Sbjct  87   YLSTSVTCKRNGRPDSDYEKWRWKPHACSVPRFDALRFLGKMRKKRIMLVGDSIMRNQ  144



>ref|XP_009356126.1| PREDICTED: protein trichome birefringence-like 36 [Pyrus x bretschneideri]
Length=379

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 3/116 (3%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYL  452
             +SSP E+E+ SWLD  + +D ++MV+S  +S R C+ S GKWV+DQSYPLYD + CPYL
Sbjct  24   GKSSPLELEDDSWLD--EEEDAVNMVESHQSSRRRCELSAGKWVYDQSYPLYD-STCPYL  80

Query  453  STAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            STAV+C KNGRPDSDY+KW+WKP+ C+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  81   STAVTCQKNGRPDSDYEKWRWKPNSCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  136



>ref|XP_002269148.1| PREDICTED: protein trichome birefringence-like 36 [Vitis vinifera]
 emb|CBI18592.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASL-RSCDFSTGKWVFDQSYPLYDPARCPY  449
             +SS +E+E+ +WLD  + DDE++MVQS H SL  SC+FS GKWV+D SYPLYD + CPY
Sbjct  29   GKSSEFELEDEAWLD--EKDDEVNMVQSGHDSLGSSCEFSDGKWVYDLSYPLYDSS-CPY  85

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            LST V+C KNGRPDSDY+KW+WKP GC+IPRFDAL FLGRMRRKRIMLVGDSIMRNQ
Sbjct  86   LSTPVTCQKNGRPDSDYEKWRWKPHGCSIPRFDALHFLGRMRRKRIMLVGDSIMRNQ  142



>emb|CAN74465.1| hypothetical protein VITISV_004134 [Vitis vinifera]
Length=388

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASL-RSCDFSTGKWVFDQSYPLYDPARCPY  449
             +SS +E+E+ +WLD  + DDE++MVQS H SL  SC+FS GKWV+D SYPLYD + CPY
Sbjct  29   GKSSEFELEDEAWLD--EKDDEVNMVQSGHDSLGSSCEFSDGKWVYDLSYPLYD-SSCPY  85

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            LST V+C KNGRPDSDY+KW+WKP GC+IPRFDAL FLGRMRRKRIMLVGDSIMRNQ
Sbjct  86   LSTPVTCQKNGRPDSDYEKWRWKPHGCSIPRFDALHFLGRMRRKRIMLVGDSIMRNQ  142



>ref|XP_002521177.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41208.1| conserved hypothetical protein [Ricinus communis]
Length=379

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = +3

Query  270  CAESSPYEIEE-LSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCP  446
            C +SS + +E+ LSWL+  + D E+ MVQ+RH S  SCDF++GKWV+DQSYPLYD + CP
Sbjct  22   CGKSSQFGLEDGLSWLN--EEDSEVDMVQTRHDSSSSCDFTSGKWVYDQSYPLYDSS-CP  78

Query  447  YLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            YLST+V+C +NGRPDSDY+KW+WKP  C++PRFDAL+FLG+MR+KRIMLVGDSIMRNQ
Sbjct  79   YLSTSVTCKRNGRPDSDYEKWRWKPHACSVPRFDALKFLGKMRKKRIMLVGDSIMRNQ  136



>ref|XP_011469321.1| PREDICTED: protein trichome birefringence-like 36 isoform X2 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +3

Query  306  SWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGR  485
            SWL   D DD ++MVQS H+S R C  S GKWV+DQSYPLYD + CPYLSTAV+C KNGR
Sbjct  40   SWLT--DEDDRVNMVQSHHSSRRKCQLSAGKWVYDQSYPLYD-STCPYLSTAVTCQKNGR  96

Query  486  PDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            PDSDY+KW+WKP+ C+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  97   PDSDYEKWRWKPNRCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  141



>ref|XP_002311947.1| hypothetical protein POPTR_0008s02180g [Populus trichocarpa]
 gb|EEE89314.1| hypothetical protein POPTR_0008s02180g [Populus trichocarpa]
Length=384

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSC  470
            E + +SWL+  + D+E+ +VQ+RH   RSC+F +GKWV+DQSYPLYD + CPYLSTAV+C
Sbjct  35   EDDGMSWLN--EEDNEVDIVQTRHDPSRSCNFESGKWVYDQSYPLYD-SNCPYLSTAVTC  91

Query  471  SKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             KNGRPDSDY+KW+W+P GC+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  92   QKNGRPDSDYEKWRWQPHGCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  141



>ref|XP_011032863.1| PREDICTED: protein trichome birefringence-like 36 [Populus euphratica]
Length=415

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSC  470
            E + +SWL+  + D+E+ +VQ+RH   RSC+F +GKWV+DQSYPLYD + CPYLSTAV+C
Sbjct  66   EDDGMSWLN--EEDNEVDIVQTRHDPSRSCNFESGKWVYDQSYPLYD-SNCPYLSTAVTC  122

Query  471  SKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             KNGRPDSDY+KW+W+P GC+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  123  QKNGRPDSDYEKWRWQPHGCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  172



>gb|AFK36769.1| unknown [Lotus japonicus]
Length=212

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 3/105 (3%)
 Frame = +3

Query  306  SWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGR  485
            SWL  +  D  ++MVQ+   S   CDFS GKWVFDQSYPLYD + CPYLSTAV+C KNGR
Sbjct  38   SWLSMEIED--VNMVQTSSGSWNKCDFSVGKWVFDQSYPLYD-SNCPYLSTAVTCQKNGR  94

Query  486  PDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            PDSDY+KWKWKPD C++PRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  95   PDSDYEKWKWKPDSCSMPRFDALKFLGKMRRKRIMLVGDSIMRNQ  139



>ref|XP_004308558.2| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011469319.1| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011469320.1| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Fragaria vesca subsp. vesca]
Length=384

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +3

Query  306  SWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGR  485
            SWL   D DD ++MVQS H+S R C  S GKWV+DQSYPLYD + CPYLSTAV+C KNGR
Sbjct  40   SWLT--DEDDRVNMVQSHHSSRRKCQLSAGKWVYDQSYPLYD-STCPYLSTAVTCQKNGR  96

Query  486  PDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            PDSDY+KW+WKP+ C+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  97   PDSDYEKWRWKPNRCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  141



>ref|XP_007142840.1| hypothetical protein PHAVU_007G021300g [Phaseolus vulgaris]
 gb|ESW14834.1| hypothetical protein PHAVU_007G021300g [Phaseolus vulgaris]
Length=379

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
            ++LSW+  +  D  I+MVQ+R  S + CDFS GKWVFDQSYPLYD + CPYLSTAV+C K
Sbjct  32   DDLSWIAMESED--INMVQTRRDSWKKCDFSVGKWVFDQSYPLYD-SNCPYLSTAVTCQK  88

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGRPDSDY+KWKWKP+GC+IPRFDAL FLG+MR KRIMLVGDSIMRNQ
Sbjct  89   NGRPDSDYEKWKWKPNGCSIPRFDALGFLGKMRSKRIMLVGDSIMRNQ  136



>gb|KDP35804.1| hypothetical protein JCGZ_10440 [Jatropha curcas]
Length=376

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 5/117 (4%)
 Frame = +3

Query  276  ESSPYEIEE-LSWLDGDDHDDEISMVQSRH-ASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
            +SS + +E+ LSWL+  + D E++MVQ+RH +S  SCDF++GKWV+DQSYPLYD + CPY
Sbjct  20   KSSQFGLEDGLSWLN--EEDSEVNMVQTRHDSSSSSCDFTSGKWVYDQSYPLYDSS-CPY  76

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            LSTAV+C +NGRPDSDY+KW+WKP GC+IPRFDAL FLG+MRRKRIMLVGDSIMRNQ
Sbjct  77   LSTAVTCKRNGRPDSDYEKWRWKPHGCSIPRFDALNFLGKMRRKRIMLVGDSIMRNQ  133



>gb|ACU13130.1| unknown [Glycine max]
Length=165

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            DD++SM QS   S + CD S GKWV+D SYPLYD + CPYLS+AV+C +NGRPDSDY+KW
Sbjct  33   DDDVSMAQSNRDSRKRCDISVGKWVYDDSYPLYDSS-CPYLSSAVTCQRNGRPDSDYEKW  91

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            KWKP GCTIPRFDAL FLGRMRRKRIMLVGDSIMRNQ
Sbjct  92   KWKPSGCTIPRFDALRFLGRMRRKRIMLVGDSIMRNQ  128



>ref|XP_006445722.1| hypothetical protein CICLE_v10015623mg [Citrus clementina]
 ref|XP_006485201.1| PREDICTED: protein YLS7-like [Citrus sinensis]
 gb|ESR58962.1| hypothetical protein CICLE_v10015623mg [Citrus clementina]
Length=379

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 4/117 (3%)
 Frame = +3

Query  273  AESSPYEIE-ELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
             +SS + +E +  WL+  + D E++MVQSR  S R CDF++GKWV+D SYPLYD + CPY
Sbjct  23   GKSSQFGLETDEFWLN--EEDSEVNMVQSRRDSSRHCDFTSGKWVYDPSYPLYD-SNCPY  79

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            LSTAVSC KNGRPDSDYQKWKWKP  C+IPRFDAL+FL +MRRKRIMLVGDSIMRNQ
Sbjct  80   LSTAVSCQKNGRPDSDYQKWKWKPHACSIPRFDALKFLAKMRRKRIMLVGDSIMRNQ  136



>ref|XP_010088792.1| hypothetical protein L484_018353 [Morus notabilis]
 gb|EXB36975.1| hypothetical protein L484_018353 [Morus notabilis]
Length=376

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 5/117 (4%)
 Frame = +3

Query  273  AESSPYEIEE-LSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
             +SS +E++E  SWL     +DE  MVQS     R CDFS+GKWVFDQSYPLYD + CPY
Sbjct  21   GKSSEFEVDEDESWLS---EEDEAVMVQSGQNRQRRCDFSSGKWVFDQSYPLYD-SNCPY  76

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            LSTAV+C KNGRPDSDYQKW+WKP+GC+IPRF+AL+FL +M++KRIMLVGDSI+RNQ
Sbjct  77   LSTAVTCQKNGRPDSDYQKWRWKPNGCSIPRFNALKFLAKMKKKRIMLVGDSIVRNQ  133



>gb|KDO44402.1| hypothetical protein CISIN_1g017027mg [Citrus sinensis]
Length=379

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 4/117 (3%)
 Frame = +3

Query  273  AESSPYEIE-ELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
             +SS + +E +  WL+  + D E++MVQSR  S R CDF++GKWV+D SYPLYD + CPY
Sbjct  23   GKSSQFGLETDEFWLN--EEDSEVNMVQSRRDSSRHCDFTSGKWVYDPSYPLYD-SNCPY  79

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            LSTAVSC KNGRPDSDYQKWKWKP  C+IPRFDAL++L +MRRKRIMLVGDSIMRNQ
Sbjct  80   LSTAVSCQKNGRPDSDYQKWKWKPHACSIPRFDALKYLAKMRRKRIMLVGDSIMRNQ  136



>gb|KEH41400.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=375

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 1/96 (1%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            D++++VQ+   S + CDFS GKWV+D+SYPLYDP  CPYLSTAV+C KNGRPDSDY+KWK
Sbjct  38   DDVNIVQNNRNSSKRCDFSVGKWVYDESYPLYDP-NCPYLSTAVTCQKNGRPDSDYEKWK  96

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            WKP GC+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  97   WKPSGCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  132



>ref|XP_010271679.1| PREDICTED: protein trichome birefringence-like 36 [Nelumbo nucifera]
Length=380

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = +3

Query  270  CAESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
            C++SS   + + SWL+  DH  E++MVQ +  S+ SCD + GKWV+DQSYPLYD   CPY
Sbjct  26   CSQSS---LGKDSWLEEKDH--EVNMVQGQPTSMNSCDMTEGKWVYDQSYPLYDTT-CPY  79

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            LS  VSC +NGRPDSDY+KWKWKP GC+IPRFDAL+FL RMRRKRIMLVGDSIMRNQ
Sbjct  80   LSIPVSCRRNGRPDSDYEKWKWKPHGCSIPRFDALDFLARMRRKRIMLVGDSIMRNQ  136



>ref|XP_007010436.1| Trichome birefringence-like 36 [Theobroma cacao]
 gb|EOY19246.1| Trichome birefringence-like 36 [Theobroma cacao]
Length=375

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +3

Query  306  SWLDGDDHDDEISMVQSR-HASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNG  482
            SWL+ ++++D + MVQ+R   S   CDFS GKWV+DQSYPLYD + CPYLSTAV+C +NG
Sbjct  29   SWLNSEENED-VVMVQTRPQESHGRCDFSVGKWVYDQSYPLYD-SNCPYLSTAVTCQRNG  86

Query  483  RPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            RPDS Y+KWKWKP+GC++PRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  87   RPDSGYEKWKWKPNGCSLPRFDALKFLGKMRRKRIMLVGDSIMRNQ  132



>gb|KEH44322.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=369

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  270  CAESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
            CA S     +  SWL  ++ +D ++MVQ++  S + CDFS GKW+FDQ+YPLYD + CPY
Sbjct  24   CASSLINPEDVSSWLALEETED-VNMVQTQRDSWKKCDFSVGKWIFDQTYPLYD-SNCPY  81

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            L+TAV+C KNGRPDSDY+KWKWKP GC+IPRFDAL++LG+MR KR+MLVGDSIMRNQ
Sbjct  82   LTTAVTCQKNGRPDSDYEKWKWKPLGCSIPRFDALKYLGKMRGKRMMLVGDSIMRNQ  138



>gb|KEH44323.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=382

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  270  CAESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
            CA S     +  SWL  ++ +D ++MVQ++  S + CDFS GKW+FDQ+YPLYD + CPY
Sbjct  24   CASSLINPEDVSSWLALEETED-VNMVQTQRDSWKKCDFSVGKWIFDQTYPLYD-SNCPY  81

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            L+TAV+C KNGRPDSDY+KWKWKP GC+IPRFDAL++LG+MR KR+MLVGDSIMRNQ
Sbjct  82   LTTAVTCQKNGRPDSDYEKWKWKPLGCSIPRFDALKYLGKMRGKRMMLVGDSIMRNQ  138



>ref|XP_003555875.1| PREDICTED: protein YLS7-like [Glycine max]
Length=386

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
            +E SW D +  D  I++V++R  + + CD+S GKWVFDQSYPLYD + CPYLSTAV+C K
Sbjct  39   DEPSWTDMETED--INIVRTRRDTWKKCDYSVGKWVFDQSYPLYD-SNCPYLSTAVACQK  95

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGRPDSDY+KWKWKP GC+IPRFDAL FL +MRRKRIMLVGDSIMRNQ
Sbjct  96   NGRPDSDYEKWKWKPFGCSIPRFDALGFLSKMRRKRIMLVGDSIMRNQ  143



>gb|KHN11469.1| hypothetical protein glysoja_015364 [Glycine soja]
Length=386

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
            +E SW D +  D  I++V++R  + + CD+S GKWVFDQSYPLYD + CPYLSTAV+C K
Sbjct  39   DEPSWTDMETED--INIVRTRRDTWKKCDYSVGKWVFDQSYPLYD-SNCPYLSTAVACQK  95

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGRPDSDY+KWKWKP GC+IPRFDAL FL +MRRKRIMLVGDSIMRNQ
Sbjct  96   NGRPDSDYEKWKWKPFGCSIPRFDALGFLSKMRRKRIMLVGDSIMRNQ  143



>gb|ACU24162.1| unknown [Glycine max]
Length=386

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
            +E SW D +  D  I++V++R  + + CD+S GKWVFDQSYPLYD + CPYLSTAV+C K
Sbjct  39   DEPSWTDMETED--INIVRTRRDTWKKCDYSVGKWVFDQSYPLYD-SNCPYLSTAVACQK  95

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGRPDSDY+KWKWKP GC+IPRFDAL FL +MRRKRIMLVGDSIMRNQ
Sbjct  96   NGRPDSDYEKWKWKPFGCSIPRFDALGFLSKMRRKRIMLVGDSIMRNQ  143



>ref|XP_003535878.1| PREDICTED: protein YLS7 [Glycine max]
Length=382

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            DD++SM QS   S + CD S GKWV+D SYPLYD + CPYLS+AV+C +NGRPDSDY+KW
Sbjct  43   DDDVSMAQSNRDSRKRCDISVGKWVYDDSYPLYDSS-CPYLSSAVTCQRNGRPDSDYEKW  101

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            KWKP GCT+PRFDAL FLGRMRRKRIMLVGDSIMRNQ
Sbjct  102  KWKPSGCTMPRFDALRFLGRMRRKRIMLVGDSIMRNQ  138



>ref|XP_007145481.1| hypothetical protein PHAVU_007G242600g [Phaseolus vulgaris]
 gb|ESW17475.1| hypothetical protein PHAVU_007G242600g [Phaseolus vulgaris]
Length=380

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 7/112 (6%)
 Frame = +3

Query  303  LSWLDGDD------HDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAV  464
            LS LD +D        D++ MVQS   S + CDFS GKWV+D SYPLYD + CPYLS+ V
Sbjct  26   LSLLDPEDEVGILVQADDVEMVQSNRDSRKICDFSVGKWVYDDSYPLYD-SNCPYLSSVV  84

Query  465  SCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +C KNGRPDSDY+KWKWKP GCT+PRFDAL FLGRMRRKRIMLVGDS++RNQ
Sbjct  85   TCQKNGRPDSDYEKWKWKPTGCTLPRFDALRFLGRMRRKRIMLVGDSMIRNQ  136



>ref|XP_008446761.1| PREDICTED: protein trichome birefringence-like 36 [Cucumis melo]
Length=378

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
            ++ SWL   + DDE+ +VQS   S + CDFS GKW FD+SYPLYD + CPYLS+AV+C +
Sbjct  31   DDQSWLT--EEDDEVHIVQSGADSHKWCDFSDGKWSFDRSYPLYDSS-CPYLSSAVTCQR  87

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGRPDSDY+KWKWKP  C+IPRFDAL FLG+MRRKRIMLVGDSIMRNQ
Sbjct  88   NGRPDSDYEKWKWKPHSCSIPRFDALNFLGKMRRKRIMLVGDSIMRNQ  135



>ref|XP_008375566.1| PREDICTED: protein trichome birefringence-like 36 [Malus domestica]
Length=379

