BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050D22

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    328   2e-104   Nicotiana tomentosiformis
ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    325   1e-103   Nicotiana sylvestris
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    320   4e-101   Solanum tuberosum [potatoes]
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    318   9e-101   Vitis vinifera
emb|CAN71280.1|  hypothetical protein VITISV_027089                     318   2e-100   Vitis vinifera
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    318   2e-100   Solanum lycopersicum
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   314   1e-99    Citrus sinensis [apfelsine]
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    315   2e-99    
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             315   2e-99    
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     310   1e-97    Eucalyptus grandis [rose gum]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    310   2e-97    Eucalyptus grandis [rose gum]
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    309   2e-97    Solanum tuberosum [potatoes]
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             305   4e-96    
ref|XP_007051240.1|  TolB protein-related isoform 1                     307   4e-96    
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    305   5e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg             305   8e-96    Capsella rubella
gb|AAM13860.1|  unknown protein                                         305   8e-96    Arabidopsis thaliana [mouse-ear cress]
gb|KCW58167.1|  hypothetical protein EUGRSUZ_H008852                    293   8e-96    Eucalyptus grandis [rose gum]
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             303   1e-95    
ref|NP_192096.1|  tolB-related protein                                  305   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    305   1e-95    Solanum lycopersicum
ref|XP_002515212.1|  conserved hypothetical protein                     304   2e-95    Ricinus communis
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    304   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922    303   2e-95    Camelina sativa [gold-of-pleasure]
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                303   2e-95    Erythranthe guttata [common monkey flower]
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    301   1e-94    Cucumis melo [Oriental melon]
ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    302   3e-94    
emb|CDP01464.1|  unnamed protein product                                301   6e-94    Coffea canephora [robusta coffee]
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     299   1e-93    Eucalyptus grandis [rose gum]
ref|XP_010091406.1|  hypothetical protein L484_013861                   299   1e-93    
gb|KDP28318.1|  hypothetical protein JCGZ_14089                         299   4e-93    Jatropha curcas
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                    297   8e-93    Arabis alpina [alpine rockcress]
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    297   8e-93    Elaeis guineensis
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    297   1e-92    Fragaria vesca subsp. vesca
emb|CDX74396.1|  BnaA03g26510D                                          296   2e-92    
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    295   2e-92    Cucumis sativus [cucumbers]
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    294   8e-92    Brassica rapa
gb|KJB09508.1|  hypothetical protein B456_001G146700                    294   3e-91    Gossypium raimondii
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    290   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    287   5e-89    Phoenix dactylifera
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             286   8e-89    
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    285   2e-88    Sesamum indicum [beniseed]
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    285   2e-87    Prunus mume [ume]
ref|NP_001060406.1|  Os07g0638100                                       282   4e-87    
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199    281   9e-87    Brachypodium distachyon [annual false brome]
gb|EAZ04851.1|  hypothetical protein OsI_27029                          279   7e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    279   8e-86    Zea mays [maize]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949    276   6e-85    
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          277   6e-85    Sorghum bicolor [broomcorn]
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    275   7e-84    Pyrus x bretschneideri [bai li]
dbj|BAJ89339.1|  predicted protein                                      273   8e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    273   1e-83    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ94262.1|  predicted protein                                      272   4e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    271   8e-83    Setaria italica
ref|XP_010456117.1|  PREDICTED: uncharacterized protein LOC104737601    260   4e-81    
ref|XP_006840287.1|  hypothetical protein AMTR_s00045p00058330          265   7e-81    
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             263   1e-79    Phaseolus vulgaris [French bean]
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    263   3e-79    Glycine max [soybeans]
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    261   3e-79    Cicer arietinum [garbanzo]
gb|EPS68684.1|  hypothetical protein M569_06083                         252   9e-76    Genlisea aurea
ref|XP_003637686.1|  Protein tolB                                       251   3e-75    
ref|XP_006840288.1|  hypothetical protein AMTR_s00045p00058890          246   1e-73    Amborella trichopoda
gb|AJD80981.1|  ABA-activated 1 protein                                 246   2e-73    Lupinus luteus
ref|XP_002515210.1|  conserved hypothetical protein                     241   6e-72    
ref|XP_003637684.1|  Protein tolB                                       240   4e-71    
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622             212   2e-60    
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782             193   2e-53    Selaginella moellendorffii
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603             193   2e-53    
gb|ABR17080.1|  unknown                                                 192   4e-53    Picea sitchensis
ref|XP_003630471.1|  Protein tolB                                       191   5e-53    
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g             190   2e-52    Phaseolus vulgaris [French bean]
dbj|BAJ88545.1|  predicted protein                                      189   4e-52    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865    188   8e-52    Glycine max [soybeans]
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein                188   9e-52    
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                    187   1e-51    Arabis alpina [alpine rockcress]
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160    188   1e-51    
gb|KJB29176.1|  hypothetical protein B456_005G088400                    187   2e-51    Gossypium raimondii
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729    187   3e-51    Zea mays [maize]
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...    186   4e-51    Tarenaya hassleriana [spider flower]
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...    186   4e-51    Tarenaya hassleriana [spider flower]
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753    186   5e-51    Solanum tuberosum [potatoes]
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505    186   5e-51    Camelina sativa [gold-of-pleasure]
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg             186   9e-51    Capsella rubella
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730    185   1e-50    Setaria italica
emb|CDY08186.1|  BnaA06g15400D                                          185   1e-50    Brassica napus [oilseed rape]
emb|CDP10971.1|  unnamed protein product                                185   1e-50    Coffea canephora [robusta coffee]
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406             185   1e-50    
emb|CDX84088.1|  BnaC08g07650D                                          185   1e-50    
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655    185   1e-50    Nelumbo nucifera [Indian lotus]
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010    185   1e-50    Brassica rapa
emb|CDY04662.1|  BnaC05g17000D                                          185   1e-50    
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096    184   2e-50    Cicer arietinum [garbanzo]
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                   184   2e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456    184   2e-50    Sesamum indicum [beniseed]
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg                184   3e-50    Erythranthe guttata [common monkey flower]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324    183   5e-50    Solanum lycopersicum
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          182   6e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058    183   7e-50    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP10970.1|  unnamed protein product                                183   7e-50    Coffea canephora [robusta coffee]
gb|EAZ29242.1|  hypothetical protein OsJ_13305                          182   1e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002520326.1|  conserved hypothetical protein                     182   2e-49    Ricinus communis
ref|NP_001051846.1|  Os03g0840200                                       182   2e-49    
ref|XP_006434259.1|  hypothetical protein CICLE_v10000425mg             182   2e-49    Citrus clementina [clementine]
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763    182   2e-49    Populus euphratica
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760    182   2e-49    Populus euphratica
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg             182   2e-49    Eutrema salsugineum [saltwater cress]
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880          181   2e-49    Sorghum bicolor [broomcorn]
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g             181   3e-49    Populus trichocarpa [western balsam poplar]
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288    181   3e-49    Camelina sativa [gold-of-pleasure]
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528    181   3e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880    181   4e-49    Nicotiana tomentosiformis
ref|XP_006472827.1|  PREDICTED: uncharacterized protein LOC102617553    181   5e-49    Citrus sinensis [apfelsine]
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978    180   5e-49    Nicotiana sylvestris
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                   180   6e-49    Citrus sinensis [apfelsine]
ref|XP_010269111.1|  PREDICTED: uncharacterized protein LOC104605872    179   8e-49    Nelumbo nucifera [Indian lotus]
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814    179   1e-48    Vitis vinifera
emb|CAN73514.1|  hypothetical protein VITISV_037210                     179   2e-48    Vitis vinifera
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    179   2e-48    Eucalyptus grandis [rose gum]
gb|EAY92514.1|  hypothetical protein OsI_14253                          178   3e-48    Oryza sativa Indica Group [Indian rice]
gb|KDP32822.1|  hypothetical protein JCGZ_12114                         177   7e-48    Jatropha curcas
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336    177   9e-48    Elaeis guineensis