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +3

Query  339  ISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWK  518
            ++MVQS   S R C+ S GKWV+DQSYPLYD + CPYLSTAV+C KNGRPDSDY+KW+WK
Sbjct  44   VNMVQSHQNSRRRCELSDGKWVYDQSYPLYD-STCPYLSTAVTCQKNGRPDSDYEKWRWK  102

Query  519  PDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            P+ C+IPRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  103  PNSCSIPRFDALKFLGKMRRKRIMLVGDSIMRNQ  136



>gb|KJB78678.1| hypothetical protein B456_013G011800 [Gossypium raimondii]
Length=372

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = +3

Query  306  SWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNG  482
            SWL+ +D  + + MVQ R     + CDFS GKWV+DQSYPLYD + CPYLSTAV+C +NG
Sbjct  27   SWLNNED--NGVIMVQGRREDRPTRCDFSVGKWVYDQSYPLYD-SNCPYLSTAVTCQRNG  83

Query  483  RPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            RPDS Y+KWKWKP+GC++PRFDAL+FLG+MRRKRIMLVGDSIMRNQ
Sbjct  84   RPDSGYEKWKWKPNGCSLPRFDALKFLGKMRRKRIMLVGDSIMRNQ  129



>ref|XP_010032073.1| PREDICTED: protein trichome birefringence-like 36 [Eucalyptus 
grandis]
 gb|KCW51460.1| hypothetical protein EUGRSUZ_J00985 [Eucalyptus grandis]
Length=387

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLR-SCDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            E E+ SW    D +D + MVQSRH   R SCD STGKWV D+SYPLYD + CPYLS+ V+
Sbjct  38   EEEDSSW---PDEEDGVDMVQSRHDPRRQSCDMSTGKWVVDESYPLYD-SNCPYLSSTVT  93

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDSDYQKW+WKP  C++PRFDAL+FL ++RRKRIMLVGDSIMRNQ
Sbjct  94   CQRNGRPDSDYQKWRWKPHACSLPRFDALKFLAKIRRKRIMLVGDSIMRNQ  144



>ref|XP_004135033.1| PREDICTED: uncharacterized protein LOC101204429 [Cucumis sativus]
 ref|XP_004164142.1| PREDICTED: uncharacterized protein LOC101230513 [Cucumis sativus]
 gb|KGN52192.1| hypothetical protein Csa_5G614680 [Cucumis sativus]
Length=378

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
            ++ SWL   + DDE+ +VQS   S R CDFS GKW FD+SYPLYD + CPYLS+AV+C +
Sbjct  31   DDQSWLT--EEDDEVHIVQSGADSHRRCDFSDGKWSFDRSYPLYDSS-CPYLSSAVACQR  87

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGRPDSDY+KWKWKP  C+I RFDAL FLG+MR KRIMLVGDSIMRNQ
Sbjct  88   NGRPDSDYEKWKWKPHSCSIRRFDALNFLGKMRSKRIMLVGDSIMRNQ  135



>ref|XP_004514721.1| PREDICTED: uncharacterized protein LOC101494450 [Cicer arietinum]
Length=388

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
            +E+ +L   D+ +  +M+Q +  S + CDFS GKWV+D+SYPLYDP  CPYLSTAV+C  
Sbjct  38   DEVGFLVQPDYVNN-NMLQMKRDSRKRCDFSVGKWVYDESYPLYDP-NCPYLSTAVACQI  95

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGRPDSDY+KWKW+P+ C+IPRFDAL FLG+MRRKRIMLVGDSIMRNQ
Sbjct  96   NGRPDSDYEKWKWRPNDCSIPRFDALRFLGKMRRKRIMLVGDSIMRNQ  143



>ref|XP_010907119.1| PREDICTED: protein trichome birefringence-like 36 [Elaeis guineensis]
Length=389

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  321  DDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            +  DDE++ VQS+H   R CD S G+WVFD SYPLY+P  CPYLS  VSC +NGRPDSDY
Sbjct  47   EKEDDEVNEVQSQHTLSRDCDLSVGEWVFDASYPLYEP-NCPYLSNQVSCRRNGRPDSDY  105

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +KW+WKP  C+IPRF+AL FLGR+R+KR+MLVGDS+MRNQ
Sbjct  106  EKWRWKPQQCSIPRFNALAFLGRIRKKRVMLVGDSMMRNQ  145



>gb|KHN09736.1| hypothetical protein glysoja_049465 [Glycine soja]
Length=335

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  345  MVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPD  524
            M QS   S + CD S GKWV+D SYPLYD + CPYLS+AV+C +NGRPDSDY+KWKWKP 
Sbjct  1    MAQSNRDSRKRCDISVGKWVYDDSYPLYDSS-CPYLSSAVTCQRNGRPDSDYEKWKWKPS  59

Query  525  GCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            GCT+PRFDAL FLGRMRRKRIMLVGDSIMRNQ
Sbjct  60   GCTMPRFDALRFLGRMRRKRIMLVGDSIMRNQ  91



>ref|XP_010536307.1| PREDICTED: protein trichome birefringence-like 36 [Tarenaya hassleriana]
Length=391

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +3

Query  285  PYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAV  464
            P E  +  WL G+D  D IS +Q+R      CD+S GKW +D SYPLYD + CPYLS+AV
Sbjct  35   PKERFDELWLPGED--DPISALQTRRERREGCDYSVGKWTYDPSYPLYD-SDCPYLSSAV  91

Query  465  SCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            SC +NGRPDS+YQKW+W+P  C++PRFDAL FLG+MRRKRIMLVGDSIMRNQ
Sbjct  92   SCQRNGRPDSNYQKWRWRPKACSVPRFDALGFLGKMRRKRIMLVGDSIMRNQ  143



>ref|XP_008784007.1| PREDICTED: protein trichome birefringence-like 36 [Phoenix dactylifera]
Length=389

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            ++++ + W + +  DD ++ VQS+H   R+CD S G+W FD SYPLY+P  CPYL   VS
Sbjct  37   FDMDSVEWTE-EKEDDGVNEVQSQHTLSRACDLSVGEWAFDASYPLYNPD-CPYLVNQVS  94

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDSDY+KW+WKP  C+IPRFDAL FLGR+R+KR+MLVGDSIMR+Q
Sbjct  95   CRRNGRPDSDYEKWRWKPQQCSIPRFDALGFLGRIRKKRVMLVGDSIMRSQ  145



>ref|XP_009139251.1| PREDICTED: protein trichome birefringence-like 36 [Brassica rapa]
Length=378

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 3/111 (3%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            +++EL WL GDD DD +  +Q+RH      CD+S GKW +D++YPLYD + CPYLS+A+S
Sbjct  24   QLDEL-WLVGDDDDDPLRALQTRHERREEKCDYSLGKWSYDETYPLYD-SNCPYLSSALS  81

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS YQKW+W P  C++ RFDAL+FLG+MR+KRIMLVGDSIMRNQ
Sbjct  82   CQRNGRPDSYYQKWRWVPKSCSLSRFDALKFLGKMRQKRIMLVGDSIMRNQ  132



>ref|XP_006391872.1| hypothetical protein EUTSA_v10023527mg [Eutrema salsugineum]
 gb|ESQ29158.1| hypothetical protein EUTSA_v10023527mg [Eutrema salsugineum]
Length=378

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 3/111 (3%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            +++EL WL GDD DD ++ +Q+R A     CD+S GKW +D++YPLYD + CPYLS+A+S
Sbjct  24   QLDEL-WLVGDDDDDPLNALQTRRAKREEKCDYSVGKWSYDETYPLYD-SNCPYLSSALS  81

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS YQKW+W P  C++ RFDAL+FLG+MR+KRIMLVGDSIMRNQ
Sbjct  82   CQRNGRPDSYYQKWRWIPKSCSLSRFDALKFLGKMRQKRIMLVGDSIMRNQ  132



>ref|XP_010515948.1| PREDICTED: protein trichome birefringence-like 36 [Camelina sativa]
Length=399

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +3

Query  270  CAESSPYEIEELSWLDGDDHDDEISMVQSRHA-SLRSCDFSTGKWVFDQSYPLYDPARCP  446
            C E+  +  E+  WL GDD  D ++ +Q+R   S   CD+S GKW +D++YPLYD   CP
Sbjct  37   CKEALSHFDEQ--WLVGDD--DPLNALQTRRERSEERCDYSVGKWTYDETYPLYDSGSCP  92

Query  447  YLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            YLS+A+SC +NGRPDS+YQKW+W P  C++PRF+AL+FLG+MR KRIMLVGD+IMRNQ
Sbjct  93   YLSSALSCQRNGRPDSNYQKWRWVPKACSLPRFNALKFLGKMRGKRIMLVGDTIMRNQ  150



>ref|XP_006291297.1| hypothetical protein CARUB_v10017432mg [Capsella rubella]
 gb|EOA24195.1| hypothetical protein CARUB_v10017432mg [Capsella rubella]
Length=381

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            +I EL WL  DD  D ++ +Q+R       CD+S GKW +D++YPLYD + CPY+S+A+S
Sbjct  24   QINEL-WLVDDD--DPVNALQTRRERREERCDYSVGKWTYDETYPLYDSSSCPYMSSALS  80

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS+YQKW+W P GC++PRFDAL+FLG+MR KRIMLVGDSIMRNQ
Sbjct  81   CQRNGRPDSNYQKWRWMPKGCSLPRFDALKFLGKMRGKRIMLVGDSIMRNQ  131



>ref|XP_010912275.1| PREDICTED: protein trichome birefringence-like 36 [Elaeis guineensis]
Length=388

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSC  470
            ++  + W + +  DDE + +QS+H   R CD S GKWVFD SYPLY+P  CPY+   VSC
Sbjct  37   DMNSIEWTE-EREDDEANEIQSQHTMSRDCDLSAGKWVFDASYPLYNPD-CPYIINQVSC  94

Query  471  SKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             +NGRPD DY+KW+W+P  C+IPRF+AL+FLGR+R+KR+MLVGDSIMR+Q
Sbjct  95   QRNGRPDLDYEKWRWQPQQCSIPRFNALDFLGRIRKKRVMLVGDSIMRSQ  144



>ref|XP_009404370.1| PREDICTED: protein trichome birefringence-like 36 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +3

Query  321  DDHDDEISMVQSRHASL-RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSD  497
            ++ +D+++ VQS   S  R C+ S G+WVFD SYPLY P  CPYLST VSC +NGRPDSD
Sbjct  17   EEKEDDVNEVQSHQGSSPRDCNLSVGEWVFDPSYPLYAPG-CPYLSTQVSCRRNGRPDSD  75

Query  498  YQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            Y++W+WKP  C+IPRFDAL+FLGR+R+KR+MLVGDSI+RNQ
Sbjct  76   YERWRWKPKQCSIPRFDALDFLGRIRKKRVMLVGDSIIRNQ  116



>ref|XP_008790903.1| PREDICTED: protein trichome birefringence-like 36 [Phoenix dactylifera]
Length=446

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 82/101 (81%), Gaps = 2/101 (2%)
 Frame = +3

Query  321  DDHDDEIS-MVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSD  497
            +  DDE++  VQS+    R CD S G+WVFD SYPLY+P  CPYLS  +SC +NGRPDSD
Sbjct  101  EKEDDEVNDEVQSQRTLSRDCDLSVGEWVFDASYPLYEP-NCPYLSNQLSCRRNGRPDSD  159

Query  498  YQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            Y+KW+WKP  C+IPRF+AL+FLGR+R+KR+MLVGDSIMRNQ
Sbjct  160  YEKWRWKPHRCSIPRFNALDFLGRIRKKRVMLVGDSIMRNQ  200



>gb|KFK34680.1| hypothetical protein AALP_AA5G177300 [Arabis alpina]
Length=384

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 89/113 (79%), Gaps = 5/113 (4%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLR-SCDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            +++EL WL GD+ DD ++ +Q+RH      CD+  GKW +D++YPLYD + CPYLS+ +S
Sbjct  24   QLDEL-WLVGDEDDDPLNALQTRHERREEQCDYLVGKWTYDETYPLYD-SNCPYLSSTLS  81

Query  468  CSKNGRPDSDYQKWKWKPDG--CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS YQKW+W P    C++PRFDAL+FLG+MR+KRIMLVGDSIMRNQ
Sbjct  82   CQRNGRPDSYYQKWRWTPKAKACSLPRFDALKFLGKMRKKRIMLVGDSIMRNQ  134



>ref|XP_002877964.1| hypothetical protein ARALYDRAFT_485823 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54223.1| hypothetical protein ARALYDRAFT_485823 [Arabidopsis lyrata subsp. 
lyrata]
Length=379

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASL-RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            + +EL WL GDD  D ++ +Q+R       CD+S GKW++D++YPLYD + CPYLS+A+S
Sbjct  24   QFDEL-WLVGDD--DPLNALQTRRERRGERCDYSVGKWMYDETYPLYDSS-CPYLSSALS  79

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS YQKW+W P  C++PRFDAL+FLG+MR KRIMLVGDSIMRNQ
Sbjct  80   CQRNGRPDSYYQKWRWIPKACSLPRFDALKFLGKMRGKRIMLVGDSIMRNQ  130



>ref|XP_006836042.1| hypothetical protein AMTR_s00114p00046060 [Amborella trichopoda]
 gb|ERM98895.1| hypothetical protein AMTR_s00114p00046060 [Amborella trichopoda]
Length=403

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGC  530
            QS+    ++CD+S GKWVFD SYPLYD A CPY+S  VSC KNGRPDS Y+KW+WKP GC
Sbjct  70   QSKKTFRQTCDYSVGKWVFDPSYPLYD-ASCPYISGRVSCRKNGRPDSVYEKWRWKPQGC  128

Query  531  TIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +I RF+AL FLG+MRRKRIMLVGDSIMRNQ
Sbjct  129  SITRFNALAFLGKMRRKRIMLVGDSIMRNQ  158



>ref|XP_006403597.1| hypothetical protein EUTSA_v10010451mg [Eutrema salsugineum]
 gb|ESQ45050.1| hypothetical protein EUTSA_v10010451mg [Eutrema salsugineum]
Length=381

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            +++EL WL GDD DD ++ +Q+R       CD+S GKW +D++YPLYD + CPYLS+ +S
Sbjct  24   QLDEL-WLVGDD-DDPLNALQTRRERREEKCDYSVGKWTYDETYPLYD-SNCPYLSSTLS  80

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS YQKW+W P  C++ RFDAL+FLG+MR+KRIMLVGDS+MRNQ
Sbjct  81   CQRNGRPDSYYQKWRWIPKACSLSRFDALKFLGKMRKKRIMLVGDSMMRNQ  131



>ref|XP_010504228.1| PREDICTED: protein trichome birefringence-like 36 [Camelina sativa]
Length=380

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  324  DHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            D DD ++ +Q+R       CD+S GKW +D++YPLYD   CPYLS+A+SC +NGRPDS+Y
Sbjct  32   DDDDPLNALQTRRERREERCDYSVGKWTYDETYPLYDSGSCPYLSSALSCQRNGRPDSNY  91

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            QKW+W P  C++PRF+AL+FLG+MR KRIMLVGD+IMRNQ
Sbjct  92   QKWRWVPKACSLPRFNALKFLGKMRGKRIMLVGDTIMRNQ  131



>ref|XP_010427099.1| PREDICTED: protein trichome birefringence-like 36 [Camelina sativa]
Length=380

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  324  DHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            D DD ++ +Q+R       CD+S GKW +D++YPLYD   CPYLS+A+SC +NGRPDS+Y
Sbjct  32   DDDDPLNALQTRRERREERCDYSVGKWTYDETYPLYDSGSCPYLSSALSCQRNGRPDSNY  91

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            QKW+W P  C++PRF+AL+FLG+MR KRIMLVGD+IMRNQ
Sbjct  92   QKWRWVPKACSLPRFNALKFLGKMRGKRIMLVGDTIMRNQ  131



>ref|NP_566996.1| protein TRICHOME BIREFRINGENCE-LIKE 36 [Arabidopsis thaliana]
 sp|Q940H3.1|TBL36_ARATH RecName: Full=Protein trichome birefringence-like 36 [Arabidopsis 
thaliana]
 gb|AAK96825.1| putative protein [Arabidopsis thaliana]
 gb|AAM10080.1| putative protein [Arabidopsis thaliana]
 gb|AEE79205.1| protein trichome birefringence-like 36 [Arabidopsis thaliana]
Length=379

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            + +EL WL GDD  D ++ +Q+R       CD+S GKW FD++YPLYD + CPYLS+A+S
Sbjct  24   QFDEL-WLVGDD--DPLNALQTRRERREERCDYSVGKWTFDETYPLYDSS-CPYLSSALS  79

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS YQKW+W P  C++PRFDAL+FLG+MR KRIMLVGDS+MRNQ
Sbjct  80   CQRNGRPDSYYQKWRWIPKACSLPRFDALKFLGKMRGKRIMLVGDSMMRNQ  130



>emb|CDX76156.1| BnaA04g04200D [Brassica napus]
Length=372

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 9/111 (8%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            +++EL WL GDD DD +  +Q+RH      CD+S GKW +D++YPLYD + CPYLS+A+S
Sbjct  24   QLDEL-WLVGDDDDDPLRALQTRHERREEKCDYSLGKWSYDETYPLYD-SNCPYLSSALS  81

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +NGRPDS YQKW+W      +P+FDAL+FLG+MR+KRIMLVGDSIMRNQ
Sbjct  82   CQRNGRPDSYYQKWRW------VPKFDALKFLGKMRQKRIMLVGDSIMRNQ  126



>emb|CDY65398.1| BnaCnng46890D [Brassica napus]
Length=380

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            +++EL WL GDD DD +  +Q+RH      CD+S GKW +D++YPLYD + CPYLS+A+S
Sbjct  25   QLDEL-WLVGDDDDDPLRALQTRHERREEKCDYSVGKWSYDETYPLYD-SNCPYLSSALS  82

Query  468  CSKNGRPDSDYQKWKWKPDGCTIP-RFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C KNGRPDS YQKW+W      +  RFDAL+FLG MR+KRIMLVGDSIMRNQ
Sbjct  83   CQKNGRPDSYYQKWRWLSLIVDVGFRFDALKFLGEMRQKRIMLVGDSIMRNQ  134



>emb|CAB71000.1| putative protein [Arabidopsis thaliana]
Length=408

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 87/142 (61%), Gaps = 36/142 (25%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVS  467
            + +EL WL GDD  D ++ +Q+R       CD+S GKW FD++YPLYD + CPYLS+A+S
Sbjct  24   QFDEL-WLVGDD--DPLNALQTRRERREERCDYSVGKWTFDETYPLYDSS-CPYLSSALS  79

Query  468  CSKNGRPDSDYQKWKWKPDGCTIPR-------------------------------FDAL  554
            C +NGRPDS YQKW+W P  C++PR                               FDAL
Sbjct  80   CQRNGRPDSYYQKWRWIPKACSLPRHTPHSSYFLHYFFLKFLSHQVKKLVYIGFAWFDAL  139

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FLG+MR KRIMLVGDS+MRNQ
Sbjct  140  KFLGKMRGKRIMLVGDSMMRNQ  161



>emb|CDP03007.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  339  ISMVQSRHASL-RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKW  515
            +S + S   +L + CDF  GKWV D+ YP+Y P  CPY+  A  C  NGRPDS+Y KW+W
Sbjct  221  VSEIYSEDFALWKGCDFYKGKWVKDEQYPIYRPGSCPYVDEAFDCQSNGRPDSEYLKWRW  280

Query  516  KPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            KPDGC +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  281  KPDGCDLPRFNATDFLVRLRGKRLMLVGDSMNRNQ  315



>gb|EPS60512.1| hypothetical protein M569_14291 [Genlisea aurea]
Length=501

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +3

Query  273  AESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYL  452
             E + Y +E+      D  D+   + +     L +C+F  GKW+ D SYPLY P  CPY+
Sbjct  126  GEKTEYSVEKA--FSADTADNVAIIDKLFLQKLMNCEFYRGKWIIDDSYPLYTPGSCPYV  183

Query  453  STAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
              A  C  NGRPDS Y KW+WKPD C +PRFDA++FL R+R KR++LVGDS+ RNQ
Sbjct  184  DEAYDCQNNGRPDSGYLKWRWKPDECDLPRFDAVDFLVRLRGKRLLLVGDSMNRNQ  239



>gb|KJB82732.1| hypothetical protein B456_013G211200 [Gossypium raimondii]
Length=414

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            D    + + H +   CD  TG WV D  YP+Y P  CPY+  A  C  NGRPDSDY +W+
Sbjct  56   DGNQTLDTAHENREMCDLYTGTWVKDDDYPIYKPGSCPYVDEAFDCQSNGRPDSDYLRWR  115

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            WKPDGC +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  116  WKPDGCDLPRFNATDFLERLRGKRLMLVGDSMNRNQ  151



>ref|XP_006845734.1| hypothetical protein AMTR_s00019p00245310 [Amborella trichopoda]
 gb|ERN07409.1| hypothetical protein AMTR_s00019p00245310 [Amborella trichopoda]
Length=300

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
             ++  CD  TGKWV    YPLY P  CPY+  A SC +N RPD DY  W+WKPDGC IPR
Sbjct  47   GAMEKCDIYTGKWVKADDYPLYPPGSCPYVDEAFSCQENRRPDVDYLNWRWKPDGCEIPR  106

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+A++FL R+R KR+MLVGDS+ RNQ
Sbjct  107  FNAIDFLERIRGKRLMLVGDSMNRNQ  132



>gb|KHG05807.1| Pyridoxal-phosphate-dependent serine hydroxymethyltransferase 
[Gossypium arboreum]
Length=412

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            D    + + H +   CD  TG WV D  YP+Y P  CPY+  A  C  NGRPDS+Y +W+
Sbjct  56   DGNQTLDTAHENREMCDLYTGTWVKDDDYPIYKPGSCPYVDEAFDCQSNGRPDSNYLRWR  115

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            WKPDGC +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  116  WKPDGCDLPRFNATDFLERLRGKRLMLVGDSMNRNQ  151



>ref|XP_010535816.1| PREDICTED: protein trichome birefringence-like 5 [Tarenaya hassleriana]
Length=508

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 0/103 (0%)
 Frame = +3

Query  312  LDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPD  491
            ++G +  D  S+       +R CD   G WV D  YPLY P  CPY+  A  C +NGR D
Sbjct  139  VEGKEESDAKSVDMEVVEKMRGCDLYKGTWVKDDQYPLYQPGSCPYVDEAFDCQRNGRRD  198

Query  492  SDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            SDY +W+WKPD C +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  199  SDYLQWRWKPDDCDLPRFNATDFLARLRGKRLMLVGDSMNRNQ  241



>gb|ABK26918.1| unknown [Picea sitchensis]
Length=216

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD  TG WV D SYPLYD   CPYL+   +C  NGRPDSDY+KW+WKP  C IPRF+AL+
Sbjct  103  CDIFTGSWVHDLSYPLYDSRTCPYLNGGATCQMNGRPDSDYEKWRWKPRDCNIPRFNALD  162

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
             L R++ K IM VGDS+  NQ
Sbjct  163  LLQRLKGKTIMFVGDSLSNNQ  183



>ref|XP_010046898.1| PREDICTED: protein trichome birefringence-like 5 [Eucalyptus 
grandis]
 gb|KCW78607.1| hypothetical protein EUGRSUZ_C00073 [Eucalyptus grandis]
Length=480

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            SL  CD   G W  D+ YP+Y P  CP++  A  C  NGRPDSDY KW+WKPDGC +PRF
Sbjct  128  SLEKCDLYMGSWEKDEEYPIYAPGSCPFVDEAFDCQNNGRPDSDYLKWRWKPDGCDLPRF  187

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R+R KR+MLVGDS+ RNQ
Sbjct  188  NATDFLVRLRGKRLMLVGDSMNRNQ  212



>gb|KDP35862.1| hypothetical protein JCGZ_10642 [Jatropha curcas]
Length=539

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            ++CD   G WV DQ YP+Y P +CPY+  A  C  NGR DSDY  W+WKPDGC +PRF+A
Sbjct  191  KNCDLYMGTWVKDQEYPIYKPGQCPYVDEAFDCEINGRRDSDYLSWRWKPDGCDLPRFNA  250

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R+R KR+MLVGDS+ RNQ
Sbjct  251  TDFLTRLRGKRLMLVGDSMNRNQ  273



>gb|EYU37306.1| hypothetical protein MIMGU_mgv1a022803mg, partial [Erythranthe 
guttata]
Length=505

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +3

Query  369  LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            LR+CD   GKWV D  YP Y P  CPY+     C  NGRPDSDY KW+W+PD C +PRF+
Sbjct  160  LRNCDVYKGKWVRDDVYPHYQPGSCPYVDDGFDCQGNGRPDSDYLKWRWQPDDCDLPRFN  219

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            A +FL R+R KR+MLVGDS+ RNQ
Sbjct  220  ATDFLVRLRGKRLMLVGDSMNRNQ  243



>ref|XP_007014486.1| Trichome birefringence-like 5 isoform 1 [Theobroma cacao]
 gb|EOY32105.1| Trichome birefringence-like 5 isoform 1 [Theobroma cacao]
Length=460

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            D  ++V +       CD  TG WV D+ YP+Y P  CPY+  A  C  NGR DSDY +W+
Sbjct  102  DNEAVVDNGEEKREMCDLYTGTWVKDEEYPVYKPGSCPYVDEAFDCQSNGRQDSDYLRWR  161

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            WKPDGC +PRF+A + L R+R KR+MLVGDS+ RNQ
Sbjct  162  WKPDGCDLPRFNATDLLERLRGKRLMLVGDSMNRNQ  197



>ref|XP_002268396.1| PREDICTED: protein trichome birefringence-like 5 [Vitis vinifera]
Length=565

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            ++CD   G WV D+ YP+Y P  CPY+  A SC  NGR DS Y KW+WKPDGC +PRF+A
Sbjct  219  KNCDLYMGTWVKDEEYPIYSPGSCPYVDEAFSCQGNGRSDSKYLKWRWKPDGCDLPRFNA  278

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R+R KR+MLVGDS+ RNQ
Sbjct  279  TDFLVRLRGKRLMLVGDSMNRNQ  301



>ref|XP_006840447.1| hypothetical protein AMTR_s00045p00169080 [Amborella trichopoda]
 gb|ERN02122.1| hypothetical protein AMTR_s00045p00169080 [Amborella trichopoda]
Length=419

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            + CD  TGKWVFD++YPLY  A CP++    +C  NGRPD DY KW+W+P GC+IPRF A
Sbjct  74   KECDIYTGKWVFDETYPLYSTASCPFIDDGFNCEANGRPDRDYMKWRWQPRGCSIPRFSA  133

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
            +  L  +R KR++ VGDSI RNQ
Sbjct  134  VNMLKLLRGKRLVFVGDSINRNQ  156



>gb|KJB22002.1| hypothetical protein B456_004G024900 [Gossypium raimondii]
Length=489

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            ++CD  TG WV D+ YP+Y P  CPY+  A  C  NGR D DY +W+WKPDGC +PRF+A
Sbjct  147  KTCDLYTGTWVRDEEYPIYKPGSCPYVDDAFDCHGNGRKDYDYLRWRWKPDGCDLPRFNA  206

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R+R KR+MLVGDS+ RNQ
Sbjct  207  TDFLERLRGKRLMLVGDSMNRNQ  229



>gb|KJB22001.1| hypothetical protein B456_004G024900 [Gossypium raimondii]
Length=487

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            ++CD  TG WV D+ YP+Y P  CPY+  A  C  NGR D DY +W+WKPDGC +PRF+A
Sbjct  147  KTCDLYTGTWVRDEEYPIYKPGSCPYVDDAFDCHGNGRKDYDYLRWRWKPDGCDLPRFNA  206

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R+R KR+MLVGDS+ RNQ
Sbjct  207  TDFLERLRGKRLMLVGDSMNRNQ  229



>ref|XP_002324663.2| hypothetical protein POPTR_0018s13290g [Populus trichocarpa]
 gb|EEF03228.2| hypothetical protein POPTR_0018s13290g [Populus trichocarpa]
Length=501

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
            ASL+SCD   G WV D+ YP+Y+   CPY+  A  C  NGR DSDY KW+WKP  C +PR
Sbjct  151  ASLKSCDLYMGTWVKDEEYPIYEAGSCPYVDEAFDCQGNGRKDSDYLKWRWKPYDCDLPR  210

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  211  FNATDFLTRLRGKRLMLVGDSMNRNQ  236



>gb|KJB22003.1| hypothetical protein B456_004G024900 [Gossypium raimondii]
Length=490

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            ++CD  TG WV D+ YP+Y P  CPY+  A  C  NGR D DY +W+WKPDGC +PRF+A
Sbjct  147  KTCDLYTGTWVRDEEYPIYKPGSCPYVDDAFDCHGNGRKDYDYLRWRWKPDGCDLPRFNA  206

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R+R KR+MLVGDS+ RNQ
Sbjct  207  TDFLERLRGKRLMLVGDSMNRNQ  229



>ref|XP_011017737.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
5 [Populus euphratica]
Length=521

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = +3

Query  291  EIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSC  470
             +E  + L+G+D D  +        SL+SCD   G WV D+ YP+Y+   CPY+  A  C
Sbjct  134  NLESGADLNGNDDDKLME-------SLKSCDLYMGTWVKDEEYPIYEAGSCPYVDEAFDC  186

Query  471  SKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
              NGR DSDY KW+WKP  C +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  187  QGNGRKDSDYLKWRWKPYDCDLPRFNATDFLTRLRGKRLMLVGDSVNRNQ  236



>gb|KHG14015.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=489

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            +CD  TG WV D+ YP+Y P  CPY+  A  C  NGR D DY +W+WKPDGC +PRF+A 
Sbjct  148  TCDLYTGTWVRDEEYPIYKPGSCPYVDEAFDCHGNGRKDYDYLRWRWKPDGCDLPRFNAT  207

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R+R KR+MLVGDS+ RNQ
Sbjct  208  DFLERLRGKRLMLVGDSMNRNQ  229



>ref|XP_011020096.1| PREDICTED: protein trichome birefringence-like 5 [Populus euphratica]
Length=494

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            SL+SCD   G WV D+ YP+Y    CPY+  A  C  NGR DSDY KW+WKP+ C +PRF
Sbjct  150  SLKSCDLYRGTWVKDEEYPIYKAGSCPYVDEAFDCQGNGRKDSDYLKWRWKPNDCDLPRF  209

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R+R KR+MLVGDS+ RNQ
Sbjct  210  NATDFLTRLRGKRLMLVGDSMNRNQ  234



>ref|XP_002308095.2| hypothetical protein POPTR_0006s07090g [Populus trichocarpa]
 gb|EEE91618.2| hypothetical protein POPTR_0006s07090g [Populus trichocarpa]
Length=495

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            SL+SCD   G WV D+ YP+Y    CPY+  A  C  NGR DSDY KW+WKP+ C +PRF
Sbjct  151  SLKSCDLYRGTWVKDEEYPIYKAGSCPYVDEAFDCQGNGRKDSDYLKWRWKPNDCDLPRF  210

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R+R KR+MLVGDS+ RNQ
Sbjct  211  NATDFLTRLRGKRLMLVGDSMNRNQ  235



>ref|XP_006846293.1| hypothetical protein AMTR_s00012p00251740 [Amborella trichopoda]
 gb|ERN07968.1| hypothetical protein AMTR_s00012p00251740 [Amborella trichopoda]
Length=394

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +3

Query  336  EISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKW  515
            E +MV    A L  C+   G+WVFD+SYPLY    CPY+S+ V+C  NGRPDSDYQKW+W
Sbjct  49   EENMVSEGSAEL--CNIFNGRWVFDESYPLYSSQSCPYISSRVNCKYNGRPDSDYQKWRW  106

Query  516  KPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRN  617
            +PD C +PRFD  + L  +R KR+M+VGDS+ R+
Sbjct  107  QPDTCNVPRFDGEKLLEGLRGKRLMIVGDSLDRS  140



>ref|XP_010999799.1| PREDICTED: protein trichome birefringence-like 30 [Populus euphratica]
Length=428

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 6/103 (6%)
 Frame = +3

Query  330  DDEISMVQSRHASLRS-----CDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPD  491
            D E+ ++  +   LRS     CD  TGKWVFD +++PLY    CPY+   +SC+KNGRPD
Sbjct  62   DKEVFVLTKQVEKLRSKTKDSCDIFTGKWVFDNKTHPLYREDECPYIQQWISCTKNGRPD  121

Query  492  SDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            S YQ W+W+P GC++P+F+A  FL ++R KR+M VGDSI +NQ
Sbjct  122  SMYQSWRWQPKGCSLPKFNAKLFLEKLRGKRLMFVGDSIHQNQ  164



>ref|XP_011069938.1| PREDICTED: protein trichome birefringence-like 5 [Sesamum indicum]
Length=558

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +3

Query  369  LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            L +CD   GKWV D+ YPLY P  CPY+  A  C  NGRPD  Y KW+WKPD C +PRF+
Sbjct  209  LGNCDIYKGKWVRDEGYPLYRPGSCPYVDEAFDCLSNGRPDYGYLKWRWKPDDCDLPRFN  268

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            A +FL R+R KR+MLVGDS+ RNQ
Sbjct  269  ATDFLVRLRGKRLMLVGDSMNRNQ  292



>gb|KHN22642.1| hypothetical protein glysoja_027530 [Glycine soja]
Length=464

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            SL+ CD  TG WV D+SYP+Y P  CPY+  A  C  NGR D+ Y  W+WKPD C +PRF
Sbjct  114  SLKECDLFTGTWVKDESYPIYQPGSCPYVDEAYDCKVNGRTDTLYSNWRWKPDACDLPRF  173

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R++ KR+MLVGDS+ RNQ
Sbjct  174  NATDFLVRLKGKRLMLVGDSMNRNQ  198



>ref|XP_008223825.1| PREDICTED: protein trichome birefringence-like 5 [Prunus mume]
Length=497

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CD   G WV D+ YPLY P+ CPY+  A  C  NGR DS+Y KW+WKP+GC +PRF+A 
Sbjct  147  GCDLYLGTWVKDEHYPLYKPSSCPYVDEAFDCQSNGRSDSEYLKWRWKPEGCDLPRFNAT  206

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R+R KR+MLVGDS+ RNQ
Sbjct  207  DFLVRLRGKRLMLVGDSMNRNQ  228



>ref|XP_007222250.1| hypothetical protein PRUPE_ppa004735mg [Prunus persica]
 gb|EMJ23449.1| hypothetical protein PRUPE_ppa004735mg [Prunus persica]
Length=494

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CD   G WV D+ YPLY P+ CPY+  A  C  NGR DS+Y KW+WKP+GC +PRF+A 
Sbjct  144  GCDLYLGTWVKDEHYPLYKPSSCPYVDEAFDCQSNGRSDSEYLKWRWKPEGCDLPRFNAT  203

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R+R KR+MLVGDS+ RNQ
Sbjct  204  DFLVRLRGKRLMLVGDSMNRNQ  225



>ref|XP_004299786.1| PREDICTED: protein trichome birefringence-like 5 [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD   G WV D+ YPLY P  CP++  A  C  NGR DS+Y KW+WKPDGC +PRF+A +
Sbjct  151  CDLYAGTWVRDEQYPLYKPGSCPHVDEAFDCQSNGRGDSEYLKWRWKPDGCDLPRFNATD  210

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            FL R+R KR+MLVGDS+ RNQ
Sbjct  211  FLVRLRGKRLMLVGDSMNRNQ  231



>ref|XP_002311234.2| hypothetical protein POPTR_0008s070202g, partial [Populus trichocarpa]
 gb|EEE88601.2| hypothetical protein POPTR_0008s070202g, partial [Populus trichocarpa]
Length=316

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 6/103 (6%)
 Frame = +3

Query  330  DDEISMVQSRHASLRS-----CDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPD  491
            D E+ +   +   LRS     CD  TGKWVFD +++PLY    CPY+   +SC+KNGRPD
Sbjct  62   DKEVFVSTKQVEKLRSEPKDSCDIFTGKWVFDNKTHPLYREDECPYIQQWISCTKNGRPD  121

Query  492  SDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            S YQ W+W+P GC++P+F+A  FL ++R KR+M VGDSI +NQ
Sbjct  122  SMYQSWRWQPKGCSLPKFNAKLFLEKLRGKRLMFVGDSIHQNQ  164