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088    177   1e-47    Cucumis melo [Oriental melon]
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890    176   1e-47    Pyrus x bretschneideri [bai li]
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474    176   1e-47    Fragaria vesca subsp. vesca
ref|XP_007223068.1|  hypothetical protein PRUPE_ppa003730mg             175   2e-47    
ref|XP_001780675.1|  predicted protein                                  174   7e-47    
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727    172   3e-46    
ref|XP_004160721.1|  PREDICTED: protein TolB-like                       172   4e-46    
ref|XP_008219596.1|  PREDICTED: uncharacterized protein LOC103319783    172   5e-46    Prunus mume [ume]
ref|XP_004149439.1|  PREDICTED: protein TolB-like                       172   6e-46    Cucumis sativus [cucumbers]
ref|XP_010095431.1|  hypothetical protein L484_013388                   170   2e-45    
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673    157   6e-41    Tarenaya hassleriana [spider flower]
ref|XP_006652005.1|  PREDICTED: uncharacterized protein LOC102702184    153   2e-40    
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    153   3e-39    
gb|EAY93383.1|  hypothetical protein OsI_15178                          149   2e-38    Oryza sativa Indica Group [Indian rice]
emb|CBI18981.3|  unnamed protein product                                145   5e-37    Vitis vinifera
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...    146   9e-37    Camelina sativa [gold-of-pleasure]
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097    146   9e-37    Camelina sativa [gold-of-pleasure]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...    146   1e-36    
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018    146   1e-36    Camelina sativa [gold-of-pleasure]
ref|NP_564146.1|  uncharacterized protein                               144   4e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405             143   1e-35    Arabidopsis lyrata subsp. lyrata
ref|XP_002520327.1|  conserved hypothetical protein                     137   3e-34    
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg             139   4e-34    Eutrema salsugineum [saltwater cress]
emb|CDY04661.1|  BnaC05g16990D                                          135   1e-32    
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                    134   2e-32    Arabis alpina [alpine rockcress]
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008    133   4e-32    Brassica rapa
emb|CDY08187.1|  BnaA06g15390D                                          133   4e-32    Brassica napus [oilseed rape]
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...    130   8e-31    Coccomyxa subellipsoidea C-169
gb|EMT16880.1|  hypothetical protein F775_15390                         124   1e-29    
ref|NP_001173830.1|  Os04g0278101                                       114   3e-26    
ref|XP_002467956.1|  hypothetical protein SORBIDRAFT_01g037140          116   6e-26    
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                     114   3e-25    Eucalyptus grandis [rose gum]
ref|XP_010676032.1|  PREDICTED: uncharacterized protein LOC104891942    108   2e-23    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT08438.1|  hypothetical protein F775_30261                         107   6e-23    
ref|XP_010675836.1|  PREDICTED: uncharacterized protein LOC104891779    105   4e-22    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002446045.1|  hypothetical protein SORBIDRAFT_06g000930          104   7e-22    Sorghum bicolor [broomcorn]
ref|XP_010102639.1|  hypothetical protein L484_010931                   104   7e-22    Morus notabilis
ref|XP_004963491.1|  PREDICTED: uncharacterized protein LOC101774581    103   1e-21    Setaria italica
ref|XP_004960704.1|  PREDICTED: uncharacterized protein LOC101777811    103   2e-21    Setaria italica
gb|EMS54560.1|  hypothetical protein TRIUR3_19354                     96.7    2e-21    Triticum urartu
ref|XP_010675829.1|  PREDICTED: uncharacterized protein LOC104891772    103   2e-21    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002519807.1|  conserved hypothetical protein                     102   3e-21    
dbj|BAJ92843.1|  predicted protein                                      102   5e-21    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001049934.1|  Os03g0314500                                       102   5e-21    
gb|EAY89757.1|  hypothetical protein OsI_11300                          102   5e-21    Oryza sativa Indica Group [Indian rice]
ref|XP_002519802.1|  conserved hypothetical protein                     101   6e-21    Ricinus communis
ref|XP_008662981.1|  PREDICTED: uncharacterized protein LOC103641407    100   2e-20    Zea mays [maize]
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                   99.8    2e-20    Eucalyptus grandis [rose gum]
ref|XP_002524160.1|  conserved hypothetical protein                   99.8    3e-20    Ricinus communis
gb|EAY90391.1|  hypothetical protein OsI_11968                        99.8    3e-20    Oryza sativa Indica Group [Indian rice]
ref|XP_002524154.1|  conserved hypothetical protein                   98.6    8e-20    Ricinus communis
ref|XP_010097765.1|  hypothetical protein L484_023906                 98.6    8e-20    Morus notabilis
gb|EMT14934.1|  hypothetical protein F775_30553                       98.2    9e-20    
gb|EAZ27259.1|  hypothetical protein OsJ_11196                        98.2    1e-19    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676033.1|  PREDICTED: uncharacterized protein LOC104891943  98.2    1e-19    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001050324.1|  Os03g0403400                                     97.8    1e-19    
gb|EMT19136.1|  hypothetical protein F775_12749                       97.4    2e-19    
ref|XP_002437598.1|  hypothetical protein SORBIDRAFT_10g030220        97.1    2e-19    Sorghum bicolor [broomcorn]
gb|EMS49561.1|  hypothetical protein TRIUR3_11240                     96.3    3e-19    Triticum urartu
ref|WP_041858684.1|  hypothetical protein                             96.3    3e-19    
gb|ABJ88479.1|  WD40 domain protein beta Propeller                    96.7    3e-19    Candidatus Solibacter usitatus Ellin6076
ref|XP_010675830.1|  PREDICTED: uncharacterized protein LOC104891773  97.1    3e-19    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004980674.1|  PREDICTED: uncharacterized protein LOC101756594  97.1    3e-19    Setaria italica
ref|XP_010675837.1|  PREDICTED: uncharacterized protein LOC104891780  96.3    4e-19    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK07068.1|  predicted protein                                    95.9    6e-19    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010087211.1|  hypothetical protein L484_006140                 95.5    7e-19    Morus notabilis
ref|XP_010105408.1|  hypothetical protein L484_008562                 92.0    3e-18    
ref|XP_010097467.1|  hypothetical protein L484_024672                 92.8    6e-18    
gb|EMT29283.1|  hypothetical protein F775_17496                       92.8    7e-18    
gb|AEW08691.1|  hypothetical protein CL1213Contig1_01                 85.5    1e-17    Pinus lambertiana
ref|XP_003575792.1|  PREDICTED: uncharacterized protein LOC100821131  92.0    1e-17    Brachypodium distachyon [annual false brome]
ref|XP_010097483.1|  hypothetical protein L484_024689                 91.7    2e-17    Morus notabilis
ref|XP_010235117.1|  PREDICTED: uncharacterized protein LOC100846313  91.7    2e-17    
ref|WP_035092853.1|  hypothetical protein                             91.3    2e-17    Caulobacter henricii
ref|XP_010102640.1|  hypothetical protein L484_010932                 90.1    5e-17    Morus notabilis
ref|XP_003574472.1|  PREDICTED: uncharacterized protein LOC100838501  89.7    7e-17    Brachypodium distachyon [annual false brome]
gb|AEW08692.1|  hypothetical protein CL1213Contig1_01                 83.2    9e-17    Pinus radiata
gb|AFG48602.1|  hypothetical protein CL1213Contig1_01                 82.8    9e-17    Pinus taeda
gb|EJL34752.1|  periplasmic component of the Tol biopolymer trans...  89.0    1e-16    Caulobacter sp. AP07
gb|EMT06488.1|  hypothetical protein F775_06751                       87.8    3e-16    
gb|AFG48601.1|  hypothetical protein CL1213Contig1_01                 81.3    4e-16    Pinus taeda
emb|CDM86908.1|  unnamed protein product                              86.7    7e-16    Triticum aestivum [Canadian hard winter wheat]
ref|WP_020604165.1|  hypothetical protein                             86.3    8e-16    Spirosoma spitsbergense
gb|AFK45973.1|  unknown                                               79.7    1e-15    Medicago truncatula
ref|WP_029915040.1|  hypothetical protein                             85.1    2e-15    Caulobacter sp. UNC358MFTsu5.1
gb|KFY81759.1|  hypothetical protein V500_11119                       84.3    4e-15    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ03462.1|  hypothetical protein V502_10931                       84.3    4e-15    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|EJE50504.1|  periplasmic component of the Tol biopolymer trans...  84.0    5e-15    Acidovorax sp. CF316
ref|WP_035205184.1|  hypothetical protein                             84.0    5e-15    Acidovorax
ref|NP_001066679.1|  Os12g0431300                                     84.0    6e-15    
ref|WP_006298539.1|  hypothetical protein                             83.2    8e-15    
emb|CAE05101.3|  OSJNBa0009K15.21                                     78.6    8e-15    Oryza sativa Japonica Group [Japonica rice]
gb|KFY12538.1|  hypothetical protein V491_06750                       83.2    9e-15    Pseudogymnoascus sp. VKM F-3775
gb|AFB33555.1|  hypothetical protein 2_7121_02                        78.6    1e-14    Pinus mugo [mountain pine]
gb|AFG49274.1|  hypothetical protein 2_7121_02                        77.8    2e-14    Pinus taeda
gb|AEW08359.1|  hypothetical protein 2_7121_02                        77.8    2e-14    Pinus radiata
ref|XP_010091904.1|  hypothetical protein L484_001053                 77.8    4e-14    
gb|EKD68537.1|  Periplasmic component of the Tol biopolymer trans...  80.9    6e-14    uncultured bacterium
ref|WP_043399319.1|  tolB protein precursor protein                   79.0    6e-14    
gb|AFB33550.1|  hypothetical protein 2_7121_02                        76.3    7e-14    Larix decidua
ref|WP_034400879.1|  translocation protein TolB                       79.7    7e-14    
gb|AFB33549.1|  hypothetical protein 2_7121_02                        76.3    8e-14    Abies alba [abete-blanco]
gb|AEW08360.1|  hypothetical protein 2_7121_02                        76.3    8e-14    Pinus lambertiana
gb|KFY42678.1|  hypothetical protein V495_04387                       80.1    9e-14    Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|AFB33553.1|  hypothetical protein 2_7121_02                        75.5    1e-13    Pinus cembra [Arve]
ref|XP_001545913.1|  hypothetical protein BC1G_15641                  79.7    1e-13    Botrytis cinerea B05.10
gb|KFX90155.1|  hypothetical protein V490_06619                       79.3    2e-13    Pseudogymnoascus sp. VKM F-3557
gb|KFY02373.1|  hypothetical protein O988_02191                       79.3    2e-13    Pseudogymnoascus sp. VKM F-3808
ref|WP_033378529.1|  MULTISPECIES: hypothetical protein               76.6    2e-13    
gb|KFY15902.1|  hypothetical protein V492_01680                       79.0    3e-13    Pseudogymnoascus sp. VKM F-4246
ref|WP_040479380.1|  translocation protein TolB                       76.6    3e-13    
gb|EMS34061.1|  tolB protein precursor, periplasmic protein invol...  77.0    3e-13    Mariniradius saccharolyticus AK6
gb|KFY74302.1|  hypothetical protein V499_05663                       78.2    4e-13    Pseudogymnoascus sp. VKM F-103