>ref|XP_003541536.1| PREDICTED: protein YLS7-like [Glycine max]
Length=464

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            SL+ CD  TG WV D+SYP+Y P  CPY+  A  C  NGR D+ Y  W+WKPD C +PRF
Sbjct  114  SLKVCDLFTGTWVKDESYPIYQPGSCPYVDEAYDCKVNGRTDTLYSNWRWKPDACDLPRF  173

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R++ KR+MLVGDS+ RNQ
Sbjct  174  NATDFLVRLKGKRLMLVGDSMNRNQ  198



>ref|XP_006474304.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=490

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 1/100 (1%)
 Frame = +3

Query  321  DDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            D+H++    V     +  +CD   G WV D+ YP+Y P  CPY+  A  C  NGR DS Y
Sbjct  125  DNHNNNNGDVSFERVN-GACDLYMGSWVKDEGYPVYRPGSCPYVDEAFDCQMNGRRDSSY  183

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             +W+WKPDGC +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  184  LRWRWKPDGCDLPRFNATDFLERLRGKRLMLVGDSMNRNQ  223



>ref|XP_006453211.1| hypothetical protein CICLE_v10008256mg [Citrus clementina]
 gb|ESR66451.1| hypothetical protein CICLE_v10008256mg [Citrus clementina]
Length=454

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 1/100 (1%)
 Frame = +3

Query  321  DDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            D+H++    V     +  +CD   G WV D+ YP+Y P  CPY+  A  C  NGR DS Y
Sbjct  89   DNHNNNNGDVSFERVN-GACDLYMGSWVKDEGYPVYRPGSCPYVDEAFDCQMNGRRDSSY  147

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             +W+WKPDGC +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  148  LRWRWKPDGCDLPRFNATDFLERLRGKRLMLVGDSMNRNQ  187



>ref|XP_006400622.1| hypothetical protein EUTSA_v10013361mg [Eutrema salsugineum]
 gb|ESQ42075.1| hypothetical protein EUTSA_v10013361mg [Eutrema salsugineum]
Length=493

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +3

Query  342  SMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKP  521
            S+ Q+    +R CD   G WV    YPLY P  CPY+  A  C +NGR DSDY  W+WKP
Sbjct  138  SVEQAVVEKIRGCDLYRGSWVKGDEYPLYQPGSCPYVDEAFDCQRNGRRDSDYLNWRWKP  197

Query  522  DGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            DGC +PRF+A +FL ++R K +MLVGDS+ RNQ
Sbjct  198  DGCDLPRFNATDFLVKLRGKSLMLVGDSMNRNQ  230



>ref|XP_010687461.1| PREDICTED: protein trichome birefringence-like 5 [Beta vulgaris 
subsp. vulgaris]
Length=466

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            ++C+F  GKWV D  YP+Y P  CP++  A  C  NGRPD ++ KW+WKPD C +PRF+A
Sbjct  117  KNCNFYMGKWVKDDGYPVYQPGSCPFVDEAYDCQSNGRPDFEFMKWRWKPDDCDLPRFNA  176

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R+R KR+MLVGDS+ RNQ
Sbjct  177  TDFLVRIRGKRLMLVGDSMNRNQ  199



>ref|XP_009388706.1| PREDICTED: protein trichome birefringence-like 31 [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQ--SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            + C+   G+WV D+  S PLY    CPYL+  V+C +NGRPDS YQKW+WKPD C +PRF
Sbjct  54   QGCNLFQGRWVLDEHNSRPLYTEESCPYLTRQVTCGRNGRPDSLYQKWRWKPDACDLPRF  113

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            DAL+ L R+R KR+M VGDSI R Q
Sbjct  114  DALKLLERLRNKRLMFVGDSIQRTQ  138



>ref|XP_009342821.1| PREDICTED: protein trichome birefringence-like 5 [Pyrus x bretschneideri]
Length=497

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CD   G WV D+ YPLY+P  CPY+  A  C  NGR DS+Y KW+WKP GC +PRF+A 
Sbjct  147  GCDLYAGTWVKDERYPLYEPRSCPYVDEAFDCQSNGRSDSEYLKWRWKPQGCDLPRFNAT  206

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R+R K++MLVGDS+ RNQ
Sbjct  207  DFLVRLRGKKLMLVGDSMNRNQ  228



>ref|XP_010689958.1| PREDICTED: protein trichome birefringence-like 43 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +3

Query  327  HDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQK  506
            +  +I+  +  + S +SCD  TGKWV D SYPLY+ + CP+      C KNGRPD++Y K
Sbjct  28   YKGKITRRKENNYSSKSCDLYTGKWVHDSSYPLYEASNCPFFEKQFGCEKNGRPDTNYLK  87

Query  507  WKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            ++WKP  C +PRFD  +FL R+R KR++ VGDSI  NQ
Sbjct  88   FRWKPSHCLLPRFDGGDFLTRLRGKRMLFVGDSISLNQ  125



>emb|CDY16546.1| BnaC09g37270D [Brassica napus]
Length=496

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 67/101 (66%), Gaps = 1/101 (1%)
 Frame = +3

Query  321  DDHDDEISMVQSRHASLRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSD  497
            +D++ E +  ++    LR CD   G WV D   YPLY P  CPY+  A  C +NGR DSD
Sbjct  133  EDNNAESAEGKAVVEKLRGCDLYKGSWVKDADEYPLYQPGSCPYVDDAFDCQRNGRRDSD  192

Query  498  YQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            Y  W+WKPDGC +PRF+A +FL ++R K +MLVGDS+ RNQ
Sbjct  193  YLNWRWKPDGCDLPRFNATDFLEKLRGKSLMLVGDSMNRNQ  233



>ref|XP_010265394.1| PREDICTED: protein trichome birefringence-like 5 [Nelumbo nucifera]
Length=497

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD   G WV D +YP+Y+P  CPY+  A SC  NGR DS+Y KW+WKPD C +PRF+A +
Sbjct  152  CDLYKGTWVKDDNYPIYNPGSCPYVDEAFSCQGNGRRDSEYLKWRWKPDDCDLPRFNATD  211

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            FL ++R KR+MLVGDS+ RNQ
Sbjct  212  FLEKLRGKRLMLVGDSMNRNQ  232



>ref|XP_010259297.1| PREDICTED: protein trichome birefringence-like 6 [Nelumbo nucifera]
Length=504

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD S G+WVFD+SYPLY    CP++    SC  NGRPD DY KW+W+P  C IPRF+A++
Sbjct  162  CDISNGRWVFDESYPLYTNGSCPFVDEGFSCQVNGRPDKDYFKWRWQPHDCNIPRFNAVK  221

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
             L  +R KR++ VGDSI RNQ
Sbjct  222  MLELLRGKRLVFVGDSINRNQ  242



>ref|XP_008386343.1| PREDICTED: protein trichome birefringence-like 41 [Malus domestica]
Length=257

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            SCDF  G+WV DQSYPLYDP+ CP++    SC KNGRPD  + K++W+P  C + RFDAL
Sbjct  33   SCDFFKGRWVLDQSYPLYDPSSCPFIEREFSCQKNGRPDQIHTKYRWQPLDCDLARFDAL  92

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +F  R R K I+ VGDS+ RNQ
Sbjct  93   DFFERFRGKNIIFVGDSLSRNQ  114



>ref|XP_004497886.1| PREDICTED: uncharacterized protein LOC101512080 [Cicer arietinum]
Length=529

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            DEI M++S    LR CDF  G+WV D+SYPLY+P  C  +    +C  NGRPD DYQK+K
Sbjct  165  DEIHMMES----LRKCDFFDGEWVKDESYPLYEPGSCNLVDEQFNCIHNGRPDKDYQKYK  220

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRN  617
            WKP GC++PR D    L  +R KR++ VGDSI RN
Sbjct  221  WKPKGCSLPRLDGKRMLDLLRGKRLVFVGDSINRN  255



>ref|XP_010267993.1| PREDICTED: protein trichome birefringence-like 6 isoform X2 [Nelumbo 
nucifera]
Length=438

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD S G+WVFD+SYPLY  + CP++    SC  NGRPD DY +W+W+P  C IPRF+A++
Sbjct  149  CDVSKGRWVFDESYPLYTNSSCPFIDEGFSCEANGRPDKDYIRWRWQPHDCNIPRFNAVK  208

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
             L  +R KR++ VGDSI RNQ
Sbjct  209  MLELIRGKRLVFVGDSINRNQ  229



>ref|XP_010915622.1| PREDICTED: protein trichome birefringence-like 42 [Elaeis guineensis]
Length=356

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query  336  EISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLS-TAVSCSKNGRPDSDYQKWK  512
            E +   S   SL  C+   G WV+D+SYPLYD A CP++S     C K+GRPD +Y K++
Sbjct  29   ETAGSSSGGRSLAQCNLFQGSWVYDESYPLYDSASCPFISKMGFDCLKSGRPDENYLKYR  88

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            WKPDGC +PRFD  +FL RMR K IM VGDSI  NQ
Sbjct  89   WKPDGCELPRFDGKDFLQRMRGKTIMFVGDSISLNQ  124



>ref|XP_003610012.1| hypothetical protein MTR_4g126950 [Medicago truncatula]
 gb|AES92209.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=455

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 7/107 (7%)
 Frame = +3

Query  321  DDHDDEISMVQSRH-------ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKN  479
            DDH+   S+  +R         +L+ CD   G WV D  YP+Y+P  CPY+  A  C  N
Sbjct  83   DDHESVESIFDTRTDEVDDAILALKECDLYNGTWVEDGDYPIYEPGSCPYVDEAYDCKIN  142

Query  480  GRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            GR D+ Y KW+WKP GC +PRF A +FL R++ K++MLVGDS+ RNQ
Sbjct  143  GRNDTRYTKWRWKPHGCDLPRFSAKDFLARLKGKQLMLVGDSMNRNQ  189



>gb|EPS67963.1| hypothetical protein M569_06809 [Genlisea aurea]
Length=337

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +3

Query  339  ISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWK  518
            IS   S+  S R CD S G WV D SYPLY  A CP++     C +NGRPDSDY K +W+
Sbjct  14   ISHSTSKIVSTR-CDLSRGNWVLDNSYPLYKSADCPFIERIFDCQRNGRPDSDYAKLRWQ  72

Query  519  PDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            PDGC +PRFDA  F+ ++R KR++ VGDS+  NQ
Sbjct  73   PDGCNLPRFDASGFISKVRGKRVIFVGDSLSLNQ  106



>emb|CBI17853.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  393  GKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRM  572
            G WV D+ YP+Y P  CPY+  A SC  NGR DS Y KW+WKPDGC +PRF+A +FL R+
Sbjct  2    GTWVKDEEYPIYSPGSCPYVDEAFSCQGNGRSDSKYLKWRWKPDGCDLPRFNATDFLVRL  61

Query  573  RRKRIMLVGDSIMRNQ  620
            R KR+MLVGDS+ RNQ
Sbjct  62   RGKRLMLVGDSMNRNQ  77



>gb|KHN17657.1| hypothetical protein glysoja_005854 [Glycine soja]
Length=459

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            +L+ CD  TG WV D++YP+Y P  CPY+  A  C  NGR D+ Y  W+WKPD C +PRF
Sbjct  109  NLKECDLFTGTWVKDENYPIYQPGSCPYVDEAYDCKVNGRTDTLYTNWRWKPDACDLPRF  168

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R++ K++MLVGDS+ RNQ
Sbjct  169  NATDFLVRLKGKKLMLVGDSMNRNQ  193



>ref|XP_003550638.1| PREDICTED: protein YLS7-like [Glycine max]
Length=460

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            +L+ CD  TG WV D++YP+Y P  CPY+  A  C  NGR D+ Y  W+WKPD C +PRF
Sbjct  110  NLKECDLFTGTWVKDENYPIYQPGSCPYVDEAYDCKVNGRTDTLYTNWRWKPDACDLPRF  169

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R++ K++MLVGDS+ RNQ
Sbjct  170  NATDFLVRLKGKKLMLVGDSMNRNQ  194



>ref|XP_006469127.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=409

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  378  CDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            C+   GKWV++ ++ PLY+ A+CP+LS  VSC +NGRPD +Y+KW WK +GC IPRF+A 
Sbjct  71   CNIFNGKWVYNGEASPLYNEAQCPFLSDQVSCQRNGRPDVEYEKWTWKAEGCEIPRFNAT  130

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            + L R++ KR+++VGDS+ RNQ
Sbjct  131  DMLERLKNKRVIIVGDSLNRNQ  152



>ref|XP_010267992.1| PREDICTED: protein trichome birefringence-like 6 isoform X1 [Nelumbo 
nucifera]
Length=491

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD S G+WVFD+SYPLY  + CP++    SC  NGRPD DY +W+W+P  C IPRF+A++
Sbjct  149  CDVSKGRWVFDESYPLYTNSSCPFIDEGFSCEANGRPDKDYIRWRWQPHDCNIPRFNAVK  208

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
             L  +R KR++ VGDSI RNQ
Sbjct  209  MLELIRGKRLVFVGDSINRNQ  229



>ref|XP_009763711.1| PREDICTED: protein trichome birefringence-like 5 [Nicotiana sylvestris]
Length=520

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +SCD   G+WV D+ +P+Y    CPY+  A  C  NGRPDS+Y  W+WKP GC +PRF A
Sbjct  174  QSCDLYKGRWVKDEKHPIYKAGSCPYVDEAFDCQSNGRPDSEYLNWRWKPHGCDLPRFSA  233

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R++ KR+MLVGDS+ RNQ
Sbjct  234  TDFLKRLKGKRLMLVGDSMNRNQ  256



>ref|XP_009340027.1| PREDICTED: protein trichome birefringence-like 41 [Pyrus x bretschneideri]
Length=362

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            SCDF  G+WV DQSYPLYDP+ CP++    SC KNGRPD  + K++W+P  C + RFDAL
Sbjct  42   SCDFFKGRWVLDQSYPLYDPSSCPFIEREFSCQKNGRPDQIHTKYRWQPLDCDLARFDAL  101

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +F  R R K+I+ VGDS+ RNQ
Sbjct  102  DFFERFRGKKIIFVGDSLSRNQ  123



>ref|NP_197559.1| protein trichome birefringence-like 5 [Arabidopsis thaliana]
 sp|F4K5K4.1|TBL5_ARATH RecName: Full=Protein trichome birefringence-like 5 [Arabidopsis 
thaliana]
 gb|AED92864.1| protein trichome birefringence-like 5 [Arabidopsis thaliana]
Length=485

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +3

Query  339  ISMVQSRHA---SLRSCDFSTGKWV-FDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQK  506
            +S+    HA    +R CD   G WV  D  YPLY P  CPY+  A  C +NGR DSDY  
Sbjct  125  VSVESVEHAVIEKMRGCDLYKGSWVKGDDEYPLYQPGSCPYVDDAFDCQRNGRRDSDYLN  184

Query  507  WKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            W+WKPDGC +PRF+A +FL ++R K +MLVGDS+ RNQ
Sbjct  185  WRWKPDGCDLPRFNATDFLVKLRGKSLMLVGDSMNRNQ  222



>ref|XP_006296433.1| hypothetical protein CARUB_v10025613mg [Capsella rubella]
 gb|EOA29331.1| hypothetical protein CARUB_v10025613mg [Capsella rubella]
Length=354

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            + C+   GKWV+DQ+YPLYD   CP++    +C  NGRPD++Y K++W+P+GC IPRF+ 
Sbjct  27   KYCNIYIGKWVYDQNYPLYDSKTCPFIEKQFNCQSNGRPDTEYLKYRWQPNGCNIPRFNG  86

Query  552  LEFLGR-MRRKRIMLVGDSIMRNQ  620
            L+FLGR M+ K++M VGDS+  NQ
Sbjct  87   LDFLGRIMKGKKLMFVGDSLSLNQ  110



>ref|XP_009120795.1| PREDICTED: protein trichome birefringence-like 5 [Brassica rapa]
Length=497

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDG  527
            Q+    LR CD   G WV D   YPLY P  CPY+  A  C +NGR DSDY  W+WKPDG
Sbjct  144  QAVVEKLRGCDLYKGSWVKDGDEYPLYQPGSCPYVDDAFDCQRNGRRDSDYLNWRWKPDG  203

Query  528  CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +PRF+A +FL ++R K +MLVGDS+ RNQ
Sbjct  204  CDLPRFNATDFLEKLRGKSLMLVGDSMNRNQ  234



>ref|XP_010914510.1| PREDICTED: protein trichome birefringence-like 40 [Elaeis guineensis]
Length=418

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 74/123 (60%), Gaps = 9/123 (7%)
 Frame = +3

Query  279  SSPYEIEELSWLDGDDHDDEISMVQSRHASL--------RSCDFSTGKWVFD-QSYPLYD  431
            + P  +E    L   + + E+S   +   SL        R C+   G+WV+D ++YPLY 
Sbjct  38   AQPVFMESSQHLATSEANSEVSSRSTERTSLSLDGKSIERKCNIFDGRWVYDPKAYPLYH  97

Query  432  PARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIM  611
              RCP+L   VSC KNGRPDS Y+ W+W+P+GC IPRF+    L R+R KR+ ++GDS+ 
Sbjct  98   GKRCPFLGAQVSCQKNGRPDSAYEHWRWEPNGCRIPRFNGSYVLERLRGKRVAIIGDSLN  157

Query  612  RNQ  620
            RNQ
Sbjct  158  RNQ  160



>ref|XP_010493164.1| PREDICTED: protein trichome birefringence-like 5 [Camelina sativa]
Length=485

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +3

Query  342  SMVQSRHASLRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWK  518
            S+ Q+    ++ CD   G WV D   YPLY P  CPY+  A  C KNGR DSDY  WKWK
Sbjct  129  SVDQAVVEKMKGCDLYRGSWVKDDDEYPLYQPGSCPYVDEAFDCQKNGRRDSDYLNWKWK  188

Query  519  PDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            PDGC +PRF+A +FL ++R K ++LVGDS+ RNQ
Sbjct  189  PDGCDLPRFNATDFLVKLRGKSLLLVGDSMNRNQ  222



>ref|XP_007154672.1| hypothetical protein PHAVU_003G138100g [Phaseolus vulgaris]
 gb|ESW26666.1| hypothetical protein PHAVU_003G138100g [Phaseolus vulgaris]
Length=453

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            +++ CD   G WV D +YP+Y P  CPY+  A  C  NGR D+ Y KW+WKPD C +PRF
Sbjct  104  NVKECDLFAGTWVRDDNYPIYQPGSCPYVDEAYGCKVNGRTDTLYTKWRWKPDACDLPRF  163

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL R++ KR+MLVGDS+ RNQ
Sbjct  164  NATDFLVRLKGKRLMLVGDSMNRNQ  188



>gb|AAM64322.1| unknown [Arabidopsis thaliana]
Length=485

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +3

Query  339  ISMVQSRHA---SLRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQK  506
            +S+    HA    +R CD   G WV D   YPLY P  CPY+  A  C +NGR DSDY  
Sbjct  125  VSVESVEHAVIEKMRGCDLYRGSWVKDDDEYPLYQPGSCPYVDDAFDCQRNGRRDSDYLN  184

Query  507  WKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            W+WKPDGC +PRF+A +FL ++R K +MLVGDS+ RNQ
Sbjct  185  WRWKPDGCDLPRFNATDFLVKLRGKSLMLVGDSMNRNQ  222



>emb|CDX92451.1| BnaA10g14900D [Brassica napus]
Length=492

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +3

Query  369  LRSCDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            LR CD   G WV D   YPLY P  CPY+  A  C +NGR DSDY  W+WKPDGC +PRF
Sbjct  145  LRGCDLYKGSWVKDGDEYPLYQPGSCPYVDDAFDCQRNGRRDSDYLNWRWKPDGCDLPRF  204

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL ++R K +MLVGDS+ RNQ
Sbjct  205  NATDFLEKLRGKSLMLVGDSMNRNQ  229



>gb|KEH16599.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=526

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            DEI M++S    L  CDF  GKW+ D+SYPLY P  C  +    SC  NGRPD DYQK K
Sbjct  159  DEIHMMES----LMKCDFFDGKWIKDESYPLYKPGSCNLIDEQFSCINNGRPDKDYQKLK  214

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRN  617
            WKP GC++PR D  + L  +R KR++ VGDSI RN
Sbjct  215  WKPKGCSLPRLDGHKMLDLLRGKRLVFVGDSINRN  249



>gb|KDO63330.1| hypothetical protein CISIN_1g043893mg [Citrus sinensis]
Length=419

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +3

Query  372  RSCDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            + C+   GKWV++ ++ PLY+ A+CP+LS  VSC +NGRPD +Y+KW WK +GC IPRF+
Sbjct  69   KLCNIFNGKWVYNGEASPLYNEAQCPFLSDQVSCQRNGRPDVEYEKWTWKAEGCEIPRFN  128

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            A + L R++ KR+++VGDS+ RNQ
Sbjct  129  ATDMLERLKNKRVIIVGDSLNRNQ  152



>ref|XP_006446764.1| hypothetical protein CICLE_v10017800mg, partial [Citrus clementina]
 gb|ESR60004.1| hypothetical protein CICLE_v10017800mg, partial [Citrus clementina]
Length=399

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +3

Query  372  RSCDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            + C+   GKWV++ ++ PLY+ A+CP+LS  VSC +NGRPD +Y+KW WK +GC IPRF+
Sbjct  69   KLCNIFNGKWVYNGEASPLYNEAQCPFLSDQVSCQRNGRPDVEYEKWTWKAEGCEIPRFN  128

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            A + L R++ KR+++VGDS+ RNQ
Sbjct  129  ATDMLERLKNKRVIIVGDSLNRNQ  152



>ref|XP_002871948.1| hypothetical protein ARALYDRAFT_488963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48207.1| hypothetical protein ARALYDRAFT_488963 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +3

Query  369  LRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            +R CD   G WV D   YPLY P  CPY+  A  C +NGR DSDY  W+WKPDGC +PRF
Sbjct  134  MRGCDLYKGSWVKDDDEYPLYQPGSCPYVDEAFDCQRNGRRDSDYLNWRWKPDGCDLPRF  193

Query  546  DALEFLGRMRRKRIMLVGDSIMRNQ  620
            +A +FL ++R K +MLVGDS+ RNQ
Sbjct  194  NATDFLVKLRGKSLMLVGDSMNRNQ  218



>ref|XP_008369046.1| PREDICTED: protein trichome birefringence-like 6 [Malus domestica]
Length=525

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  369  LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            +R CDF+ G+WV+D+SYPLY    CP +    +C  NGR D DY KW+W+P  C IPRF+
Sbjct  192  VRGCDFTRGRWVYDESYPLYTNVSCPLIDEGFNCQANGRKDKDYMKWRWQPQDCDIPRFN  251

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            A + L  MR KR++ VGDSI RNQ
Sbjct  252  ATKMLELMRGKRLVFVGDSINRNQ  275



>gb|ACN40917.1| unknown [Picea sitchensis]
Length=437

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +3

Query  348  VQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDG  527
            V    A    C+  +G WV D SYPL+  A+CPY+ +  +C +NGRPDSDY+KW+W+P G
Sbjct  95   VGENKADTTKCNLFSGTWVRDASYPLFLGAQCPYVDSKATCRQNGRPDSDYEKWRWQPSG  154

Query  528  CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C+IP F+A + L R+R KR+M VGDSI ++Q
Sbjct  155  CSIPSFNARDMLERLRGKRLMFVGDSISQSQ  185



>ref|XP_006287593.1| hypothetical protein CARUB_v10000803mg [Capsella rubella]
 gb|EOA20491.1| hypothetical protein CARUB_v10000803mg [Capsella rubella]
Length=494

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +3

Query  342  SMVQSRHASLRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWK  518
            S+ Q+    +R CD   G WV D   YPLY P  CPY+  A  C +NGR DSDY  W+WK
Sbjct  138  SVEQAVVEKMRGCDLYRGSWVKDDDEYPLYQPGSCPYVDEAFDCQRNGRRDSDYLNWRWK  197

Query  519  PDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            PDGC +PRF+A +FL ++R K ++LVGDS+ RNQ
Sbjct  198  PDGCDLPRFNATDFLVKLRGKSLLLVGDSMNRNQ  231



>ref|XP_011098382.1| PREDICTED: protein trichome birefringence-like 43 [Sesamum indicum]
Length=205

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 70/117 (60%), Gaps = 1/117 (1%)
 Frame = +3

Query  270  CAESSPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPY  449
            CA SSP        L      D  ++V+ ++   + CD   G WVFD+SYPLYD  +CP 
Sbjct  2    CACSSPLSAVLAVTLLLLSSVDANAVVELKNHH-KKCDLYDGSWVFDKSYPLYDVEKCPL  60

Query  450  LSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +    SC +NGRPD  YQK++W+P  C +PR+D  EF  R+R KRIM VGDSI  NQ
Sbjct  61   ILQQFSCMRNGRPDRRYQKYRWQPKNCNLPRWDGREFGRRVRGKRIMFVGDSIGLNQ  117



>ref|XP_009378730.1| PREDICTED: protein trichome birefringence-like 6 [Pyrus x bretschneideri]
Length=565

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  369  LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            +R CDF+ G+WV+D+SYPLY    CP +    +C  NGR D DY KW+W+P  C IPRF+
Sbjct  231  VRGCDFTRGRWVYDESYPLYTNVSCPLIDEGFNCQGNGRKDKDYMKWRWQPQDCDIPRFN  290

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            A + L  MR KR++ VGDSI RNQ
Sbjct  291  ATKMLELMRGKRLVFVGDSINRNQ  314



>ref|XP_009610815.1| PREDICTED: protein trichome birefringence-like 5 [Nicotiana tomentosiformis]
Length=528

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +SCD   G+WV D+ +P+Y    CPY+  A  C  NGRPDS Y  W+WKP GC +PRF A
Sbjct  182  QSCDLYKGRWVKDEKHPIYKAGSCPYVDEAFDCQSNGRPDSQYLNWRWKPHGCDLPRFSA  241

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
              FL R++ KR+MLVGDS+ RNQ
Sbjct  242  TNFLKRLKGKRLMLVGDSMNRNQ  264



>ref|XP_011044590.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Populus euphratica]
Length=257

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
            A+   CDF TG WV D S+PLY+ + CP++    SC KNGRPDS Y K++WKP  C + R
Sbjct  26   ANASGCDFFTGTWVVDGSFPLYNASACPFIEREFSCQKNGRPDSLYTKYRWKPLYCNLKR  85

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+ ++FL R R KRIM VGDS+ RNQ
Sbjct  86   FNGVDFLERFRGKRIMFVGDSLSRNQ  111



>gb|KFK26286.1| hypothetical protein AALP_AA8G228100 [Arabis alpina]
Length=490

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query  369  LRSCDFSTGKW--VFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
            +R CD   G W  V D  YPLY P  CPY+  A  C +NGR DSDY  WKWKPDGC +PR
Sbjct  142  MRGCDLYKGSWIKVKDDEYPLYQPGSCPYVDEAFDCQRNGRRDSDYLNWKWKPDGCDLPR  201

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+A +FL +++ K +MLVGDS+ RNQ
Sbjct  202  FNATDFLVKLKGKSLMLVGDSMNRNQ  227



>ref|XP_006366199.1| PREDICTED: uncharacterized protein LOC102583948 isoform X2 [Solanum 
tuberosum]
Length=499

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  312  LDGDDHDDEISMVQSRHASL-RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRP  488
            LD      + S+V+ +   +  SCD   G WV D+++P+Y P  CPY+  A  C  NGRP
Sbjct  142  LDVTSETPKSSLVEKKSRPIGESCDLFKGSWVKDENHPIYKPGSCPYVDEAFDCQTNGRP  201

Query  489  DSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            DS Y KW WKP GC +PRF   +FL R++ KR+MLVGDS+ RNQ
Sbjct  202  DSQYLKWTWKPHGCHLPRFSPSDFLKRLKGKRLMLVGDSMNRNQ  245



>ref|XP_004243016.1| PREDICTED: protein trichome birefringence-like 5 [Solanum lycopersicum]
Length=532

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            SCD   G+WV D+++P+Y P  CPY+  A  C  NGRPDS Y KW+WKP GC +PRF   
Sbjct  197  SCDLFKGRWVKDENHPIYKPGSCPYVDEAFDCQTNGRPDSQYLKWRWKPFGCHLPRFSPS  256

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R++ KR+MLVGDS+ RNQ
Sbjct  257  DFLYRLKGKRLMLVGDSMNRNQ  278



>ref|XP_010454365.1| PREDICTED: protein trichome birefringence-like 5 [Camelina sativa]
Length=500

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +3

Query  342  SMVQSRHASLRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWK  518
            S+ Q+    +R CD   G WV D   YPLY P  CPY+  A  C +NGR DSDY  W+WK
Sbjct  144  SVDQAVVEKMRGCDLYRGSWVKDDDEYPLYQPGSCPYVDEAFDCQRNGRRDSDYLNWRWK  203

Query  519  PDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            PDGC +PRF+A +FL ++R K ++LVGDS+ RNQ
Sbjct  204  PDGCDLPRFNATDFLVKLRGKSLLLVGDSMNRNQ  237



>ref|XP_010921033.1| PREDICTED: protein trichome birefringence-like 35 [Elaeis guineensis]
Length=442

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  351  QSRHASL-RSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPD  524
            Q +H S    CD  +G+WV+D  SYPLYD  RCPY+S  ++C K+GRPD +YQKW+W+P 
Sbjct  94   QWQHESWSNGCDMFSGRWVYDNISYPLYDGGRCPYMSDQLACRKHGRPDKEYQKWRWQPH  153

Query  525  GCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            GC + R++A E L ++R KR+M VGDS+ R Q
Sbjct  154  GCNLKRWNATEMLEKLRGKRLMFVGDSLNRGQ  185



>ref|XP_010273482.1| PREDICTED: protein trichome birefringence-like 41 [Nelumbo nucifera]
Length=364

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +3

Query  282  SPYEIEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTA  461
            +P  I  L  + G+ H + +S    R  S + CD   GKWV+D+ YPLYDP+ CP++   
Sbjct  13   APLIISSLQQVRGE-HFNNVSWWGQRKQS-QGCDLFQGKWVYDEVYPLYDPSVCPFIEQL  70

Query  462  VSCSKNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
              C +NGRPD  Y K++WKP+GC +P F+  +FL R+R K IM VGDS+  NQ
Sbjct  71   FDCQRNGRPDKLYLKYRWKPNGCDLPSFNGHDFLWRLRGKSIMFVGDSLSLNQ  123



>gb|ABR16389.1| unknown [Picea sitchensis]
Length=484

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CDFS G WV+D SY LY+   CP+L     C +NGRPDSDY KW+W+P  C +PRF+A  
Sbjct  129  CDFSVGSWVWDDSYSLYESRNCPFLDGGFRCQENGRPDSDYLKWRWQPSHCDLPRFNANT  188

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            FL R+R  R++ VGDSI RNQ
Sbjct  189  FLERIRNSRVVFVGDSIGRNQ  209



>ref|XP_002283620.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=328

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CDF  G WV D SYPLYD + CP++S  V C KNGRPD  Y K++W+P GCT+PRF+  
Sbjct  7    GCDFFKGTWVVDDSYPLYDSSICPFISPHVDCQKNGRPDKLYLKYRWQPHGCTLPRFNGE  66

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R + K+IM VGDS+  NQ
Sbjct  67   DFLKRFKGKKIMFVGDSLSENQ  88



>ref|XP_010513188.1| PREDICTED: protein trichome birefringence-like 43 [Camelina sativa]
Length=365

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = +3

Query  327  HDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQK  506
            +  E ++V+  H   +SC+   G WV+DQSYPLYD   CP++    +C  NGR DS+Y K
Sbjct  21   NQTESAIVKKPHR--KSCNIYIGNWVYDQSYPLYDSKTCPFIEKQFNCKSNGRLDSEYLK  78

Query  507  WKWKPDGCTIPRFDALEFLGR-MRRKRIMLVGDSIMRNQ  620
            ++W+P GC +PRF+ L+FLGR MR K++M VGDS+  NQ
Sbjct  79   YRWQPSGCNLPRFNGLDFLGRVMRGKKLMFVGDSLSLNQ  117



>ref|XP_009414283.1| PREDICTED: protein ESKIMO 1-like [Musa acuminata subsp. malaccensis]
Length=503

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            SCD  TG WV+D+ SYP+Y    C +L+  V+C +NGR D DYQKW+W+P GC++PRFDA
Sbjct  143  SCDLFTGDWVYDEVSYPIYKEPECEFLTEQVTCMRNGRRDDDYQKWRWQPQGCSLPRFDA  202

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
               L R+R KR+M VGDS+ RNQ
Sbjct  203  QVMLERLRGKRLMFVGDSLNRNQ  225



>ref|XP_006366198.1| PREDICTED: uncharacterized protein LOC102583948 isoform X1 [Solanum 
tuberosum]
Length=535

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  312  LDGDDHDDEISMVQSRHASL-RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRP  488
            LD      + S+V+ +   +  SCD   G WV D+++P+Y P  CPY+  A  C  NGRP
Sbjct  178  LDVTSETPKSSLVEKKSRPIGESCDLFKGSWVKDENHPIYKPGSCPYVDEAFDCQTNGRP  237

Query  489  DSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            DS Y KW WKP GC +PRF   +FL R++ KR+MLVGDS+ RNQ
Sbjct  238  DSQYLKWTWKPHGCHLPRFSPSDFLKRLKGKRLMLVGDSMNRNQ  281



>ref|NP_001168900.1| uncharacterized protein LOC100382706 [Zea mays]
 gb|ACN30974.1| unknown [Zea mays]
 tpg|DAA57002.2| TPA: hypothetical protein ZEAMMB73_914259 [Zea mays]
Length=541

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +CD S G+WVFD  SYPLY    C +L++ V+C KNGR D  YQKW+W+P GC++PRFDA
Sbjct  185  TCDLSKGRWVFDNTSYPLYREEECEFLTSQVTCMKNGRRDDTYQKWRWQPKGCSMPRFDA  244

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
              F+ R+R KR M VGDS+ RNQ
Sbjct  245  KLFMERLRGKRFMFVGDSLNRNQ  267



>emb|CAN60202.1| hypothetical protein VITISV_036403 [Vitis vinifera]
Length=367

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +3

Query  336  EISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKW  515
             +S ++SR   + SC+   GKWVFD SYP YD + CP++     C K GRPD  Y K+ W
Sbjct  33   NVSGLRSR-KQVSSCNLFQGKWVFDASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSW  91

Query  516  KPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            KPD C +PRFD L+FL R R KRIM VGDS+  NQ
Sbjct  92   KPDSCDLPRFDGLDFLRRWRGKRIMFVGDSLSLNQ  126



>emb|CBI30668.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +3

Query  336  EISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKW  515
             +S ++SR   + SC+   GKWVFD SYP YD + CP++     C K GRPD  Y K+ W
Sbjct  43   NVSGLRSR-KQVSSCNLFQGKWVFDASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSW  101

Query  516  KPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            KPD C +PRFD L+FL R R KRIM VGDS+  NQ
Sbjct  102  KPDSCDLPRFDGLDFLRRWRGKRIMFVGDSLSLNQ  136



>gb|ABA29158.1| unknown [Pisum sativum]
Length=371

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            +C+   GKWV+D SYPLYDP+ CP++    +C K GRPD+ YQK++W+P  C++PRF+AL
Sbjct  52   TCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPLTCSLPRFNAL  111

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL + R K+IM VGDS+  NQ
Sbjct  112  DFLAKYRGKKIMFVGDSLSLNQ  133



>gb|AAP22495.1| hypothetical protein At2g30900 [Arabidopsis thaliana]
Length=214

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            C+   G WV+D+SYPLYD   CP++    +C  NGRPDS+Y K++W+P GC +PRF+ L+
Sbjct  42   CNIYQGSWVYDKSYPLYDSKNCPFIERQFNCKSNGRPDSEYLKYRWQPSGCNLPRFNGLD  101

Query  558  FLGR-MRRKRIMLVGDSIMRNQ  620
            FLGR M+ K++M VGDS+  NQ
Sbjct  102  FLGRIMKGKKLMFVGDSLSLNQ  123



>ref|XP_002274664.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=409

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +3

Query  318  GDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSD  497
             D     +S ++SR   + SC+   GKWVFD SYP YD + CP++     C K GRPD  
Sbjct  69   ADHQVYNVSGLRSR-KQVSSCNLFQGKWVFDASYPFYDASNCPFIDPEFDCQKYGRPDKQ  127