gb|KFZ05841.1|  hypothetical protein V501_07970                       77.4    7e-13    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
emb|CAI78611.1|  tolB protein                                         76.6    8e-13    uncultured delta proteobacterium
gb|ENH85242.1|  WD40 domain protein beta propeller                    77.0    8e-13    
gb|KFY39698.1|  hypothetical protein V494_03875                       77.0    1e-12    Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|WP_020383615.1|  hypothetical protein                             75.1    1e-12    
ref|WP_041305462.1|  hypothetical protein                             73.2    1e-12    
gb|ETI58852.1|  hypothetical protein C100_22665                       76.3    2e-12    Sphingobium sp. C100
ref|WP_041569562.1|  hypothetical protein                             74.7    2e-12    
ref|WP_031310342.1|  hypothetical protein                             76.3    2e-12    Sphingobium sp. C100
ref|WP_026842125.1|  translocation protein TolB                       75.5    2e-12    Geobacter bremensis
gb|AHG92466.1|  WD40-like beta Propeller containing protein           75.9    2e-12    Gemmatirosa kalamazoonesis
gb|AEP11793.1|  Periplasmic component of the Tol biopolymer trans...  74.7    2e-12    Chloracidobacterium thermophilum B
ref|WP_015838788.1|  translocation protein TolB                       75.1    3e-12    Geobacter sp. M21
ref|XP_007914327.1|  putative tat pathway signal sequence domain-...  75.5    3e-12    Phaeoacremonium minimum UCRPA7
ref|WP_027978304.1|  hypothetical protein                             75.5    3e-12    
ref|WP_026159723.1|  hypothetical protein                             73.6    3e-12    
ref|WP_035035180.1|  hypothetical protein                             75.1    4e-12    
gb|AHI25037.1|  hypothetical protein H845_1092                        75.1    4e-12    Komagataeibacter xylinus E25
gb|ABX03625.1|  WD40 domain protein beta Propeller                    73.6    4e-12    Herpetosiphon aurantiacus DSM 785
ref|WP_000615434.1|  hypothetical protein                             73.2    4e-12    
ref|WP_025438063.1|  hypothetical protein                             75.1    4e-12    Komagataeibacter xylinus
ref|WP_015754374.1|  translocation protein TolB                       73.2    4e-12    Robiginitalea biformata
ref|WP_027716026.1|  translocation protein TolB                       74.3    5e-12    Desulfuromonas sp. TF
ref|WP_020384321.1|  hypothetical protein                             73.2    5e-12    
ref|WP_020383555.1|  hypothetical protein                             73.2    6e-12    
ref|WP_030901696.1|  hypothetical protein                             74.7    6e-12    Streptomyces sp. NRRL F-5126
ref|WP_041576117.1|  translocation protein TolB                       73.9    6e-12    
gb|AGH96540.1|  adventurous gliding motility protein W                73.9    7e-12    Bdellovibrio exovorus JSS
ref|WP_013226661.1|  translocation protein TolB                       74.7    7e-12    Amycolatopsis mediterranei
emb|CBH22796.1|  TolB protein precursor                               73.9    8e-12    Salinibacter ruber M8
gb|KEZ20905.1|  Periplasmic component of the Tol biopolymer trans...  73.9    1e-11    Sphingobium yanoikuyae
ref|WP_037517431.1|  hypothetical protein                             73.9    1e-11    Sphingobium yanoikuyae
ref|WP_025779649.1|  hypothetical protein                             70.9    1e-11    
ref|WP_012831477.1|  hypothetical protein                             72.8    1e-11    Haliangium ochraceum
gb|ESZ89568.1|  hypothetical protein SBOR_10048                       73.6    1e-11    Sclerotinia borealis F-4128
gb|EJK81239.1|  periplasmic component of the Tol biopolymer trans...  73.6    1e-11    Sphingobium sp. AP49
ref|WP_015718924.1|  translocation protein TolB                       72.8    1e-11    
ref|WP_041978883.1|  hypothetical protein                             72.4    1e-11    
ref|WP_037486764.1|  hypothetical protein                             73.2    1e-11    
dbj|GAA89133.1|  tat pathway signal sequence domain-containing pr...  73.2    2e-11    Aspergillus kawachii IFO 4308
emb|CDM66426.1|  periplasmic component of the Tol biopolymer tran...  72.0    2e-11    Pyrinomonas methylaliphatogenes
ref|XP_007835900.1|  hypothetical protein PFICI_09128                 72.8    2e-11    Pestalotiopsis fici W106-1
ref|WP_044595669.1|  hypothetical protein                             71.6    2e-11    
ref|WP_039744998.1|  translocation protein TolB                       72.4    2e-11    Geobacter pickeringii
ref|WP_012531942.1|  translocation protein TolB                       72.0    2e-11    Geobacter bemidjiensis
dbj|GAK58097.1|  WD40-like Beta Propeller                             72.4    2e-11    
ref|XP_007798560.1|  putative tat pathway signal sequence domain-...  72.8    2e-11    
ref|XP_010094534.1|  hypothetical protein L484_024827                 69.7    3e-11    
ref|WP_033198113.1|  WD40 domain protein beta propeller               70.5    3e-11    
ref|WP_012115032.1|  beta-propeller repeat-containing to-pal syst...  72.0    3e-11    
ref|WP_019091574.1|  hypothetical protein                             72.4    3e-11    
dbj|BAL54994.1|  TolB protein                                         70.9    3e-11    
ref|WP_036546999.1|  hypothetical protein                             70.1    3e-11    
ref|WP_010509656.1|  hypothetical protein                             72.4    3e-11    
ref|WP_019086650.1|  hypothetical protein                             72.4    3e-11    
gb|KEQ78669.1|  tricorn protease N-terminal domain-containing pro...  72.4    3e-11    
emb|CBE67573.1|  Protein tolB precursor                               71.6    4e-11    
ref|WP_020383554.1|  hypothetical protein                             70.9    4e-11    
gb|EHA25732.1|  hypothetical protein ASPNIDRAFT_50375                 72.0    4e-11    
ref|XP_001395414.2|  hypothetical protein ANI_1_1672104               72.0    4e-11    
ref|WP_015250253.1|  Tol biopolymer transport system periplasmic ...  70.1    5e-11    
ref|WP_025306923.1|  translocation protein TolB                       71.2    5e-11    
ref|WP_038036308.1|  translocation protein TolB                       70.9    6e-11    
ref|WP_044188701.1|  tolB protein precursor protein                   70.5    6e-11    
ref|XP_007595649.1|  TOXD                                             71.6    7e-11    
ref|WP_029877303.1|  translocation protein TolB                       70.9    7e-11    
ref|WP_029557867.1|  translocation protein TolB                       70.5    8e-11    
ref|WP_004513696.1|  translocation protein TolB                       70.5    9e-11    
dbj|GAK58088.1|  WD40-like Beta Propeller                             69.7    9e-11    
ref|WP_036514540.1|  translocation protein TolB                       70.5    9e-11    
ref|WP_020384320.1|  hypothetical protein                             69.3    1e-10    
ref|WP_036196430.1|  hypothetical protein                             68.9    1e-10    
dbj|GAD95313.1|  hypothetical protein ANI_1_1672104                   70.9    1e-10    
ref|WP_033260684.1|  translocation protein TolB                       70.9    1e-10    
ref|WP_038283157.1|  translocation protein TolB                       70.1    1e-10    
gb|EMD82160.1|  TolB protein precursor                                70.1    1e-10    
dbj|GAK49571.1|  WD40-like Beta Propeller                             68.9    1e-10    
ref|XP_007588104.1|  putative tat pathway signal sequence domain-...  70.1    1e-10    
gb|EKG10177.1|  Six-bladed beta-propeller TolB-like protein           70.1    2e-10    
dbj|GAK52271.1|  WD40-like Beta Propeller                             69.3    2e-10    
ref|WP_041726769.1|  hypothetical protein                             68.2    2e-10    
gb|EKD55533.1|  WD40-like protein Beta Propeller                      69.7    3e-10    
ref|WP_040334620.1|  hypothetical protein                             68.6    3e-10    
gb|EJQ51187.1|  hypothetical protein IEQ_02127                        65.5    3e-10    
ref|WP_012640704.1|  translocation protein TolB                       68.6    3e-10    
gb|EMH80413.1|  tol-pal system beta propeller repeat protein TolB     68.6    4e-10    
ref|WP_006399669.1|  hypothetical protein                             68.9    4e-10    
gb|ADU66304.1|  TolB protein                                          68.6    4e-10    
ref|WP_040747138.1|  translocation protein TolB                       68.6    4e-10    
ref|WP_039218915.1|  hypothetical protein                             68.9    4e-10    
ref|WP_006403962.1|  hypothetical protein                             68.9    4e-10    
ref|WP_010921063.1|  translocation protein TolB                       68.6    4e-10    
ref|WP_035954400.1|  hypothetical protein                             68.9    4e-10    
emb|CAK46110.1|  unnamed protein product                              68.9    4e-10    
ref|WP_043949727.1|  translocation protein TolB                       68.6    4e-10    
emb|CBH39656.1|  conserved hypothetical secreted protein, contain...  67.8    4e-10    
ref|WP_041872499.1|  translocation protein TolB                       68.6    4e-10    
ref|WP_043431595.1|  tolB protein precursor protein                   68.2    4e-10    
gb|EDT09480.1|  hypothetical protein BgramDRAFT_3858                  68.6    5e-10    
ref|WP_029968882.1|  hypothetical protein                             68.6    5e-10    
ref|WP_011550484.1|  hypothetical protein                             68.2    5e-10    
ref|WP_044021394.1|  hypothetical protein                             68.6    5e-10    
ref|WP_019872746.1|  hypothetical protein                             68.2    5e-10    
gb|EQB54739.1|  hypothetical protein CGLO_05391                       68.6    5e-10    
ref|WP_035474624.1|  hypothetical protein                             68.6    6e-10    
ref|WP_027818119.1|  hypothetical protein                             68.6    6e-10    
ref|WP_043539896.1|  translocation protein TolB                       68.2    6e-10    
gb|EPX59664.1|  tolB protein precursor, periplasmic protein           67.8    6e-10    
ref|WP_043201552.1|  hypothetical protein                             68.2    6e-10    
dbj|BAJ63516.1|  hypothetical protein ANT_14880                       67.0    6e-10    
ref|XP_007275047.1|  WD40 domain protein beta propeller               68.2    7e-10    
ref|WP_020384323.1|  hypothetical protein                             67.4    7e-10    
dbj|BAJ07029.1|  WD40-like beta propeller protein                     67.0    8e-10    
ref|WP_039647551.1|  translocation protein TolB                       67.8    8e-10    
ref|WP_038321358.1|  hypothetical protein                             67.0    8e-10    
ref|WP_034806253.1|  translocation protein TolB                       67.4    8e-10    
ref|WP_043785949.1|  translocation protein TolB                       68.2    9e-10    
ref|WP_043623202.1|  translocation protein TolB                       67.4    9e-10    
ref|WP_020258740.1|  hypothetical protein                             66.6    9e-10    
ref|WP_022817416.1|  translocation protein TolB                       68.2    9e-10    
ref|WP_012169055.1|  twin-arginine translocation pathway signal       67.4    1e-09    
ref|WP_034427159.1|  hypothetical protein                             66.6    1e-09    
gb|ADG09198.1|  Tol-Pal system beta propeller repeat protein TolB     67.0    1e-09    
ref|XP_003040341.1|  hypothetical protein NECHADRAFT_34811            67.4    1e-09    
gb|KIL85442.1|  hypothetical protein FAVG1_11399                      67.0    1e-09    
gb|ETW93507.1|  hypothetical protein ETSY1_38930                      66.6    1e-09    
ref|WP_041538454.1|  translocation protein TolB                       66.6    2e-09    