Query  498  YQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            Y K+ WKPD C +PRFD L+FL R R KRIM VGDS+  NQ
Sbjct  128  YLKYSWKPDSCDLPRFDGLDFLRRWRGKRIMFVGDSLSLNQ  168



>gb|KEH39261.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=368

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            C++  GKWV+D SYPLYDP+ CP++    +C K GRPD+ YQK++W+P  C+IPRF+AL+
Sbjct  50   CNWFRGKWVYDPSYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPFTCSIPRFNALD  109

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            FL + R K+IM VGDS+  NQ
Sbjct  110  FLAKYRGKKIMFVGDSLSLNQ  130



>gb|AGC11114.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C KNGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKKNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A + L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATDMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11123.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11131.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11132.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C KNGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKKNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A + L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATDMLEKLRGKRLMFIGDSINRNQ  177



>ref|NP_001183316.1| uncharacterized protein LOC100501717 [Zea mays]
 gb|ACR36404.1| unknown [Zea mays]
Length=262

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDG  527
            Q +  +  +CD   G+WV+D+S  PLY  + C +L+  V+C++NGR D DYQKW+W+PDG
Sbjct  147  QEQDQAQGTCDLYKGRWVYDESRAPLYKESECSFLTEQVTCTRNGRRDDDYQKWRWQPDG  206

Query  528  CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +PRF+A   L ++R KR+M VGDS+ RNQ
Sbjct  207  CDLPRFEAKLLLEKLRNKRLMFVGDSLNRNQ  237



>gb|ABA29157.1| unknown [Pisum sativum]
Length=371

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            +C+   GKWV+D SYPLYDP+ CP++    +C K GRPD+ YQK++W+P  C++PRF+AL
Sbjct  52   TCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPLTCSLPRFNAL  111

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL + R K+IM VGDS+  NQ
Sbjct  112  DFLAKYRGKKIMFVGDSLSLNQ  133



>ref|XP_006349183.1| PREDICTED: uncharacterized protein LOC102598625 [Solanum tuberosum]
Length=532

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            +E+S    +  + + CD + GKWVFD+SYPLY  A CPY+    SC  NGR D +Y KW+
Sbjct  176  EEVSSDVLQVVNKKECDITKGKWVFDESYPLYTNASCPYIDEGFSCENNGRLDKNYMKWR  235

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            W+P  C IPRF+A + L  +R KR++  GDSI RNQ
Sbjct  236  WQPQDCDIPRFNATQMLELIRGKRLVFAGDSINRNQ  271



>gb|AGC11105.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11146.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11155.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11161.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11167.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C KNGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKKNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A + L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATDMLEKLRGKRLMFIGDSINRNQ  177



>gb|EPS71829.1| hypothetical protein M569_02929 [Genlisea aurea]
Length=257

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +3

Query  336  EISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKW  515
             ++  +  +A+   CD   GKWV+D SYPLYDP+ CPY+    +C K  RPD DY +++W
Sbjct  18   HVAAAELFNATAVGCDVFEGKWVYDSSYPLYDPSGCPYIDEGFNCLKYNRPDRDYLRYRW  77

Query  516  KPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRN  617
            +P  C +PRFD L+FL R R KRIM VGDS+  N
Sbjct  78   QPSSCDLPRFDGLDFLERSRGKRIMFVGDSLSLN  111



>ref|XP_010272738.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Nelumbo nucifera]
Length=357

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CD   G+WV+D++YPLY+P+ CP + +   C KNGRPD  Y K++WKP+GC +PRF+  
Sbjct  45   GCDLFDGRWVYDEAYPLYNPSSCPSIESIFDCQKNGRPDKLYLKYRWKPNGCDLPRFNGH  104

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R+R KRIM VGDS+  NQ
Sbjct  105  DFLWRLRGKRIMFVGDSLSLNQ  126



>gb|KJB46924.1| hypothetical protein B456_008G001700 [Gossypium raimondii]
Length=501

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +3

Query  324  DHDDEISMVQSRHASLRSCDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            D+DDE+++        R C+   GKWV+D +  PLYD A CP+LS   SC +NGRPD +Y
Sbjct  154  DNDDEVTVTMEEE---RKCNIFEGKWVYDPKESPLYDSAMCPFLSETTSCRRNGRPDKEY  210

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +KW+W+ + C IPRF+A + L R+R KR+++VGDSI  +Q
Sbjct  211  EKWRWEINECKIPRFNAKDMLERLRGKRVVIVGDSINHSQ  250



>ref|XP_004305820.2| PREDICTED: protein trichome birefringence-like 43 [Fragaria vesca 
subsp. vesca]
Length=357

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +3

Query  348  VQSRHA--SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKP  521
            V  +HA   L  CD   G WV+D SYPLYD + C ++  A +C KNGRPD  Y K++W+P
Sbjct  21   VHGKHAYEKLNKCDIYQGSWVYDDSYPLYDSSLCNFIENAFNCQKNGRPDKHYLKYRWQP  80

Query  522  DGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
              C +PRFD  + L R+R KRIM VGDS+  NQ
Sbjct  81   SSCKLPRFDVEDLLERLRNKRIMFVGDSLSLNQ  113



>gb|AGC11129.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=273

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C KNGRPDS Y +W
Sbjct  82   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKKNGRPDSGYTQW  141

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  142  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  178



>ref|XP_008781812.1| PREDICTED: protein trichome birefringence-like 5 [Phoenix dactylifera]
Length=486

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = +3

Query  333  DEISMVQSRHASLRS--CDFSTGKWVFDQS--YPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            D+    + R A  R   CD   G+W  D+   YPLY P  CPY+  A SC +NGRPD DY
Sbjct  120  DDAEAREGRPAGRREGKCDIYQGRWERDEEGWYPLYSPGSCPYVDEAFSCQENGRPDRDY  179

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             KW+WKP  C +PRF+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  180  LKWRWKPKDCDLPRFNAADFLERLRGKRLMLVGDSMNRNQ  219



>ref|XP_002525125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37252.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 68/103 (66%), Gaps = 1/103 (1%)
 Frame = +3

Query  315  DGDDHDDEISMVQSRHASLRS-CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPD  491
            +G D +  IS   SR  +  S C++  GKWVFD SYPLYDP  CP+L    +C +NGRPD
Sbjct  10   NGTDSNFLISSRSSRKLAANSKCNWFRGKWVFDSSYPLYDPYSCPFLDKQFNCQENGRPD  69

Query  492  SDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
              Y K++W+P  C++PRF+ L FL + R K+IM VGDS+  NQ
Sbjct  70   RYYLKYRWQPFSCSLPRFNGLYFLEKWRGKKIMFVGDSLSLNQ  112



>gb|AGC11130.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11136.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11182.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11188.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11199.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=273

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C KNGRPDS Y +W
Sbjct  82   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKKNGRPDSGYTQW  141

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  142  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  178



>ref|XP_010272737.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Nelumbo nucifera]
Length=371

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CD   G+WV+D++YPLY+P+ CP + +   C KNGRPD  Y K++WKP+GC +PRF+  
Sbjct  45   GCDLFDGRWVYDEAYPLYNPSSCPSIESIFDCQKNGRPDKLYLKYRWKPNGCDLPRFNGH  104

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R+R KRIM VGDS+  NQ
Sbjct  105  DFLWRLRGKRIMFVGDSLSLNQ  126



>ref|XP_007200128.1| hypothetical protein PRUPE_ppa017879mg [Prunus persica]
 gb|EMJ01327.1| hypothetical protein PRUPE_ppa017879mg [Prunus persica]
Length=764

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CDF+ G+WV+D+SYPLY    CP++  + +C  NGR D ++ KW+W+P+ C IPRFDA +
Sbjct  445  CDFTRGRWVYDKSYPLYANGSCPFIEKSFNCRGNGRLDENFMKWRWQPEDCDIPRFDATK  504

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
             L  MR KR++ VGDS+ RNQ
Sbjct  505  MLELMRGKRLVFVGDSLNRNQ  525



>ref|XP_004507925.1| PREDICTED: uncharacterized protein LOC101489461 isoform X1 [Cicer 
arietinum]
Length=469

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD  TG WV DQ+YP+Y P  CPY+  A  C  NGR D+ Y KW+WKP  C +PRF A +
Sbjct  123  CDLYTGTWVEDQNYPIYQPGSCPYVDEAYDCKVNGRNDTHYTKWRWKPHDCDLPRFSAKD  182

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            FL R++ KR+ML+GDS+ RNQ
Sbjct  183  FLVRLKGKRLMLIGDSMNRNQ  203



>ref|XP_004251923.1| PREDICTED: protein trichome birefringence-like 41 [Solanum lycopersicum]
Length=355

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            RSC+F  G W+ D++YPLYD  +CP++    +C KNGRPD DY K++W+P GC++ RFD 
Sbjct  34   RSCNFFEGNWIEDETYPLYDSIQCPFIEHEFNCQKNGRPDQDYLKYRWQPHGCSLERFDG  93

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
              FL + + K IM VGDS+ RNQ
Sbjct  94   GAFLNKFKGKSIMFVGDSLSRNQ  116



>gb|AFK49604.1| unknown [Lotus japonicus]
Length=367

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = +3

Query  321  DDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDY  500
            DDHD       +       CD   G+WV+D+SYPLYD +RCP+      C KNGRPD  +
Sbjct  25   DDHDVNYQKQLTAGFGKSGCDLFEGRWVYDESYPLYDSSRCPFFEQQFDCQKNGRPDKFH  84

Query  501  QKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             K++W+P GC +PRF+  +FL R R K IM VGDS+  NQ
Sbjct  85   LKYRWQPTGCNLPRFNGEDFLRRYRGKSIMFVGDSLSLNQ  124



>ref|XP_009631911.1| PREDICTED: protein trichome birefringence-like 43 [Nicotiana 
tomentosiformis]
Length=384

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
              CD   G WVFD SYPLY+ + CP++  +  C KNGRPD DY K++W+P GC +PRF+ 
Sbjct  77   NGCDIYKGSWVFDDSYPLYNSSTCPFIEESWDCQKNGRPDKDYLKYRWQPYGCNLPRFNG  136

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             EFL + + KRIM VGDS+ +NQ
Sbjct  137  TEFLLKYKGKRIMFVGDSLGQNQ  159



>emb|CDP17066.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  297  EELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSK  476
             E+  L G +   E S +     S  +CD + G WVFDQSYPLY    CP++    +C  
Sbjct  187  HEVKLLSGINPMQENSRMSRSSGSELTCDVANGMWVFDQSYPLYRNTTCPFIDEGFNCET  246

Query  477  NGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            NGR D DY KW+W+P  C IPRF+A + L  +R KR++ VGDS+ RNQ
Sbjct  247  NGRLDRDYMKWRWQPQACNIPRFNASKMLELIRGKRLVFVGDSLNRNQ  294



>ref|XP_008783972.1| PREDICTED: protein trichome birefringence-like 42 [Phoenix dactylifera]
Length=363

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = +3

Query  303  LSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLS-TAVSCSKN  479
            L+ L    H   +   +    SL  C+   G WV+D+SYPLYD A CP +S T   C K+
Sbjct  19   LALLVASSHGVIVGSSKGGSGSLARCNLFQGSWVYDESYPLYDSASCPLISATYFDCRKS  78

Query  480  GRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            GRPD+ Y K++WKPDGC +PRF+  +FL RMR K IM VGDSI  NQ
Sbjct  79   GRPDTKYLKYRWKPDGCELPRFNGKDFLERMRGKTIMFVGDSISLNQ  125



>ref|XP_009132768.1| PREDICTED: protein trichome birefringence-like 40 [Brassica rapa]
 emb|CDX84800.1| BnaA03g14300D [Brassica napus]
Length=365

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            RSC++  GKWV+D SYPLY P  CP+++   +C K GRPD++YQ ++W+P  C++PRFD 
Sbjct  44   RSCNWFRGKWVYDSSYPLYSPFSCPFINPEFNCQKTGRPDTNYQHFRWQPFSCSLPRFDG  103

Query  552  LEFLGRMRRKRIMLVGDSIMRN  617
            + F+ RMR K+IM+VGDS+  N
Sbjct  104  VNFMRRMRGKKIMMVGDSLSLN  125



>ref|XP_006344054.1| PREDICTED: uncharacterized protein LOC102598924 [Solanum tuberosum]
Length=399

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
            A+L SC    G WV+D++YPLY  + CP + +  +C   GRPDSDY K++WKP  C IPR
Sbjct  58   ANLTSCSLFMGSWVYDETYPLYQSSSCPIIDSQFNCQMYGRPDSDYLKYRWKPTNCEIPR  117

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+ L+FL RMR K IM VGDS+ RNQ
Sbjct  118  FNGLDFLLRMRGKTIMYVGDSLGRNQ  143



>emb|CDY23962.1| BnaC03g17290D [Brassica napus]
Length=365

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            RSC++  GKWV+D SYPLY P  CP+++   +C K GRPD++YQ ++W+P  C++PRFD 
Sbjct  44   RSCNWFRGKWVYDSSYPLYSPFSCPFINPEFNCQKTGRPDTNYQHFRWQPFSCSLPRFDG  103

Query  552  LEFLGRMRRKRIMLVGDSIMRN  617
            + F+ RMR K+IM+VGDS+  N
Sbjct  104  VNFMRRMRGKKIMMVGDSLSLN  125



>gb|AFW81662.1| putative DUF231 domain containing family protein [Zea mays]
Length=335

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDG  527
            Q +  +  +CD   G+WV+D+S  PLY  + C +L+  V+C++NGR D DYQKW+W+PDG
Sbjct  147  QEQDQAQGTCDLYKGRWVYDESRAPLYKESECSFLTEQVTCTRNGRRDDDYQKWRWQPDG  206

Query  528  CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +PRF+A   L ++R KR+M VGDS+ RNQ
Sbjct  207  CDLPRFEAKLLLEKLRNKRLMFVGDSLNRNQ  237



>ref|XP_004229386.1| PREDICTED: protein trichome birefringence-like 6 [Solanum lycopersicum]
Length=541

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            + CD + GKWVFD+SYPLY  A CPY+    SC  NGR D +Y KW+W+P  C IPRF+A
Sbjct  198  KECDITKGKWVFDESYPLYTNASCPYIDEGFSCETNGRLDKNYMKWRWQPQDCDIPRFNA  257

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             + L  +R KR++  GDSI RNQ
Sbjct  258  TQMLELIRGKRLVFAGDSINRNQ  280



>ref|XP_002862622.1| hypothetical protein ARALYDRAFT_333274 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38880.1| hypothetical protein ARALYDRAFT_333274 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 1/100 (1%)
 Frame = +3

Query  324  DHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQ  503
            +  +  S+  S  +  + C+   G WV+D+SYPLYD   CP++    +C  NGRPD +Y 
Sbjct  23   NQTESASVNGSSQSHRKFCNIYLGSWVYDKSYPLYDSKTCPFIERQFNCKSNGRPDKEYL  82

Query  504  KWKWKPDGCTIPRFDALEFLGR-MRRKRIMLVGDSIMRNQ  620
            K++W+P GC +PRF+ LEFLGR M+ K++M VGDS+  NQ
Sbjct  83   KYRWQPSGCNLPRFNGLEFLGRIMKGKKLMFVGDSLSLNQ  122



>gb|KHN36688.1| hypothetical protein glysoja_001419 [Glycine soja]
Length=369

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 5/106 (5%)
 Frame = +3

Query  318  GDDHDDEISMVQSRHAS-----LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNG  482
             D+ D + S+  +++AS        C+   GKWV+D SYPLYDP+ CP++    +C K G
Sbjct  26   ADEFDFDESLFNAKNASSGRKLAGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYG  85

Query  483  RPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            RPD  YQK++W+P  C +PRF+A +FL + R K+IM VGDS+  NQ
Sbjct  86   RPDKQYQKYRWQPFSCPLPRFNAFDFLAKYRGKKIMFVGDSLSLNQ  131



>ref|XP_003543309.1| PREDICTED: protein YLS7 [Glycine max]
Length=369

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 5/106 (5%)
 Frame = +3

Query  318  GDDHDDEISMVQSRHAS-----LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNG  482
             D+ D + S+  +++AS        C+   GKWV+D SYPLYDP+ CP++    +C K G
Sbjct  26   ADEFDFDESLFNAKNASSGRKLAGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYG  85

Query  483  RPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            RPD  YQK++W+P  C +PRF+A +FL + R K+IM VGDS+  NQ
Sbjct  86   RPDKQYQKYRWQPFSCPLPRFNAFDFLAKYRGKKIMFVGDSLSLNQ  131



>gb|AFW81659.1| putative DUF231 domain containing family protein [Zea mays]
Length=347

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDG  527
            Q +  +  +CD   G+WV+D+S  PLY  + C +L+  V+C++NGR D DYQKW+W+PDG
Sbjct  147  QEQDQAQGTCDLYKGRWVYDESRAPLYKESECSFLTEQVTCTRNGRRDDDYQKWRWQPDG  206

Query  528  CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +PRF+A   L ++R KR+M VGDS+ RNQ
Sbjct  207  CDLPRFEAKLLLEKLRNKRLMFVGDSLNRNQ  237



>ref|XP_004487169.1| PREDICTED: uncharacterized protein LOC101503983 [Cicer arietinum]
Length=363

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            C++  GKWV+D SYPLYDP+ CP++    +C K GRPD+ YQK++W+P  C++PRF AL+
Sbjct  43   CNWFRGKWVYDPSYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPLSCSLPRFSALD  102

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            FL + R K+IM VGDS+  NQ
Sbjct  103  FLAKYRGKKIMFVGDSLSLNQ  123



>ref|XP_006854129.1| hypothetical protein AMTR_s00048p00162020 [Amborella trichopoda]
 gb|ERN15596.1| hypothetical protein AMTR_s00048p00162020 [Amborella trichopoda]
Length=533

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  HASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIP  539
            H  LR+CD   GKWV D++YP Y+   CP+L  A +C+KNGRPDS Y+K +W+P  C IP
Sbjct  174  HRILRTCDIFDGKWVSDEAYPYYEAGSCPFLDDAFNCAKNGRPDSSYEKLRWQPRECHIP  233

Query  540  RFDALEFLGRMRRKRIMLVGDSIMRN  617
            R D LE L R+R KR++ VGDS+ RN
Sbjct  234  RLDGLEMLERLRGKRLVYVGDSLNRN  259



>ref|XP_008355473.1| PREDICTED: protein trichome birefringence-like 11 [Malus domestica]
Length=269

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CD   G WV+D+SYPLY+   C  L     CS+NGRPD+ Y KW+W+P GCT+PRFDA 
Sbjct  84   GCDVFDGNWVWDESYPLYESQNCSLLDEGFRCSENGRPDNFYTKWRWQPKGCTLPRFDAG  143

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            + L ++R +R++ VGDSI RNQ
Sbjct  144  KMLEKLRNRRVVFVGDSIGRNQ  165



>gb|KDO71838.1| hypothetical protein CISIN_1g045325mg, partial [Citrus sinensis]
Length=412

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +3

Query  354  SRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCT  533
            +R   L SCD   G+WV D S PLY P  CP++  A +C KNGRPDSDY K+KW+P GC 
Sbjct  59   NRIKKLSSCDIFNGQWVVDNSEPLYKPGSCPFIDEAFNCFKNGRPDSDYLKYKWRPIGCQ  118

Query  534  IPRFDALEFLGRMRRKRIMLVGDSIMRN  617
            +PRFD  + L  +R KR++ VGDS+ RN
Sbjct  119  LPRFDGGKMLEMLRGKRLVFVGDSLNRN  146



>gb|AFW81661.1| putative DUF231 domain containing family protein [Zea mays]
Length=389

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDG  527
            Q +  +  +CD   G+WV+D+S  PLY  + C +L+  V+C++NGR D DYQKW+W+PDG
Sbjct  147  QEQDQAQGTCDLYKGRWVYDESRAPLYKESECSFLTEQVTCTRNGRRDDDYQKWRWQPDG  206

Query  528  CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +PRF+A   L ++R KR+M VGDS+ RNQ
Sbjct  207  CDLPRFEAKLLLEKLRNKRLMFVGDSLNRNQ  237



>ref|XP_004137306.1| PREDICTED: uncharacterized protein LOC101210661 [Cucumis sativus]
 ref|XP_004156551.1| PREDICTED: uncharacterized LOC101210661 [Cucumis sativus]
 gb|KGN53594.1| hypothetical protein Csa_4G083680 [Cucumis sativus]
Length=415

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +3

Query  345  MVQSRHASLRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKP  521
            +V S+     +C+   GKW +D  SYPLY+   CP+L   V+C KNGRPDS Y+KW+W+P
Sbjct  59   VVSSKDIIDENCNLFEGKWEWDNASYPLYEEDTCPFLVKQVTCQKNGRPDSFYKKWRWQP  118

Query  522  DGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            + C +PRFDAL+ L  +R KRIM VGDSI R Q
Sbjct  119  NSCNLPRFDALKVLDILRDKRIMFVGDSIQRGQ  151



>ref|XP_011044589.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Populus euphratica]
Length=352

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
            A+   CDF TG WV D S+PLY+ + CP++    SC KNGRPDS Y K++WKP  C + R
Sbjct  26   ANASGCDFFTGTWVVDGSFPLYNASACPFIEREFSCQKNGRPDSLYTKYRWKPLYCNLKR  85

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+ ++FL R R KRIM VGDS+ RNQ
Sbjct  86   FNGVDFLERFRGKRIMFVGDSLSRNQ  111



>ref|XP_007216490.1| hypothetical protein PRUPE_ppa025085mg, partial [Prunus persica]
 gb|EMJ17689.1| hypothetical protein PRUPE_ppa025085mg, partial [Prunus persica]
Length=149

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CD   G+WVFD  +PLYD   CP++    +C KNGRPD  YQ+++W+P  C +PRF A +
Sbjct  31   CDLYEGRWVFDDLHPLYDSTHCPFIEKIFNCQKNGRPDKLYQQYRWQPSACNLPRFSAED  90

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            FL R + KRIM +GDS+  NQ
Sbjct  91   FLQRFKDKRIMFIGDSLSLNQ  111



>gb|AFW84205.1| putative DUF231 domain containing family protein [Zea mays]
Length=234

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            DE +  +S+ A   +CD   G+WV D S PLY    CP ++   +C  NGRPD DY+ W+
Sbjct  130  DEDTSNESQKAEQDNCDLYRGEWVTDSSGPLYTNNSCPIITQMQNCQGNGRPDKDYENWR  189

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            WKP+ C +PRFDA +FL  MR K +  VGDS+ RNQ
Sbjct  190  WKPEQCNLPRFDARKFLELMRGKTLAFVGDSVARNQ  225



>ref|XP_008783902.1| PREDICTED: protein trichome birefringence-like 42 [Phoenix dactylifera]
Length=360

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLST-AVSCSKNGRPDSDYQKWKWKPDGCTIP  539
             SL  C+   G WV+D+SYPLYD A CP++S+    C K+GRPD  Y +++WKPDGC +P
Sbjct  38   GSLAECNLFQGSWVYDESYPLYDSASCPFISSIGFDCLKSGRPDRKYLQYRWKPDGCDLP  97

Query  540  RFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            RFD  +FL RMR K I  VGDSI +NQ
Sbjct  98   RFDGEDFLQRMRGKTITFVGDSISKNQ  124



>ref|XP_006488998.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=457

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +3

Query  354  SRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCT  533
            +R   L SCD   G+WV D S PLY P  CP++  A +C KNGRPDSDY K+KW+P GC 
Sbjct  104  NRIKKLSSCDIFNGQWVVDNSEPLYKPGSCPFIDEAFNCFKNGRPDSDYLKYKWRPIGCQ  163

Query  534  IPRFDALEFLGRMRRKRIMLVGDSIMRN  617
            +PRFD  + L  +R KR++ VGDS+ RN
Sbjct  164  LPRFDGGKMLEMLRGKRLVFVGDSLNRN  191



>ref|XP_002285609.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
 emb|CBI20119.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (59%), Gaps = 0/109 (0%)
 Frame = +3

Query  294  IEELSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCS  473
            I  +SWL   +   E S      A L  C+   G WV D ++PLY  + CP++     C 
Sbjct  15   IFLVSWLHESNAKVEGSSSDEVAAQLAGCNLYQGSWVIDDTFPLYQSSICPFIDKEFDCQ  74

Query  474  KNGRPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            KNGRPD  Y K++W+P GC +PRF+ +EFL R + KRIM VGDS+  NQ
Sbjct  75   KNGRPDKLYLKYRWRPSGCILPRFNGVEFLARYKGKRIMFVGDSLSLNQ  123



>ref|XP_006419433.1| hypothetical protein CICLE_v10006676mg [Citrus clementina]
 gb|ESR32673.1| hypothetical protein CICLE_v10006676mg [Citrus clementina]
Length=436

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +3

Query  357  RHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTI  536
            R   L SCD   G+WV D S PLY P  CP++  A +C KNGRPDSDY K+KW+P GC +
Sbjct  105  RIKKLSSCDIFNGQWVVDNSEPLYKPGSCPFIDEAFNCFKNGRPDSDYLKYKWRPIGCQL  164

Query  537  PRFDALEFLGRMRRKRIMLVGDSIMRN  617
            PRFD  + L  +R KR++ VGDS+ RN
Sbjct  165  PRFDGGKMLEMLRGKRLVFVGDSLNRN  191



>ref|XP_008451714.1| PREDICTED: protein trichome birefringence-like 31 [Cucumis melo]
Length=414

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +C+   GKW +D  SYPLY+   CP+L   V+C KNGRPDS Y+KW+W+P+ C +PRFDA
Sbjct  69   NCNLFEGKWEWDNASYPLYEEETCPFLVKQVTCQKNGRPDSFYKKWRWQPNSCNLPRFDA  128

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
            L+ L  +R KRIM VGDSI R Q
Sbjct  129  LKVLDILRDKRIMFVGDSIQRGQ  151



>gb|AGC11112.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11197.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11215.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11119.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11208.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11125.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>ref|XP_008456435.1| PREDICTED: protein trichome birefringence-like 37 [Cucumis melo]
Length=165

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            R C+   GKWVFD SYPLYD + CP++    +C K GRPD  Y K++W+P  C IPRF+ 
Sbjct  50   RKCNLYQGKWVFDSSYPLYDSSTCPFVDPQFNCQKYGRPDKSYLKYRWQPFACGIPRFNG  109

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
            L FL + R K+IM VGDS+  NQ
Sbjct  110  LNFLEKWRGKKIMFVGDSLSLNQ  132



>emb|CAN82331.1| hypothetical protein VITISV_007322 [Vitis vinifera]
Length=365

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 63/106 (59%), Gaps = 0/106 (0%)
 Frame = +3

Query  303  LSWLDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNG  482
            +SWL   +   E S      A L  C+   G WV D ++PLY  + CP++     C KNG
Sbjct  18   VSWLHESNAKVEGSSSDEVAAQLAGCNLYQGSWVIDDTFPLYQSSICPFIDKEFDCQKNG  77

Query  483  RPDSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            RPD  Y K++W+P GC +PRF+ +EFL R + KRIM VGDS+  NQ
Sbjct  78   RPDKLYLKYRWRPSGCILPRFNGVEFLARYKGKRIMFVGDSLSLNQ  123



>ref|XP_009359366.1| PREDICTED: protein trichome birefringence-like 41 [Pyrus x bretschneideri]
Length=366

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            CDF  G+WV DQSYPLY+ + CP++    +C KNGRPD  Y K++W+P  C + RFDAL+
Sbjct  46   CDFFKGRWVLDQSYPLYNTSSCPFIEHEFTCQKNGRPDQIYTKYRWQPHDCDLARFDALD  105

Query  558  FLGRMRRKRIMLVGDSIMRNQ  620
            F  R R K IM VGDS+ RNQ
Sbjct  106  FFERFRGKSIMFVGDSLSRNQ  126



>gb|AGC11120.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11115.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11122.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>ref|XP_004240405.1| PREDICTED: protein PMR5 [Solanum lycopersicum]
Length=428

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
            A+L SC    G WV+D++YPLY  + CP + +  +C   GRPD+DY K++WKP  C IPR
Sbjct  87   ANLTSCSLFMGSWVYDETYPLYQSSSCPIIDSQFNCQMYGRPDTDYLKYRWKPTNCEIPR  146

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+ L+FL RMR K IM VGDS+ RNQ
Sbjct  147  FNGLDFLLRMRGKTIMYVGDSLGRNQ  172



>gb|AGC11192.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>ref|XP_010913702.1| PREDICTED: protein trichome birefringence-like 5 [Elaeis guineensis]
Length=485

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = +3

Query  378  CDFSTGKWVFDQS--YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            CD   G+W  D+   YPLY P  CPY+  A SC +NGRPD DY KW+WKP  C +PRF+A
Sbjct  137  CDLFHGRWERDEEGWYPLYSPGSCPYVDEAFSCQENGRPDRDYLKWRWKPKDCDLPRFNA  196

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             +FL R+R KR+MLVGDS+ RNQ
Sbjct  197  ADFLERLRGKRLMLVGDSMNRNQ  219



>gb|AGC11164.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11104.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11106.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11107.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11108.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11110.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11111.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11113.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11116.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11117.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11118.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11124.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11126.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11134.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11135.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11137.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11138.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11139.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11140.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11141.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11142.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11143.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11145.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11148.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11149.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11150.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11151.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11152.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11153.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11154.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11156.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11157.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11159.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11162.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11165.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11170.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11171.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11172.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11173.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11174.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11175.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11176.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11178.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11179.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11180.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11181.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11183.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11184.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11185.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11189.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11190.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11191.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11193.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11195.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11196.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11200.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11201.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11202.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11203.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11206.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11211.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11214.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>gb|AGC11109.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11121.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11127.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11128.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11133.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11144.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11147.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11163.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11166.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11169.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11186.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11187.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11194.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11198.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11205.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11207.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11212.1| LRR receptor-like protein kinase, partial [Larix sibirica]
 gb|AGC11213.1| LRR receptor-like protein kinase, partial [Larix sibirica]
Length=272

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            D ++  V+ +      CD  +GKWV D SYPLY    C Y+S A  C +NGRPDS Y +W
Sbjct  81   DGKVYTVREKENPPIQCDIYSGKWVRDDSYPLYPAGECSYMSGAFDCKRNGRPDSGYTQW  140

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PR +A   L ++R KR+M +GDSI RNQ
Sbjct  141  RWQPRDCNLPRLNATNMLEKLRGKRLMFIGDSINRNQ  177



>ref|XP_010240099.1| PREDICTED: protein trichome birefringence-like 11 [Brachypodium 
distachyon]
Length=424

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  ASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
            A +  CDF  GKWV+D  YPLY+   CP++     CS+NGRPD+ Y KW+W+P  C +PR
Sbjct  53   AVVEECDFFDGKWVWDDKYPLYESKDCPFVDAGFRCSENGRPDTAYTKWRWQPSRCDLPR  112

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            FDA   L R+R KR++  GDSI RNQ
Sbjct  113  FDAKSMLERLRNKRVVFAGDSIGRNQ  138



>ref|XP_002271893.1| PREDICTED: protein trichome birefringence-like 4 [Vitis vinifera]
 emb|CBI22916.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  369  LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            L SCD   G WV D S P+Y P  CPY+  A +C KNGRPDSDY +++WKP GC IPRFD
Sbjct  114  LSSCDIFDGNWVLDDSEPVYPPGSCPYIDDAFNCFKNGRPDSDYLRFRWKPQGCQIPRFD  173

Query  549  ALEFLGRMRRKRIMLVGDSIMRN  617
              + L  +R KR+M VGDS+ RN
Sbjct  174  GRKMLKMLRGKRLMFVGDSLNRN  196



>ref|XP_010544965.1| PREDICTED: protein trichome birefringence-like 6 [Tarenaya hassleriana]
Length=481

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGC  530
            + +   +  CD + G+WV+D SYPLY  A CP++    SC  NGR DSDY KW+W+P  C
Sbjct  133  EKKAKGIEECDVTKGRWVYDDSYPLYANASCPFIDEGFSCQSNGRLDSDYMKWRWEPRDC  192

Query  531  TIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             IPRF+A + L  +R KR++ VGDSI RNQ
Sbjct  193  DIPRFNATKLLEMIRGKRLVFVGDSINRNQ  222



>ref|XP_006451732.1| hypothetical protein CICLE_v10009228mg [Citrus clementina]
 gb|ESR64972.1| hypothetical protein CICLE_v10009228mg [Citrus clementina]
Length=261

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFD-QSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            SC+ S GKW++D ++YP+Y    CPYLS   SC +NGRPDS +QKW+W+PDGC +P FD 
Sbjct  67   SCNVSGGKWIWDNKTYPVYTEESCPYLSNQTSCQRNGRPDSFHQKWRWQPDGCNLPWFDP  126

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
            L+ L  +  KR+M +GDSI R Q
Sbjct  127  LKLLDILSGKRLMFIGDSIQRGQ  149



>ref|XP_007133303.1| hypothetical protein PHAVU_011G168300g [Phaseolus vulgaris]
 gb|ESW05297.1| hypothetical protein PHAVU_011G168300g [Phaseolus vulgaris]
Length=343

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQS-YPLYDPAR-CPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
              CDFS G WV DQS YPLYD +R CP++    +C +NGRPD DY K++WKP GC +PRF
Sbjct  28   NGCDFSLGDWVLDQSHYPLYDASRDCPFIGHGFNCLRNGRPDQDYLKYRWKPSGCDLPRF  87

Query  546  DALEFLGRMRRKRIMLVGDSIMRN  617
            D ++FL + R K+IM VGDS+  N
Sbjct  88   DGVKFLEKYRGKKIMFVGDSLSNN  111



>ref|XP_004295668.1| PREDICTED: protein trichome birefringence-like 43 [Fragaria vesca 
subsp. vesca]
Length=370

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            SCD   G WV+D++YPLYD + CP++   V C KNGRPD  Y K++WKP GCT+PRF+  
Sbjct  48   SCDLFDGSWVYDETYPLYDTSSCPFIDREVDCQKNGRPDKQYLKYRWKPKGCTLPRFNGQ  107

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            + L R++ K+I+ VGDS+  NQ
Sbjct  108  DLLRRLKGKKILFVGDSLSYNQ  129



>ref|XP_006410237.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
 gb|ESQ51690.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
Length=365

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            RSC++  GKWV+D SYPLY P  CP++ +  +C K GRPD++YQ ++W+P  C++PRFD 
Sbjct  44   RSCNWFRGKWVYDSSYPLYSPFSCPFIDSEFNCQKAGRPDTNYQHFRWQPFSCSLPRFDG  103

Query  552  LEFLGRMRRKRIMLVGDSIMRN  617
              F+ RMR K+IM+VGDS+  N
Sbjct  104  ANFMRRMRGKKIMMVGDSLSLN  125



>ref|XP_010420901.1| PREDICTED: protein trichome birefringence-like 5 [Camelina sativa]
Length=493

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +3

Query  330  DDEISMV-QSRHASLRSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQ  503
            +D++  V Q+    +R CD   G WV D + YPLY P  CPY+  A  C +NGR DS Y 
Sbjct  133  EDKVESVDQAVVEKMRGCDLYRGSWVKDDAEYPLYQPGSCPYVDEAFDCQRNGRRDSGYL  192

Query  504  KWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             W+WKPDGC +PRF+A +FL ++R K ++LVGDS+ RNQ
Sbjct  193  NWRWKPDGCDLPRFNATDFLVKLRGKSLLLVGDSMNRNQ  231



>gb|KFK31236.1| hypothetical protein AALP_AA6G086200 [Arabis alpina]
Length=361

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            RSC++  GKWV+D SYPLY P  CP++ +  +C K GRPDS+YQ ++W+P  C++PRFD 
Sbjct  40   RSCNWFRGKWVYDSSYPLYSPYSCPFIDSEFNCQKAGRPDSNYQHFRWQPFSCSLPRFDG  99

Query  552  LEFLGRMRRKRIMLVGDSIMRN  617
              F+ +MR K+IMLVGDS+  N
Sbjct  100  GNFMRKMRGKKIMLVGDSLSLN  121



>gb|AFW70396.1| hypothetical protein ZEAMMB73_344849 [Zea mays]
 gb|AFW70397.1| hypothetical protein ZEAMMB73_344849 [Zea mays]
Length=255