ref|WP_040095900.1|  translocation protein TolB                       66.6    2e-09    
gb|KGO45093.1|  WD40-like Beta Propeller                              67.0    2e-09    
ref|WP_027211084.1|  hypothetical protein                             67.0    2e-09    
ref|WP_020678259.1|  hypothetical protein                             66.6    2e-09    
ref|WP_041970151.1|  translocation protein TolB                       66.6    2e-09    
ref|WP_033712222.1|  hypothetical protein                             63.2    2e-09    
gb|EGL66673.1|  translocation protein                                 66.6    2e-09    
ref|XP_007828048.1|  hypothetical protein PFICI_01276                 67.0    2e-09    
ref|WP_002615693.1|  hypothetical protein                             66.2    2e-09    
gb|EQB62921.1|  hypothetical protein RBG1_1C00001G0500                66.6    2e-09    
ref|WP_010973273.1|  MULTISPECIES: translocation protein TolB         66.6    2e-09    
ref|WP_029638152.1|  translocation protein TolB                       66.6    2e-09    
ref|WP_007678383.1|  TolB protein                                     64.3    2e-09    
ref|WP_029131120.1|  translocation protein TolB                       66.2    2e-09    
gb|KGO53636.1|  WD40-like Beta Propeller                              66.6    2e-09    
ref|WP_007661449.1|  tol-pal system beta propeller repeat protein...  66.2    2e-09    
ref|WP_020402308.1|  hypothetical protein                             66.6    2e-09    
ref|WP_026181509.1|  MULTISPECIES: translocation protein TolB         66.2    2e-09    
ref|WP_040498617.1|  translocation protein TolB                       65.9    3e-09    
ref|WP_009208751.1|  tolB protein, periplasmic component, biopoly...  66.2    3e-09    
ref|WP_026091053.1|  translocation protein TolB                       65.9    3e-09    
ref|WP_004445729.1|  MULTISPECIES: tol-pal system beta propeller ...  65.9    3e-09    
gb|EKV04294.1|  hypothetical protein PDIP_88020                       66.2    3e-09    
ref|WP_024348846.1|  translocation protein TolB                       65.9    3e-09    
ref|WP_022563044.1|  Protein tolB precursor                           65.9    3e-09    
ref|WP_019387844.1|  hypothetical protein                             65.5    3e-09    
ref|WP_006697167.1|  MULTISPECIES: translocation protein TolB         65.9    3e-09    
ref|WP_006000501.1|  translocation protein TolB                       65.9    3e-09    
ref|WP_017943217.1|  hypothetical protein                             65.9    3e-09    
ref|WP_031448221.1|  translocation protein TolB                       65.9    3e-09    
ref|WP_042305737.1|  hypothetical protein                             66.2    3e-09    
ref|WP_012632085.1|  translocation protein TolB                       65.9    3e-09    
ref|WP_007068778.1|  translocation protein TolB precursor             65.9    3e-09    
ref|WP_015345983.1|  beta-propeller repeat-containing to-pal syst...  65.5    3e-09    
ref|WP_044278321.1|  tolB protein precursor protein                   65.5    3e-09    
gb|ADY66818.1|  protein tolB precursor                                65.9    4e-09    
ref|WP_043390602.1|  translocation protein TolB                       65.5    4e-09    
gb|AIE98934.1|  WD40-like beta propeller repeat-containing protei...  65.9    4e-09    
ref|WP_003511387.1|  MULTISPECIES: translocation protein TolB         65.5    4e-09    
ref|WP_035277427.1|  hypothetical protein                             65.5    4e-09    
ref|WP_011419718.1|  translocation protein TolB                       65.5    4e-09    
gb|AIO73947.1|  hypothetical protein DM80_3777                        65.9    4e-09    
ref|WP_041870465.1|  hypothetical protein                             64.3    4e-09    
ref|WP_038053671.1|  translocation protein TolB                       65.5    4e-09    
ref|WP_041187541.1|  hypothetical protein                             65.1    4e-09    
ref|WP_004616244.1|  tol-pal system beta propeller repeat protein...  65.5    4e-09    
ref|WP_003523242.1|  translocation protein TolB                       65.5    4e-09    
ref|WP_012820041.1|  translocation protein TolB                       65.5    4e-09    
ref|WP_003506242.1|  translocation protein TolB                       65.5    5e-09    
ref|WP_026364039.1|  MULTISPECIES: translocation protein TolB         65.5    5e-09    
ref|WP_028318597.1|  hypothetical protein                             65.5    5e-09    
ref|WP_035047731.1|  translocation protein TolB                       65.5    5e-09    
emb|CDM26673.1|  Six-bladed beta-propeller, TolB-like                 65.5    5e-09    
ref|WP_035459582.1|  translocation protein TolB                       65.1    5e-09    
gb|KIN05407.1|  hypothetical protein OIDMADRAFT_39656                 65.5    6e-09    
ref|WP_043436880.1|  hypothetical protein                             65.5    6e-09    
gb|KGO75694.1|  WD40-like Beta Propeller                              65.5    6e-09    
ref|WP_041787794.1|  translocation protein TolB                       65.1    6e-09    
ref|WP_036361734.1|  translocation protein TolB                       65.1    6e-09    
gb|ADP72488.1|  Tol-Pal system beta propeller repeat protein TolB     64.7    7e-09    
ref|WP_034307572.1|  translocation protein TolB                       65.5    7e-09    
gb|AEB09960.1|  Protein tolB                                          64.7    7e-09    
emb|CBK43047.1|  Protein TolB precursor                               64.7    7e-09    
gb|EYE99209.1|  TolB, C-terminal domain-containing protein            65.1    7e-09    
ref|WP_035071525.1|  translocation protein TolB                       64.7    8e-09    
ref|WP_025322946.1|  hypothetical protein                             64.3    8e-09    
ref|WP_006726830.1|  translocation protein TolB                       64.7    8e-09    
ref|WP_011631813.1|  translocation protein TolB                       64.7    8e-09    
ref|WP_012524762.1|  translocation protein TolB                       64.7    8e-09    
gb|AHJ62933.1|  TolB protein                                          64.7    8e-09    
gb|KJF73262.1|  translocation protein TolB                            64.7    8e-09    
gb|KJF66339.1|  translocation protein TolB                            64.7    8e-09    
ref|WP_035222753.1|  translocation protein TolB                       64.7    8e-09    
ref|WP_040889071.1|  WD40 domain protein beta propeller               63.5    9e-09    
gb|AIF22130.1|  WD40-like beta propeller repeat-containing protei...  64.3    9e-09    
gb|EGP55224.1|  translocation protein TolB                            64.3    9e-09    
ref|WP_035513763.1|  hypothetical protein                             64.7    9e-09    
ref|WP_009763441.1|  tol-pal system beta propeller repeat protein...  64.3    9e-09    
ref|WP_038523674.1|  translocation protein TolB                       65.1    9e-09    
ref|WP_035243252.1|  translocation protein TolB                       64.3    9e-09    
ref|WP_028038046.1|  translocation protein TolB                       64.3    1e-08    
ref|WP_029907214.1|  translocation protein TolB                       64.3    1e-08    
ref|WP_013942199.1|  translocation protein TolB                       64.3    1e-08    
ref|WP_008626827.1|  tolB protein precursor, periplasmic protein ...  64.7    1e-08    
ref|WP_010940703.1|  translocation protein TolB                       64.3    1e-08    
ref|WP_002638920.1|  translocation protein TolB                       63.9    1e-08    
ref|WP_041536626.1|  translocation protein TolB                       63.9    1e-08    
ref|WP_028466884.1|  translocation protein TolB                       63.9    1e-08    
ref|WP_041801062.1|  translocation protein TolB                       63.9    1e-08    
ref|WP_039191827.1|  translocation protein TolB                       63.9    1e-08    
ref|WP_015089363.1|  adventurous gliding motility protein W           63.9    1e-08    
gb|AEI63304.1|  beta-propeller repeat-containing to-pal system pr...  63.9    1e-08    
ref|WP_027390703.1|  hypothetical protein                             63.9    1e-08    
ref|WP_041455426.1|  hypothetical protein                             61.6    1e-08    
sp|A7HV03.1|TOLB_PARL1  RecName: Full=Protein TolB; Flags: Precursor  63.9    1e-08    
ref|WP_043709552.1|  tolB protein precursor protein                   63.9    1e-08    
gb|ABJ08626.1|  transport system periplasmic component                63.9    1e-08    
ref|WP_041539754.1|  translocation protein TolB                       63.9    1e-08    
ref|WP_011162787.1|  translocation protein TolB                       63.9    1e-08    
ref|WP_035992689.1|  hypothetical protein                             64.3    1e-08    
dbj|GAM35983.1|  hypothetical protein TCE0_018f04727                  64.3    1e-08    
ref|WP_038454721.1|  hypothetical protein                             63.9    1e-08    
emb|CCQ73317.1|  Protein tolB precursor                               63.9    1e-08    
dbj|GAK68872.1|  protein TolB                                         63.9    1e-08    
ref|WP_030055158.1|  MULTISPECIES: hypothetical protein               63.5    2e-08    
gb|EPX63167.1|  tolB protein precursor, periplasmic protein           63.5    2e-08    
ref|WP_027279367.1|  translocation protein TolB                       63.9    2e-08    
ref|XP_008082401.1|  DPP6 N-terminal                                  63.9    2e-08    
dbj|GAK55986.1|  protein tolB                                         63.5    2e-08    
gb|ABZ73547.1|  Tol-Pal system beta propeller repeat protein TolB     63.5    2e-08    
ref|WP_022730350.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_027841025.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_041532929.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_043429512.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_020186384.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_015828440.1|  hypothetical protein                             63.9    2e-08    
ref|WP_042617516.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_014203430.1|  hypothetical protein                             63.5    2e-08    
ref|WP_035728283.1|  translocation protein TolB                       63.5    2e-08    
gb|ABL00916.1|  WD-40 repeat-containing protein                       63.5    2e-08    
ref|WP_011582484.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_035963468.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_012333176.1|  beta-propeller repeat-containing to-pal syst...  63.5    2e-08    
ref|WP_044602070.1|  hypothetical protein                             62.0    2e-08    
ref|WP_021777246.1|  domain containing protein                        63.5    2e-08    
gb|ABJ81522.1|  WD40 domain protein beta Propeller                    63.5    2e-08    
ref|WP_026190563.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_043848777.1|  translocation protein TolB                       63.9    2e-08    
ref|WP_010789827.1|  Acylamino-acid-releasing enzyme                  63.5    2e-08    
ref|WP_035969040.1|  translocation protein TolB                       63.5    2e-08    
ref|WP_041858862.1|  hypothetical protein                             63.2    2e-08    
ref|WP_020381447.1|  hypothetical protein                             62.8    2e-08    
ref|WP_035533596.1|  translocation protein TolB                       63.2    2e-08    
gb|EDQ34364.2|  tol-pal system beta propeller repeat protein TolB     63.5    2e-08    
emb|CAB60199.2|  P100GA2 protein                                      63.5    2e-08    
gb|AGM05836.1|  TolB-related protein                                  63.9    2e-08    
ref|WP_021327580.1|  Periplasmic component of the Tol biopolymer ...  63.2    2e-08    
ref|WP_018288388.1|  hypothetical protein                             63.2    2e-08    
ref|WP_020475332.1|  hypothetical protein                             62.4    2e-08    



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 175/197 (89%), Gaps = 4/197 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKH+VFRSGRSGHKNLYI+D++ GEL+GG I QLT+G WIDTMPSWSPDGKLIAFSSN
Sbjct  505  PDGKHVVFRSGRSGHKNLYIVDAVKGELEGGEICQLTEGPWIDTMPSWSPDGKLIAFSSN  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N  CFSIYVV PDGTGLRRIHVAG EGS+EV++ERLNHVCFS D EW+LFTANLG
Sbjct  565  RHNPDNITCFSIYVVHPDGTGLRRIHVAGPEGSDEVDKERLNHVCFSKDCEWLLFTANLG  624

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA--EVDLARLSLG  535
            GVTAEPVS+PNQ+QPYGDLY+++LDG+GLQRLTWNGYENGTPAWHP A   VD+ R  L 
Sbjct  625  GVTAEPVSLPNQYQPYGDLYLVKLDGSGLQRLTWNGYENGTPAWHPSATITVDVKRSLL-  683

Query  536  KSGEKLRGKFDEPLWIN  586
              G+KLRG+FD+ LW+N
Sbjct  684  -VGDKLRGEFDDVLWMN  699



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKH+VFRSGRSGHKNLYI+D++ GEL+GG IRQLT G WIDTMPSWSPDGKLIAFSSN
Sbjct  468  PDGKHVVFRSGRSGHKNLYIVDAIKGELEGGEIRQLTKGPWIDTMPSWSPDGKLIAFSSN  527

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N  CFSIYVV PDGTGLRRI+VAG EGS+E ++ERLNHVCFS D EW+LFTANLG
Sbjct  528  RHNPDNITCFSIYVVHPDGTGLRRIYVAGPEGSDEADKERLNHVCFSKDCEWLLFTANLG  587

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS+PNQ+QPYGDLY+++LDG+GLQRLTWNGYENGTPAWHP A   +        
Sbjct  588  GVTAEPVSLPNQYQPYGDLYLVKLDGSGLQRLTWNGYENGTPAWHPSATTTVEVKRSLLV  647

Query  542  GEKLRGKFDEPLWIN  586
            G+KLRG+FD+ LW+N
Sbjct  648  GDKLRGEFDDVLWMN  662



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 175/198 (88%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKHIVFRSGRSGHKNLYI+D++ GEL+GGGIRQLT+G WIDTMPSWSPDGKLIAFSSN
Sbjct  501  PDGKHIVFRSGRSGHKNLYIMDAVKGELEGGGIRQLTEGPWIDTMPSWSPDGKLIAFSSN  560

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N  CFSIYV+ P+GTGLRRIHVAG EGS+EV++ERLNHVCFS D EW+LFT NLG
Sbjct  561  RHNPDNVTCFSIYVIHPNGTGLRRIHVAGPEGSDEVDKERLNHVCFSKDCEWLLFTGNLG  620

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS+PNQ+QPYGDLY+++LDG+GL+RLT N YENGTPAWHP A + +  L + ++
Sbjct  621  GVTAEPVSLPNQYQPYGDLYLVKLDGSGLRRLTCNAYENGTPAWHPSA-MPMTALDIERN  679

Query  542  ---GEKLRGKFDEPLWIN  586
               G+KLRG+FD+ LW+N
Sbjct  680  VIVGDKLRGEFDDVLWMN  697



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   318 bits (815),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG+KNLYIID++NGEL+GG IRQLT+G WIDTMPSWSPDGKLIAFSSN
Sbjct  480  PDGKSVVFRSGRSGNKNLYIIDAVNGELEGG-IRQLTEGPWIDTMPSWSPDGKLIAFSSN  538

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FSIYV+RPDG+ LRR++VAG+EGS +V+RER+NHVCFS+D EW+LF ANLG
Sbjct  539  RHNPDNLNAFSIYVIRPDGSDLRRVYVAGSEGSVDVDRERINHVCFSADCEWLLFAANLG  598

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-K  538
            G+TAEP+S+PNQFQPYGDL+++RLDG+GL+RLTWNGYENGTPAWH   EVD+ R+ LG +
Sbjct  599  GMTAEPISLPNQFQPYGDLFVVRLDGSGLKRLTWNGYENGTPAWHTGNEVDMGRMCLGSE  658

Query  539  SGEKLRGKFDEPLWINSDF  595
            +G+KL G+FDEPLWI+ + 
Sbjct  659  NGDKLTGEFDEPLWISCEL  677



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG+KNLYIID++NGEL+GG IRQLT+G WIDTMPSWSPDGKLIAFSSN
Sbjct  480  PDGKSVVFRSGRSGNKNLYIIDAVNGELEGG-IRQLTEGXWIDTMPSWSPDGKLIAFSSN  538

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FSIYV+RPDG+ LRR++VAG+EGS +V+RER+NHVCFS+D EW+LF ANLG
Sbjct  539  RHNPDNLNAFSIYVIRPDGSDLRRVYVAGSEGSVDVDRERINHVCFSADCEWLLFAANLG  598

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-K  538
            G TAEP+S+PNQFQPYGDL+++RLDG+GL+RLTWNGYENGTPAWH   EVD+ R+ LG +
Sbjct  599  GXTAEPISLPNQFQPYGDLFVVRLDGSGLKRLTWNGYENGTPAWHTGNEVDMGRMCLGSE  658

Query  539  SGEKLRGKFDEPLWINSDF  595
            +G+KL G+FDEPLWI+ + 
Sbjct  659  NGDKLTGEFDEPLWISCEL  677



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 173/199 (87%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKHIVFRSGRSGHKNLYI+DS+ GEL+GGGIRQLT+G WIDTMPSWSPDGKLIAFSSN
Sbjct  500  PDGKHIVFRSGRSGHKNLYIMDSVKGELEGGGIRQLTEGPWIDTMPSWSPDGKLIAFSSN  559

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N  CFSIYV+ P+GTGLRRIHVAG EGS+EV++ERLNHVCFS D EW+LFT NLG
Sbjct  560  RHNPDNVTCFSIYVIHPNGTGLRRIHVAGPEGSDEVDKERLNHVCFSKDCEWLLFTGNLG  619

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK----AEVDLARLS  529
            GVTAEPVS+PNQ+QPYGDLY+++LDG+GL++LT N YENGTPAWHP       +D+ R  
Sbjct  620  GVTAEPVSLPNQYQPYGDLYLVKLDGSGLRQLTCNAYENGTPAWHPSGTPMTALDIERNV  679

Query  530  LGKSGEKLRGKFDEPLWIN  586
            +   G+KLRG+FD+ LW+N
Sbjct  680  I--VGDKLRGEFDDVLWMN  696



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNL+++D++NGE +G  IRQLTDG WIDTMPSWSP G LIAFSSN
Sbjct  445  PDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-IRQLTDGPWIDTMPSWSPKGDLIAFSSN  503

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FS+YV++PDG+GLRRIHVAG EGS +V+RER+NHVCFS+D EW+LFTANLG
Sbjct  504  RHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEGSGDVDRERINHVCFSADGEWLLFTANLG  563

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             V AEPVS PNQFQPYGDLY+++LDG+GL+RLTWNGYENGTPAWHP  ++DL +L L   
Sbjct  564  AVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRLTWNGYENGTPAWHPGNQLDLGKLRLEDD  623

Query  542  -GEKLRGKFDEPLWINSDF  595
             G+KLRG+FDEPLWI+ DF
Sbjct  624  IGDKLRGQFDEPLWISCDF  642



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNL+++D++NGE +G  IRQLTDG WIDTMPSWSP G LIAFSSN
Sbjct  503  PDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-IRQLTDGPWIDTMPSWSPKGDLIAFSSN  561

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FS+YV++PDG+GLRRIHVAG EGS +V+RER+NHVCFS+D EW+LFTANLG
Sbjct  562  RHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEGSGDVDRERINHVCFSADGEWLLFTANLG  621

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             V AEPVS PNQFQPYGDLY+++LDG+GL+RLTWNGYENGTPAWHP  ++DL +L L   
Sbjct  622  AVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRLTWNGYENGTPAWHPGNQLDLGKLRLEDD  681

Query  542  -GEKLRGKFDEPLWINSDF  595
             G+KLRG+FDEPLWI+ DF
Sbjct  682  IGDKLRGQFDEPLWISCDF  700



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNL+++D++NGE +G  IRQLTDG WIDTMPSWSP G LIAFSSN
Sbjct  503  PDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-IRQLTDGPWIDTMPSWSPKGDLIAFSSN  561

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FS+YV++PDG+GLRRIHVAG EGS +V+RER+NHVCFS+D EW+LFTANLG
Sbjct  562  RHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEGSGDVDRERINHVCFSADGEWLLFTANLG  621

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             V AEPVS PNQFQPYGDLY+++LDG+GL+RLTWNGYENGTPAWHP  ++DL +L L   
Sbjct  622  AVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRLTWNGYENGTPAWHPGNQLDLGKLRLEDD  681

Query  542  -GEKLRGKFDEPLWINSDF  595
             G+KLRG+FDEPLWI+ DF
Sbjct  682  IGDKLRGQFDEPLWISCDF  700



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 173/201 (86%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLY +D++NGE  GGGIRQLTDG WIDTMPSWSP+G LIAFSSN
Sbjct  458  PDGKWLVFRSGRTGHKNLYAVDAVNGEF-GGGIRQLTDGPWIDTMPSWSPNGDLIAFSSN  516

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FSIY+++PDG+GLRR+HVAG EGS EV+RER+NHVCFS D EW+LFTANLG
Sbjct  517  RHNPDNVNAFSIYLIKPDGSGLRRVHVAGPEGSPEVDRERINHVCFSRDGEWLLFTANLG  576

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS PNQFQPYG+LY++RLDG+GLQRLTWNG+ENGTPAWH   +V  + L  G S
Sbjct  577  GVTAEPVSWPNQFQPYGELYVVRLDGSGLQRLTWNGFENGTPAWHSSDDVSPSDLRSGIS  636

Query  542  ----GEKLRGKFDEPLWINSD  592
                G+KLRG+F+EPLWI+ D
Sbjct  637  EDWDGDKLRGQFEEPLWISCD  657



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 173/201 (86%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLY +D++NGE  GGGIRQLTDG WIDTMPSWSP+G LIAFSSN
Sbjct  502  PDGKWLVFRSGRTGHKNLYAVDAVNGEF-GGGIRQLTDGPWIDTMPSWSPNGDLIAFSSN  560

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FSIY+++PDG+GLRR+HVAG EGS EV+RER+NHVCFS D EW+LFTANLG
Sbjct  561  RHNPDNVNAFSIYLIKPDGSGLRRVHVAGPEGSPEVDRERINHVCFSRDGEWLLFTANLG  620

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS PNQFQPYG+LY++RLDG+GLQRLTWNG+ENGTPAWH   +V  + L  G S
Sbjct  621  GVTAEPVSWPNQFQPYGELYVVRLDGSGLQRLTWNGFENGTPAWHSSDDVSPSDLRSGIS  680

Query  542  ----GEKLRGKFDEPLWINSD  592
                G+KLRG+F+EPLWI+ D
Sbjct  681  EDWDGDKLRGQFEEPLWISCD  701



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 173/200 (87%), Gaps = 8/200 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKHIVFRSGRSGHKNLYIID++NGE++GG IRQLT+GAWIDTMP+WSPDGKLIAFSSN
Sbjct  459  PDGKHIVFRSGRSGHKNLYIIDAVNGEMEGGEIRQLTNGAWIDTMPNWSPDGKLIAFSSN  518