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  333  DEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWK  512
            DE +  +S+ A   +CD   G+WV D S PLY    CP ++   +C  NGRPD DY+ W+
Sbjct  130  DEDTSNESQKAEQDNCDLYRGEWVTDSSGPLYTNNSCPIITQMQNCQGNGRPDKDYENWR  189

Query  513  WKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            WKP+ C +PRFDA +FL  MR K +  VGDS+ RNQ
Sbjct  190  WKPEQCNLPRFDARKFLELMRGKTLAFVGDSVARNQ  225



>ref|XP_006302323.1| hypothetical protein CARUB_v10020376mg [Capsella rubella]
 gb|EOA35221.1| hypothetical protein CARUB_v10020376mg [Capsella rubella]
Length=413

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            SC+   G+WV+D  SYPLY    CPYL    +C +NGRPDS+YQ W+WKP+ C +PRFDA
Sbjct  66   SCNVFEGQWVWDNVSYPLYTEKNCPYLVKQTTCQRNGRPDSNYQNWRWKPNSCDLPRFDA  125

Query  552  LEFLGRMRRKRIMLVGDSIMRN  617
            L+ L  +R KR+M +GDS+ R+
Sbjct  126  LKLLDVLRNKRLMFIGDSVQRS  147



>ref|XP_007149752.1| hypothetical protein PHAVU_005G096200g [Phaseolus vulgaris]
 gb|ESW21746.1| hypothetical protein PHAVU_005G096200g [Phaseolus vulgaris]
Length=367

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DDEISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKW  509
            +  +S + S       C+   GKWV+D SYPLYDP+ CP++    +C K GRPD+ YQK+
Sbjct  33   NANVSSLSSGRKLAGRCNLFRGKWVYDSSYPLYDPSTCPFIDPQFNCQKYGRPDTQYQKY  92

Query  510  KWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +W+P  C +PRF+A +FL + R K+IM VGDS+  NQ
Sbjct  93   RWQPFSCPLPRFNAFDFLSKYRGKKIMFVGDSLSLNQ  129



>ref|XP_004970447.1| PREDICTED: uncharacterized protein LOC101759220 isoform X1 [Setaria 
italica]
Length=540

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +CD S G+WVFD  SYPLY    C +L++ V+C KNGR D  YQKW+W+P+ C++PRFDA
Sbjct  186  TCDLSKGRWVFDNTSYPLYREEECEFLTSQVTCMKNGRRDDTYQKWRWQPNDCSMPRFDA  245

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
              F+ R+R KR M VGDS+ RNQ
Sbjct  246  KLFMERLRGKRFMFVGDSLNRNQ  268



>ref|XP_010038289.1| PREDICTED: protein trichome birefringence-like 6 [Eucalyptus 
grandis]
 gb|KCW50113.1| hypothetical protein EUGRSUZ_K03547 [Eucalyptus grandis]
Length=536

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             C+ + GKWV+D+SYPLY  A CP++     C  NGRPD D+ KW+W+P GC  PRF+A 
Sbjct  193  GCELTRGKWVYDESYPLYTNASCPFIDEGFDCEGNGRPDKDHAKWRWQPQGCDFPRFNAT  252

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
              L  +R KR++ VGDSI RNQ
Sbjct  253  TMLELLRGKRLVFVGDSINRNQ  274



>ref|XP_004970448.1| PREDICTED: uncharacterized protein LOC101759220 isoform X2 [Setaria 
italica]
Length=539

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +CD S G+WVFD  SYPLY    C +L++ V+C KNGR D  YQKW+W+P+ C++PRFDA
Sbjct  186  TCDLSKGRWVFDNTSYPLYREEECEFLTSQVTCMKNGRRDDTYQKWRWQPNDCSMPRFDA  245

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
              F+ R+R KR M VGDS+ RNQ
Sbjct  246  KLFMERLRGKRFMFVGDSLNRNQ  268



>ref|XP_008450807.1| PREDICTED: protein trichome birefringence-like 5 [Cucumis melo]
Length=482

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPR  542
             L+ CD   G WV D+  YP+Y    CPY+  A  C  NGR DS+Y KW+WKP GC +PR
Sbjct  130  GLKQCDLYMGTWVKDEEHYPIYKVGSCPYVDEAYDCGNNGRADSEYTKWRWKPYGCDLPR  189

Query  543  FDALEFLGRMRRKRIMLVGDSIMRNQ  620
            F+A +FL R+R KR+MLVGDS+ RNQ
Sbjct  190  FNATDFLVRLRGKRLMLVGDSMNRNQ  215



>ref|NP_180647.2| protein TRICHOME BIREFRINGENCE-LIKE 43 [Arabidopsis thaliana]
 sp|Q6DR10.1|TBL43_ARATH RecName: Full=Protein trichome birefringence-like 43 [Arabidopsis 
thaliana]
 gb|AAT69222.1| hypothetical protein At2g30900 [Arabidopsis thaliana]
 gb|AEC08454.1| trichome birefringence-like 43 protein [Arabidopsis thaliana]
Length=368

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            C+   G WV+D+SYPLYD   CP++    +C  NGRPDS+Y K++W+P GC +PRF+ L+
Sbjct  43   CNIYQGSWVYDKSYPLYDSKNCPFIERQFNCKSNGRPDSEYLKYRWQPSGCNLPRFNGLD  102

Query  558  FLGR-MRRKRIMLVGDSIMRNQ  620
            FLGR M+ K++M VGDS+  NQ
Sbjct  103  FLGRIMKGKKLMFVGDSLSLNQ  124



>ref|XP_006410189.1| hypothetical protein EUTSA_v10017902mg [Eutrema salsugineum]
 gb|ESQ51642.1| hypothetical protein EUTSA_v10017902mg [Eutrema salsugineum]
Length=314

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            C+   G WV+D+SYPLYD   CP++    SC  NGRPDSDY  ++W+P GC IPRF+ L+
Sbjct  42   CNIYRGSWVYDKSYPLYDSKSCPFIERQFSCKLNGRPDSDYLNYRWQPTGCNIPRFNGLD  101

Query  558  FLGR-MRRKRIMLVGDSIMRNQ  620
            FL R MR KR+M VGDS+  NQ
Sbjct  102  FLERIMRGKRMMFVGDSLSLNQ  123



>emb|CBI20118.3| unnamed protein product [Vitis vinifera]
Length=1354

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
             CDF  G WV D SYPLYD + CP++S  V C KNGRPD  Y K++W+P GCT+PRF+  
Sbjct  42   GCDFFKGTWVVDDSYPLYDSSICPFISPHVDCQKNGRPDKLYLKYRWQPHGCTLPRFNGE  101

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R + K+IM VGDS+  NQ
Sbjct  102  DFLKRFKGKKIMFVGDSLSENQ  123


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +3

Query  333   DEISMVQSRHASLRS--CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQK  506
             + I+ V      +RS  C++  G WV++ SYP YD ++CP++    +C KNGRPD +Y K
Sbjct  1206  EHINHVDHHTQIMRSNGCNWFLGSWVYNDSYPFYDASKCPFIRNGSNCLKNGRPDKEYLK  1265

Query  507   WKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
             +KWKP+ C +PRF+  +FL R + K+IM V DS+  NQ
Sbjct  1266  YKWKPNDCHLPRFNGEDFLKRFKGKKIMFVRDSLSENQ  1303



>gb|AAP22494.1| hypothetical protein At2g30900 [Arabidopsis thaliana]
Length=368

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            C+   G WV+D+SYPLYD   CP++    +C  NGRPDS+Y K++W+P GC +PRF+ L+
Sbjct  43   CNIYQGSWVYDKSYPLYDSKNCPFIERQFNCKSNGRPDSEYLKYRWQPSGCNLPRFNGLD  102

Query  558  FLGR-MRRKRIMLVGDSIMRNQ  620
            FLGR M+ K++M VGDS+  NQ
Sbjct  103  FLGRIMKGKKLMFVGDSLSLNQ  124



>ref|XP_008783901.1| PREDICTED: protein trichome birefringence-like 31 [Phoenix dactylifera]
Length=410

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +3

Query  360  HASLRSCDFSTGKWVFDQ--SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCT  533
            H   R C+   GKWV D+  S PLY    CPYL+  ++C +NGRPDS YQKW+WKP  C 
Sbjct  62   HVLDRRCNLFEGKWVLDEHNSRPLYTEDSCPYLTRQLTCQRNGRPDSLYQKWRWKPHSCD  121

Query  534  IPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            +PRFDA++ L  +R KR+M +GDSI R Q
Sbjct  122  LPRFDAVKLLESLRNKRLMFIGDSIQRTQ  150



>gb|AAC20724.1| hypothetical protein [Arabidopsis thaliana]
Length=367

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  378  CDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDALE  557
            C+   G WV+D+SYPLYD   CP++    +C  NGRPDS+Y K++W+P GC +PRF+ L+
Sbjct  42   CNIYQGSWVYDKSYPLYDSKNCPFIERQFNCKSNGRPDSEYLKYRWQPSGCNLPRFNGLD  101

Query  558  FLGR-MRRKRIMLVGDSIMRNQ  620
            FLGR M+ K++M VGDS+  NQ
Sbjct  102  FLGRIMKGKKLMFVGDSLSLNQ  123



>emb|CDP05987.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
             C+   GKWV+D  SYPLY    CPYL   V+C KNGRPDS YQ W+W+P+GC +PRFDA
Sbjct  70   GCNVFEGKWVWDNLSYPLYREDSCPYLVKQVTCLKNGRPDSLYQNWRWQPNGCNLPRFDA  129

Query  552  LEFLGRMRRKRIMLVGDSIMR  614
            L+ L  +R KR+M +GDSI R
Sbjct  130  LKLLEILRDKRLMFIGDSIQR  150



>ref|XP_003564532.1| PREDICTED: protein trichome birefringence-like 28 [Brachypodium 
distachyon]
Length=539

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +CD S G+WVFD  SYPLY    C +L++ V+C KNGR D  YQKW+W+P+ C++PRFDA
Sbjct  182  TCDLSKGEWVFDNASYPLYREEECTFLTSQVTCMKNGRRDDTYQKWRWQPNDCSMPRFDA  241

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
              F+ R+R KR M VGDS+ RNQ
Sbjct  242  KLFMERLRGKRFMFVGDSLNRNQ  264



>ref|XP_008235216.1| PREDICTED: protein trichome birefringence-like 6 [Prunus mume]
Length=510

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +3

Query  339  ISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWK  518
            +S  Q  +  +R CDF+ G+WV+D+SYPLY    CP++    +C  NGR D DY K +W+
Sbjct  186  LSGGQVENKRVRGCDFTRGRWVYDESYPLYTNGSCPFIDEGFNCQGNGRLDKDYMKLRWQ  245

Query  519  PDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            P  C IPRF+A + L  +R KR++ VGDSI RNQ
Sbjct  246  PQDCDIPRFNATKMLELIRGKRLVFVGDSINRNQ  279



>dbj|BAK06236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=387

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            +CD S G+WVFD  SYPLY    C +L++ V+C KNGR D +YQKW+W+P  C +PRFDA
Sbjct  178  TCDLSRGEWVFDNASYPLYREEECSFLTSQVTCMKNGRRDDNYQKWRWQPKECDMPRFDA  237

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
              F+ R+R KR M VGDS+ RNQ
Sbjct  238  KLFIERLRNKRFMFVGDSLNRNQ  260



>ref|XP_002527690.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34689.1| conserved hypothetical protein [Ricinus communis]
Length=537

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            ++C+   G WV D+  YP+Y P+ CPY+  A  C  NGR DSDY KW+WKPD C +PRF+
Sbjct  188  KNCNLYMGTWVKDEEHYPIYKPSSCPYVDEAFDCQSNGRRDSDYLKWRWKPDTCDLPRFN  247

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            + +FL R+R KR+MLVGDS+ RNQ
Sbjct  248  STDFLTRLRGKRLMLVGDSMNRNQ  271



>ref|XP_007217300.1| hypothetical protein PRUPE_ppa018693mg [Prunus persica]
 gb|EMJ18499.1| hypothetical protein PRUPE_ppa018693mg [Prunus persica]
Length=359

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  369  LRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFD  548
            L+ CD   G+WV+D SYPLYD + C ++  A +C KNGR D  Y K+KW+P  C +PRFD
Sbjct  32   LKKCDIYQGRWVYDASYPLYDSSLCSFIENAFACQKNGRADELYLKYKWQPFACKLPRFD  91

Query  549  ALEFLGRMRRKRIMLVGDSIMRNQ  620
            A +FL R R KRIM VGDS+  NQ
Sbjct  92   AEDFLERFRDKRIMFVGDSLSLNQ  115



>ref|XP_010473941.1| PREDICTED: protein trichome birefringence-like 43 [Camelina sativa]
Length=362

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +3

Query  336  EISMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKW  515
            E ++V+  H   +SC+   G WV+DQSYPLYD   CP++    +C  NGR DS+Y K++W
Sbjct  24   ESAIVKKPHR--KSCNIYIGNWVYDQSYPLYDSKTCPFIEKQFNCKPNGRLDSEYLKYRW  81

Query  516  KPDGCTIPRFDALEFLGR-MRRKRIMLVGDSIMRNQ  620
            +P GC +PRF+ L+FLGR MR K++M VGDS   NQ
Sbjct  82   QPSGCNLPRFNGLDFLGRIMRGKKLMFVGDSRSLNQ  117



>ref|XP_010911005.1| PREDICTED: protein trichome birefringence-like 39, partial [Elaeis 
guineensis]
Length=167

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  SCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDAL  554
            SCDF  G WV+D +YP+YD   CP++     C K GRPD  Y K++W+P+ C +PRF+ L
Sbjct  55   SCDFFQGSWVYDDTYPIYDSLSCPFVEPEFDCQKYGRPDKLYLKYRWRPNACDLPRFNGL  114

Query  555  EFLGRMRRKRIMLVGDSIMRNQ  620
            +FL R R K+IM VGDSI +NQ
Sbjct  115  DFLERWRGKKIMFVGDSISQNQ  136



>emb|CDY24924.1| BnaC03g22480D [Brassica napus]
Length=419

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = +3

Query  312  LDGDDHDDEISMVQSRHASLRSCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRP  488
            L  ++ + +I +V     SL  CD  TGKWV D  ++PLY    C +LS  V+C++NGRP
Sbjct  50   LQEENKEKKIGLV-----SLEVCDVFTGKWVLDNVTHPLYKEDECEFLSEWVACTRNGRP  104

Query  489  DSDYQKWKWKPDGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            DS YQKW+W+P  C++PRFDA   L ++R K++M +GDSI  NQ
Sbjct  105  DSKYQKWRWQPRDCSLPRFDAKPLLEKLRGKKLMFIGDSIHYNQ  148



>ref|XP_010917266.1| PREDICTED: protein trichome birefringence [Elaeis guineensis]
Length=678

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  366  SLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRF  545
            +L+SCD   G WV D SYPLY    CP++    +C  NGRPD  YQK +WKPDGC IPR 
Sbjct  326  ALKSCDIFQGNWVKDDSYPLYPEGSCPHIDEPFNCYLNGRPDRAYQKLRWKPDGCDIPRL  385

Query  546  DALEFLGRMRRKRIMLVGDSIMRN  617
            +A + L R+R KR++ VGDS+ RN
Sbjct  386  NATDMLERLREKRLVFVGDSLNRN  409



>ref|XP_008655378.1| PREDICTED: uncharacterized protein LOC100501717 isoform X1 [Zea 
mays]
 gb|AFW81660.1| putative DUF231 domain containing family protein [Zea mays]
Length=514

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  351  QSRHASLRSCDFSTGKWVFDQS-YPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDG  527
            Q +  +  +CD   G+WV+D+S  PLY  + C +L+  V+C++NGR D DYQKW+W+PDG
Sbjct  147  QEQDQAQGTCDLYKGRWVYDESRAPLYKESECSFLTEQVTCTRNGRRDDDYQKWRWQPDG  206

Query  528  CTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
            C +PRF+A   L ++R KR+M VGDS+ RNQ
Sbjct  207  CDLPRFEAKLLLEKLRNKRLMFVGDSLNRNQ  237



>ref|XP_009802920.1| PREDICTED: protein trichome birefringence-like 43 [Nicotiana 
sylvestris]
Length=350

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  RSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
              CD   G W+FD SYPLY+ + CP++  +  C KNGRPD +Y K++W+P GC +PRF+ 
Sbjct  43   NGCDIYKGSWIFDDSYPLYNSSTCPFIEESWDCQKNGRPDEEYLKYRWQPYGCNLPRFNG  102

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
             EFL + + KRIM VGDS+ +NQ
Sbjct  103  TEFLLKYKGKRIMFVGDSLGQNQ  125



>ref|XP_006451733.1| hypothetical protein CICLE_v10008349mg [Citrus clementina]
 gb|ESR64973.1| hypothetical protein CICLE_v10008349mg [Citrus clementina]
Length=432

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  375  SCDFSTGKWVFDQ-SYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKPDGCTIPRFDA  551
            SC+   GKW++D  +YPLY    CPYL    +C +NGRPDS YQ W+W+PDGC +PRFD 
Sbjct  86   SCNVFEGKWIWDNVTYPLYSEESCPYLVKQTTCQRNGRPDSFYQNWRWQPDGCKLPRFDP  145

Query  552  LEFLGRMRRKRIMLVGDSIMRNQ  620
            L+ L  +R KR+M +GDS+ R Q
Sbjct  146  LKLLDILRGKRLMFIGDSVQRGQ  168



>ref|XP_003540392.1| PREDICTED: protein YLS7 isoform 1 [Glycine max]
 gb|KHN27931.1| hypothetical protein glysoja_007663 [Glycine soja]
Length=375

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +3

Query  342  SMVQSRHASLRSCDFSTGKWVFDQSYPLYDPARCPYLSTAVSCSKNGRPDSDYQKWKWKP  521
            S    R      C+   GKWV+D SYPLYDP+ CP++    +C K GRPD  YQK++W+P
Sbjct  45   SFSSGRKLGAGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDKQYQKYRWQP  104

Query  522  DGCTIPRFDALEFLGRMRRKRIMLVGDSIMRNQ  620
              C +PRF+A +FL + R K+IM VGDS+  NQ
Sbjct  105  FSCPLPRFNAFDFLAKYRGKKIMFVGDSLSLNQ  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950