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             HNP + +CFSIYVV PDG+GLRRI+VAG EGSEEV++ERLNHVCFS DSEW+LFT NL 
Sbjct  519  MHNPDDINCFSIYVVHPDGSGLRRIYVAGPEGSEEVDKERLNHVCFSKDSEWLLFTGNLS  578

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS+PNQFQPYGDLY+++LDG+GL+RLT NGYENGTPAWH  +       + G++
Sbjct  579  GVTAEPVSLPNQFQPYGDLYVVKLDGSGLRRLTCNGYENGTPAWH--SSTMPMETTTGET  636

Query  542  ------GEKLRGKFDEPLWI  583
                  GEKL+G+FD+ LW+
Sbjct  637  ERNVLVGEKLKGEFDDVLWM  656



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSN
Sbjct  454  PDGKSIVFRSGRSGHKNLYIVDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSN  513

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N D F  YVVRPDG+GLRRI ++G EGSEE  RER+NHV F+ D +W++FTANL 
Sbjct  514  RHNPANIDAFGAYVVRPDGSGLRRILISGPEGSEEAARERVNHVSFNKDGDWLVFTANLC  573

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GK  538
            G+TAEPV++PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL+R+SL G+
Sbjct  574  GITAEPVAMPNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSRMSLNGQ  633

Query  539  SGEKLRGKFDEPLWINSDF  595
             G+KL G+F+EPLWI+ D 
Sbjct  634  DGDKLDGQFEEPLWISCDI  652



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 169/199 (85%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++NGE +GG IR+LTDG WIDTMPSWSP G LIAFSSN
Sbjct  506  PDGKSLVFRSGRSGHKNLYILDAVNGEFNGG-IRKLTDGPWIDTMPSWSPSGDLIAFSSN  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             HNP   D FSIYV++PDG+ LRRI VAG  GS +V+RER+NHVCFS D EW+LF  N+G
Sbjct  565  MHNPDRVDAFSIYVIKPDGSDLRRIFVAGPRGSSDVDRERINHVCFSQDGEWLLFATNIG  624

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-K  538
            GVT EPVS PNQFQPYGDLY++RLDG+GL+RLTWNG+ENGTPAWHP +E+D+ RL LG +
Sbjct  625  GVTVEPVSWPNQFQPYGDLYVVRLDGSGLRRLTWNGFENGTPAWHPWSELDMGRLCLGNE  684

Query  539  SGEKLRGKFDEPLWINSDF  595
            +G KL+G F+EPLWI  DF
Sbjct  685  AGVKLKGDFEEPLWITCDF  703



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG+++VFRSGRSGHKNLYI+D++ GE  GGG+R+LT+G WIDTMP WSPDG+LIAFSSN
Sbjct  457  PDGRYLVFRSGRSGHKNLYIVDAVEGETSGGGVRRLTEGEWIDTMPVWSPDGELIAFSSN  516

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+P N D F IY+VRPDGTGLRR+HVAG  GS EV RERLNHVCFS DS W++F ANLG
Sbjct  517  RHDPSNPDVFGIYLVRPDGTGLRRVHVAGPPGSAEVGRERLNHVCFSPDSRWLVFAANLG  576

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV-DLARLSLGK  538
             VTAEPVS+PN FQPYGDLY  RLDGTGL RLT+N YENGTP WH   +V  L  LSLG 
Sbjct  577  AVTAEPVSLPNHFQPYGDLYACRLDGTGLTRLTYNCYENGTPTWHSGGDVPSLGSLSLGP  636

Query  539  S-GEKLRGKFDEPLWINSD  592
              GEKLRG+FDEPLWI  D
Sbjct  637  HVGEKLRGQFDEPLWITFD  655



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score =   305 bits (780),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++NGE DGG IR+LT+G WIDTMP WSP G LI FSSN
Sbjct  452  PDGKSIVFRSGRSGHKNLYIVDAVNGESDGGEIRRLTEGEWIDTMPCWSPKGDLIGFSSN  511

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP +   F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL 
Sbjct  512  RHNPADTSAFGAYVVRPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLC  571

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GK  538
            G+TAEPV++PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL+RLSL G+
Sbjct  572  GITAEPVAMPNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDELDLSRLSLNGQ  631

Query  539  SGEKLRGKFDEPLWINSDF  595
             G+KL G+F+EPLWI+ D 
Sbjct  632  DGDKLEGQFEEPLWISCDI  650



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   305 bits (780),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++NGE +GGGIR+LTDG WIDTMP WSP G LI FSSN
Sbjct  459  PDGKSIVFRSGRSGHKNLYIVDAVNGESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSN  518

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N   F  YVVRPDGTGLRRI ++G EGSEE  RER+NHV F+ D +W++F ANL 
Sbjct  519  RHNPENTAVFGAYVVRPDGTGLRRIQISGPEGSEEAARERVNHVSFNKDGDWLVFAANLS  578

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GK  538
            GVTAEPV++PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL++L+L G+
Sbjct  579  GVTAEPVTMPNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQ  638

Query  539  SGEKLRGKFDEPLWINSDF  595
             G+KL G+F+EPLWI+ D 
Sbjct  639  DGDKLEGQFEEPLWISCDI  657



>gb|KCW58167.1| hypothetical protein EUGRSUZ_H008852, partial [Eucalyptus grandis]
Length=276

 Score =   293 bits (749),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 167/202 (83%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNL+I+D+ NGE DGG IRQLTDG WIDTMPSWSP+  LIAFSSN
Sbjct  76   PDGKWLVFRSGRTGHKNLFIVDAANGEFDGG-IRQLTDGPWIDTMPSWSPNNDLIAFSSN  134

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHN G+A  FSIY++RPDG+ LRR+H+AG EGS EV+RER+NHVCFS D EW+LFTANLG
Sbjct  135  RHNSGDASTFSIYLIRPDGSDLRRVHLAGPEGSPEVDRERINHVCFSRDGEWLLFTANLG  194

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL----ARLS  529
            GVTAEPVS PNQFQPYG+LY+ RLDG+GL+RLTWNG+ENGTPAWH    V L    +   
Sbjct  195  GVTAEPVSWPNQFQPYGELYVARLDGSGLKRLTWNGFENGTPAWHSTHAVGLGDPWSATG  254

Query  530  LGKSGEKLRGKFDEPLWINSDF  595
             G   +KLRG+F+EPLWI+ + 
Sbjct  255  EGWDEDKLRGQFEEPLWISCNI  276



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 169/199 (85%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLY++D++NGE DG  IR+LTDG WIDTMP WSP G LI FSSN
Sbjct  405  PDGKSVVFRSGRSGHKNLYVVDAVNGESDG--IRRLTDGPWIDTMPCWSPKGDLIGFSSN  462

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + F +YVVRPDG+GLRRI VAG EGSEE  RER+NHV F+ D +W++FTANLG
Sbjct  463  RHNPANTEAFGVYVVRPDGSGLRRIQVAGPEGSEEAARERVNHVSFNKDGDWLVFTANLG  522

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GK  538
            GV AEPV++PNQFQPYG+LY+++LDGTGL+RLTWNGYENGTP WH   +VDL++LSL G+
Sbjct  523  GVMAEPVAMPNQFQPYGELYVVKLDGTGLRRLTWNGYENGTPTWHTVDDVDLSQLSLNGQ  582

Query  539  SGEKLRGKFDEPLWINSDF  595
             G+KL G+F+EPLWI+ D 
Sbjct  583  DGDKLEGQFEEPLWISCDI  601



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++NGE +GGGIR+LTDG WIDTMP WSP G LI FSSN
Sbjct  454  PDGKSIVFRSGRSGHKNLYIVDAVNGESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSN  513

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N   F  YVVRPDGTGLRRI ++G EGSEE  RER+NHV F+ D +W++F ANL 
Sbjct  514  RHNPENTAVFGAYVVRPDGTGLRRIQISGPEGSEEAARERVNHVSFNKDGDWLVFAANLS  573

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GK  538
            GVTAEPV++PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL++L+L G+
Sbjct  574  GVTAEPVTMPNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQ  633

Query  539  SGEKLRGKFDEPLWINSDF  595
             G+KL G+F+EPLWI+ D 
Sbjct  634  DGDKLEGQFEEPLWISCDI  652



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 172/202 (85%), Gaps = 12/202 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKH+VFRSGRSG+KNLYIID +NGE++GG +RQLT+GAWIDTMP+WSPDGKLIAFSSN
Sbjct  461  PDGKHLVFRSGRSGYKNLYIIDGVNGEMEGGEVRQLTNGAWIDTMPNWSPDGKLIAFSSN  520

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP + + FSIYVV PDG+GLRRI+VAG EGSEEV++ERLNHVCFS DSEW+LFT NL 
Sbjct  521  RHNPNDINRFSIYVVHPDGSGLRRIYVAGPEGSEEVDKERLNHVCFSKDSEWLLFTGNLS  580

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA--------EVDL  517
            GVTAEPVS+PNQFQPYGDLY+++LDG+GL+RLT NGYENGTPAWHP          E + 
Sbjct  581  GVTAEPVSLPNQFQPYGDLYVVKLDGSGLRRLTCNGYENGTPAWHPSTMPMETTAGETER  640

Query  518  ARLSLGKSGEKLRGKFDEPLWI  583
            + L     GEKL+G+FD+ LW+
Sbjct  641  SVL----VGEKLKGEFDDLLWM  658



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 168/198 (85%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG+ +VFRSGRSGHKNLYIID++ GE +GG IRQLT+G WIDTMPSWSP G LIAFSSN
Sbjct  469  PDGESLVFRSGRSGHKNLYIIDAVEGEFNGG-IRQLTEGPWIDTMPSWSPKGDLIAFSSN  527

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FSIYV+RPDG+GL+RIHVAG+EGS E  R R+NHVCFS D EW+LFT NLG
Sbjct  528  RHNPNNVNAFSIYVIRPDGSGLKRIHVAGSEGSSEGERGRINHVCFSRDGEWLLFTGNLG  587

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             VTAEPVS PNQFQPYGDL++ RLDG+GL RLTWNG+ENGTPAWHP++E++L  L L + 
Sbjct  588  SVTAEPVSWPNQFQPYGDLHVTRLDGSGLSRLTWNGFENGTPAWHPRSELELDSLCLDED  647

Query  542  GE-KLRGKFDEPLWINSD  592
             E KL G+FD+PLWIN D
Sbjct  648  VEDKLTGQFDDPLWINCD  665



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYIID++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSN
Sbjct  453  PDGKSIVFRSGRSGHKNLYIIDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSN  512

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N   F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ + +W++FTANL 
Sbjct  513  RHNPENTAAFGAYVVRPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKEGDWIVFTANLC  572

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GK  538
            G+TAEPV+IPNQFQPYGDLY++++DGTGL+RLTWNGYE+GTP WH   E+DL +LSL G+
Sbjct  573  GITAEPVAIPNQFQPYGDLYVVKVDGTGLRRLTWNGYEDGTPTWHTVDELDLTQLSLNGQ  632

Query  539  SGEKLRGKFDEPLWINSDF  595
             G+KL G+F+EPLWI+ D 
Sbjct  633  DGDKLEGQFEEPLWISCDI  651



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSN
Sbjct  453  PDGKSVVFRSGRSGHKNLYILDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSN  512

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N   F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL 
Sbjct  513  RHNPENTAAFGAYVVRPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLC  572

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GK  538
            G+TAEPV+IPNQFQPYGDLY++++DGTGL+RLTWNGYE+GTP WH   E+DL RLSL G+
Sbjct  573  GITAEPVAIPNQFQPYGDLYIVKVDGTGLRRLTWNGYEDGTPTWHTVDELDLTRLSLNGQ  632

Query  539  SGEKLRGKFDEPLWINSDF  595
             G+KL G+F+EPLWI+ D 
Sbjct  633  DGDKLGGQFEEPLWISCDI  651



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 170/201 (85%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++NGEL+GG +RQLTDG WIDTMPSWSPDGKLIAFSSN
Sbjct  458  PDGKSVVFRSGRSGHKNLYIMDAVNGELEGGMVRQLTDGNWIDTMPSWSPDGKLIAFSSN  517

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N   F IY+V P+G G+RR+ VA  E  EE  RERLNHVCFS+D EW+LFT+NLG
Sbjct  518  RHNPENEGAFGIYLVEPNGKGVRRVQVAVIE--EE--RERLNHVCFSADGEWLLFTSNLG  573

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL--G  535
            GVTAEPVSIPNQFQPYGD+Y++RLDG+GLQRLTWNGYENGTPAWHP   + L+ LSL   
Sbjct  574  GVTAEPVSIPNQFQPYGDMYLVRLDGSGLQRLTWNGYENGTPAWHPTPGLSLSALSLEGN  633

Query  536  KSGE-KLRGKFDEPLWINSDF  595
            K GE KL+G+FDEPLWI  D 
Sbjct  634  KDGEDKLKGQFDEPLWILCDL  654



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 167/199 (84%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++ GE +G  +R+LTDGAWIDTMP+WSP G LI FSSN
Sbjct  450  PDGKFLVFRSGRSGHKNLYIVDAVKGEFEGE-LRRLTDGAWIDTMPNWSPRGDLIVFSSN  508

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             HNP N + FSIYV+RPDG+GLRR++VAG EGS EV+RER+NHVCFS D +W+LFTANL 
Sbjct  509  MHNPKNTEAFSIYVIRPDGSGLRRVYVAGPEGSSEVDRERINHVCFSRDGKWLLFTANLS  568

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS PNQFQPYGDL+++RLDGTGL RLTWNGYENGTP W+  +EV L+ LSL   
Sbjct  569  GVTAEPVSWPNQFQPYGDLFVVRLDGTGLSRLTWNGYENGTPTWYYGSEVALSGLSLKDE  628

Query  542  --GEKLRGKFDEPLWINSD  592
              GEKL+G FDEPLWI  D
Sbjct  629  VVGEKLKGNFDEPLWITFD  647



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 171/201 (85%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+++GE +GG IRQLTDG WIDTMP+WSPDGKLI FSSN
Sbjct  515  PDGKFVVFRSGRSGHKNLYIMDAVDGEFNGG-IRQLTDGPWIDTMPNWSPDGKLIVFSSN  573

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N + FSIY++RPDGT LRR++VAG EGS E  RER+NHVCFS DS W++FTANLG
Sbjct  574  RHNPSNVEAFSIYLIRPDGTDLRRVYVAGVEGSAEAERERINHVCFSPDSLWLVFTANLG  633

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP---KAEVDLARLSL  532
            GV  EPVS+PNQFQPYGDLY++RLDG+GL+RLTWNGYENGTP W+    + ++D+ RLS+
Sbjct  634  GVLTEPVSMPNQFQPYGDLYVVRLDGSGLKRLTWNGYENGTPTWNSTTGEMDMDMDRLSV  693

Query  533  GK-SGEKLRGKFDEPLWINSD  592
                G++L G+FDEPLWI+ D
Sbjct  694  ETVVGDRLMGQFDEPLWISCD  714



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   301 bits (772),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 173/202 (86%), Gaps = 7/202 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++NGE +GG IR+LTDG WIDTMPSWSPDGK IAFSSN
Sbjct  518  PDGKFIVFRSGRSGHKNLYIVDAVNGEFNGGSIRRLTDGPWIDTMPSWSPDGKWIAFSSN  577

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             HNP + + FSIYV+  DG+GLRRI +AG EGS  ++RERLNHVC+S+D EW+LFTANLG
Sbjct  578  MHNPDDVEHFSIYVIGADGSGLRRIRIAGNEGSGRLDRERLNHVCWSADCEWLLFTANLG  637

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK---AEVDLARL-S  529
            GVTAEPVS+PNQFQPYGDLYM+R+DGTGL+RLTWNGYENGTPAW+P     E+D+ RL +
Sbjct  638  GVTAEPVSLPNQFQPYGDLYMVRVDGTGLRRLTWNGYENGTPAWYPTGGDVELDMGRLMN  697

Query  530  LGKS---GEKLRGKFDEPLWIN  586
            L +S   G+KL+G F EPLW++
Sbjct  698  LKRSETVGDKLKGDFIEPLWLH  719



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 169/201 (84%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNL+I+D+ NGE DGG IRQLTDG WIDTMPSWSP+  LIAFSSN
Sbjct  448  PDGKWLVFRSGRTGHKNLFIVDAANGEFDGG-IRQLTDGPWIDTMPSWSPNNDLIAFSSN  506

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG+A  FSIY++RPDG+ LRR+H+AG EGS EV+RER+NHVCFS D EW+LFTANLG
Sbjct  507  RHNPGDASTFSIYLIRPDGSDLRRVHLAGPEGSPEVDRERINHVCFSRDGEWLLFTANLG  566

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL----ARLS  529
            GVTAEPVS PNQFQPYG+LY++RLDG+GL+RLTWNG+ENGTPAWH    V L    +   
Sbjct  567  GVTAEPVSWPNQFQPYGELYVVRLDGSGLKRLTWNGFENGTPAWHSMHAVGLGDPWSATG  626

Query  530  LGKSGEKLRGKFDEPLWINSD  592
             G   +KLRG+F+EPLWI+ D
Sbjct  627  EGWDEDKLRGQFEEPLWISCD  647



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 168/203 (83%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++NGE DGG +RQLTDG WIDTMP WSP G LIAFSSN
Sbjct  459  PDGKSLVFRSGRSGHKNLYILDAVNGEFDGGSLRQLTDGPWIDTMPCWSPKGDLIAFSSN  518

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP + + F+IYV+  DG+ LRRI++AG EGS + +RER+NHVCFS D EW+LFTANLG
Sbjct  519  RHNPDDVNAFNIYVITSDGSELRRIYLAGPEGSGDADRERINHVCFSEDGEWLLFTANLG  578

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEVDLARLSLG  535
            GVTAEPV+ PNQFQPYGDLYM+RLDG+GL+RLTWNGYENGTPAW    + +VD+  LSL 
Sbjct  579  GVTAEPVTWPNQFQPYGDLYMVRLDGSGLRRLTWNGYENGTPAWKNFGRDDVDMGPLSLA  638

Query  536  KS----GEKLRGKFDEPLWINSD  592
                  GE+LRG+FDEPLWI  D
Sbjct  639  GDDRLVGEELRGQFDEPLWITCD  661



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 166/199 (83%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYIID++ GE +G  +RQLT+GAWIDTMPSWSP G LIAFSSN
Sbjct  506  PDGKSIVFRSGRSGHKNLYIIDTVYGEFNGT-VRQLTNGAWIDTMPSWSPKGDLIAFSSN  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N   FSIYV++PDG+ LRRIHVAGAEGS EV RER+NHVCFS D EW+LF +NL 
Sbjct  565  RHNPDNPAVFSIYVIKPDGSDLRRIHVAGAEGSSEVVRERINHVCFSKDGEWLLFASNLD  624

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             VTAEPVS  NQFQPYGDL+++RLDG+GL+RLT NGYENGTPAW    E+DL RLSL K 
Sbjct  625  SVTAEPVSWANQFQPYGDLHVVRLDGSGLRRLTCNGYENGTPAWFSGNELDLDRLSLDKQ  684

Query  542  -GEKLRGKFDEPLWINSDF  595
             G+KL G+FDEPLWI+ D 
Sbjct  685  VGDKLTGQFDEPLWISCDL  703



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 169/200 (85%), Gaps = 2/200 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDGK +VFRSGRSG+KNLYI+D++NGE +GG GIR+LT+G WIDTMP WSP G LI FSS
Sbjct  449  PDGKSVVFRSGRSGYKNLYILDAVNGESNGGDGIRRLTEGPWIDTMPCWSPKGDLIGFSS  508

Query  179  NRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            NRHNP N + F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL
Sbjct  509  NRHNPTNTEAFGAYVVRPDGSGLRRIEIAGPEGSEEAARERVNHVSFNKDGDWLVFTANL  568

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-G  535
            GG+TAEPV+IPNQFQPYGDLY++++DGTGL+RLTWNGYE+GTP WH   ++DL+ LSL G
Sbjct  569  GGITAEPVTIPNQFQPYGDLYVVKVDGTGLKRLTWNGYEDGTPTWHSVDDLDLSGLSLNG  628

Query  536  KSGEKLRGKFDEPLWINSDF  595
            + G+KL G+F+EPLWI  D 
Sbjct  629  QDGDKLEGQFEEPLWITCDI  648



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDGK +VFRSGRSG KNLYI+D++NGE DGG GIRQLT+G W DTMP+WSPDG+LIAFSS
Sbjct  456  PDGKSLVFRSGRSGQKNLYILDAVNGESDGGEGIRQLTEGKWTDTMPTWSPDGELIAFSS  515

Query  179  NRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            NRH P N D FSIY++RPDGTGLRR+HVAG  GS  V+RER+NHVCFS DS+W+LFTANL
Sbjct  516  NRHAPSNPDVFSIYLIRPDGTGLRRVHVAGPAGSSYVDRERINHVCFSPDSKWLLFTANL  575

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK-AEVDLARLSL-  532
            G VT+EPVS PNQFQPYGDLY+ RLDGTGL+RLT   YENGTPAW  +    DL  LSL 
Sbjct  576  GSVTSEPVSWPNQFQPYGDLYVCRLDGTGLRRLTCGSYENGTPAWSSRGGPDDLGSLSLR  635

Query  533  GKSGEKLRGKFDEPLWINSD  592
              +G+KLRG+FDEPLWI  D
Sbjct  636  SPTGDKLRGQFDEPLWITCD  655



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 170/200 (85%), Gaps = 8/200 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+G+KNLY++D++NGE +GG I +LT+G  IDTMPSWSP G LIAFSSN
Sbjct  490  PDGKSLVFRSGRTGNKNLYVVDAVNGEFNGG-IHRLTEGPCIDTMPSWSPKGDLIAFSSN  548

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH P +A  FSIYV++PDG+GLRRIHVAG    ++V+RER+NHVCFS+D EW+LFTANLG
Sbjct  549  RHKPEDAAVFSIYVIKPDGSGLRRIHVAG----DDVDRERINHVCFSNDGEWLLFTANLG  604

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS PNQFQPYGDLY MRLDG+GL RLTWNGYENGTP WH   +VDL RL LG++
Sbjct  605  GVTAEPVSFPNQFQPYGDLYTMRLDGSGLTRLTWNGYENGTPTWHTGDDVDLGRLRLGEA  664

Query  542  ---GEKLRGKFDEPLWINSD  592
               G+KL+G+FDEPLWI+ D
Sbjct  665  CEVGDKLKGQFDEPLWISCD  684



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDGK +VFRSGRSGHKNLYI+D++NGE +GG GIR+LT+GAWIDTMP WSP G LI FSS
Sbjct  451  PDGKSVVFRSGRSGHKNLYILDAVNGESEGGEGIRRLTEGAWIDTMPCWSPKGDLIGFSS  510

Query  179  NRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            NRH+P N   F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL
Sbjct  511  NRHDPSNDAAFGAYVVRPDGSGLRRIEIAGPEGSEEAARERVNHVSFNKDGDWLVFTANL  570

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-G  535
            GG+TAEPV+IPNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   ++ L+ LSL G
Sbjct  571  GGITAEPVAIPNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDDLGLSGLSLNG  630

Query  536  KSGEKLRGKFDEPLWINSDF  595
            + G+KL G+F+EPLWI  D 
Sbjct  631  QDGDKLEGQFEEPLWITCDI  650



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 165/199 (83%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLYI+D++ GE +G  +RQLTDG WIDTMP+WSP G LI FSSN
Sbjct  445  PDGKFLVFRSGRTGHKNLYIVDAMKGEFEGE-LRQLTDGPWIDTMPNWSPRGDLIVFSSN  503

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             HNP N + FSIYV+RPDG+GLRR++VAG EGS EV+RER+NHVCFS D  W+LFTANL 
Sbjct  504  MHNPKNTEAFSIYVIRPDGSGLRRVYVAGPEGSSEVDRERINHVCFSRDGNWLLFTANLS  563

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS+PNQFQPYGDL+++RLDGTGL+RLT N YENGTP W+  +E+ L+ LSL   
Sbjct  564  GVTAEPVSLPNQFQPYGDLFVVRLDGTGLRRLTCNAYENGTPTWYYGSELALSGLSLKDE  623

Query  542  --GEKLRGKFDEPLWINSD  592
              GEKL+G FDEPLWI  D
Sbjct  624  VVGEKLKGDFDEPLWIKFD  642



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDGK +VFRSGRSGHKNLYI+D++NGE +GG GIR+LT+G WIDTMP WSP G LI FSS
Sbjct  451  PDGKSVVFRSGRSGHKNLYILDAVNGESEGGEGIRRLTEGPWIDTMPCWSPKGDLIGFSS  510

Query  179  NRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            NRH+P N   F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL
Sbjct  511  NRHDPSNDAAFGAYVVRPDGSGLRRIEIAGPEGSEEAARERVNHVSFNKDGDWIVFTANL  570

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-G  535
            GG+TAEPV+IPNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   ++ L+ LSL G
Sbjct  571  GGITAEPVAIPNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDDLGLSGLSLNG  630

Query  536  KSGEKLRGKFDEPLWINSD  592
            + G+KL G+F+EPLWI  D
Sbjct  631  QDGDKLEGQFEEPLWITCD  649



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 166/199 (83%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++NGE + G IR+LT G WIDTMPSWSP+G LIAFSSN
Sbjct  512  PDGKSLVFRSGRSGHKNLYILDAVNGEFNDG-IRKLTAGPWIDTMPSWSPNGDLIAFSSN  570

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             HNP N D FSIYV++PDG+ LRRI+ AG +GS +V+ ER+NHVCFS + EW++F AN+G
Sbjct  571  MHNPNNVDAFSIYVIKPDGSDLRRIYAAGPKGSSDVDMERINHVCFSPNGEWLVFAANIG  630

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-  538
            GVTAEPVS PNQFQPYGDLY+MRLDG+GL+RLT +GYENGTP WH   E+D+ RL LG  
Sbjct  631  GVTAEPVSFPNQFQPYGDLYVMRLDGSGLRRLTCDGYENGTPTWHFGGELDMRRLCLGND  690

Query  539  SGEKLRGKFDEPLWINSDF  595
            +G +L G FDEPLWI SDF
Sbjct  691  AGVELTGGFDEPLWITSDF  709



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 165/200 (83%), Gaps = 4/200 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRS HKNLYI+D++ GE   GGIR+LT+G WIDTMP WSP G LIAFSSN
Sbjct  452  PDGKSVVFRSGRSSHKNLYIVDAIAGE--SGGIRRLTEGPWIDTMPCWSPKGDLIAFSSN  509

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHN GN + F  YVVRPDG+G+RRI VAG EGSEE  RER+NH+ FS D EW++FTANLG
Sbjct  510  RHNQGNTEGFGAYVVRPDGSGVRRIKVAGTEGSEEAERERINHLSFSKDGEWLVFTANLG  569

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK-AEVDLARLSL-G  535
            GVT EPV++PNQFQPYG++Y++R+DGTGL+RLTWNGYE+GTP WH    E+DL RLSL G
Sbjct  570  GVTVEPVAVPNQFQPYGEVYVVRVDGTGLRRLTWNGYEDGTPTWHTADDELDLTRLSLDG  629

Query  536  KSGEKLRGKFDEPLWINSDF  595
            + G+KL G+ DEPLWI+ D 
Sbjct  630  QDGDKLTGQIDEPLWISCDL  649



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 165/201 (82%), Gaps = 3/201 (1%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDG-GGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDGK +VFRSGRSGHKNLYI+D++NGE DG  GIR+LT+G W DTMP WSPDG+LIAFSS
Sbjct  456  PDGKSLVFRSGRSGHKNLYILDAVNGESDGREGIRRLTEGEWTDTMPCWSPDGELIAFSS  515

Query  179  NRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            NRH P + D FSIY++RPDGTGLRR+HVAG  GS  V++ER+NHVCFS DS+W+LFTANL
Sbjct  516  NRHAPTSPDVFSIYLIRPDGTGLRRVHVAGPAGSCYVDKERVNHVCFSQDSKWLLFTANL  575

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK-AEVDLARLSL-  532
            G VTAEPVS PN FQPYGDL++ RLDGTGL+RLT + YENGTPAW  +    DL  LSL 
Sbjct  576  GSVTAEPVSWPNHFQPYGDLFLCRLDGTGLRRLTCDPYENGTPAWSSRGGPDDLETLSLR  635

Query  533  GKSGEKLRGKFDEPLWINSDF  595
              +G+KL+G+FDEPLWI  D 
Sbjct  636  SPTGDKLQGQFDEPLWITCDI  656



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 166/201 (83%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLYIID++NGE +G   R+LT+G  IDTMPSWSP G LIAFSSN
Sbjct  466  PDGKSLVFRSGRTGHKNLYIIDAVNGEFNGDA-RRLTEGQCIDTMPSWSPKGDLIAFSSN  524

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP +   F IYV++PDG+GLRR+H AG    ++V RER+NHVCFS D EW+LFTANLG
Sbjct  525  RHNPDDVAVFGIYVIKPDGSGLRRVHAAG----DDVERERINHVCFSKDGEWLLFTANLG  580

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE-VDLARLSLGK  538
            GVTAEPVS+PNQFQPYGDLY++RLDG+GL+RLTWNGYENGTPAW    E VD+ RL L  
Sbjct  581  GVTAEPVSLPNQFQPYGDLYVVRLDGSGLRRLTWNGYENGTPAWLEGDEVVDMGRLRLEN  640

Query  539  S--GEKLRGKFDEPLWINSDF  595
               G+KL+G+F+EPLWI+ DF
Sbjct  641  EVGGDKLKGRFEEPLWISCDF  661



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 168/207 (81%), Gaps = 14/207 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++ GE++GG IRQLT+G WIDTMPSWSP+G+LIAFSSN
Sbjct  458  PDGKSVVFRSGRSGHKNLYIVDAIKGEVEGG-IRQLTEGPWIDTMPSWSPNGELIAFSSN  516

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N D F IY+++PDGTGLRR+ VA  E  EE  RERLNHVCFS D EW+LF ANLG
Sbjct  517  RHNPDNVDAFGIYLIKPDGTGLRRVKVA--EFEEE--RERLNHVCFSGDGEWLLFAANLG  572

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK------AEVDLAR  523
            GVT EPV++PN FQPYGDLY++RLDG+GL+RLTWNGYENGTPAWHP        E+ L  
Sbjct  573  GVTVEPVALPNHFQPYGDLYLVRLDGSGLRRLTWNGYENGTPAWHPNRVLGGAEELKLCG  632

Query  524  LSLGKSG---EKLRGKFDEPLWINSDF  595
            LSLG      E+L+G+FDEPLWI  DF
Sbjct  633  LSLGGGKKGEEELKGQFDEPLWIKCDF  659



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 165/201 (82%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLYIID++NGE +G   R+LT+G  IDTMPSWSP G LIAFSSN
Sbjct  517  PDGKSLVFRSGRTGHKNLYIIDAVNGEFNGDA-RRLTEGQCIDTMPSWSPKGDLIAFSSN  575

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP +   F IYV++PDG+GLRR++ AG    ++V RER+NHVCFS D EW+LFTANLG
Sbjct  576  RHNPDDVAVFGIYVIKPDGSGLRRVYAAG----DDVERERINHVCFSKDGEWLLFTANLG  631

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW-HPKAEVDLARLSLGK  538
            GV AEPVS+PNQFQPYGDLY++RLDG+GL+RLTWNGYENGTPAW     EVD+ RL L  
Sbjct  632  GVIAEPVSLPNQFQPYGDLYVVRLDGSGLRRLTWNGYENGTPAWLEGDEEVDMGRLRLDN  691

Query  539  S--GEKLRGKFDEPLWINSDF  595
               G+KL+G+F+EPLWI+ DF
Sbjct  692  EVGGDKLKGQFEEPLWISCDF  712



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 160/203 (79%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG---IRQLTDGAWIDTMPSWSPDGKLIAF  172
            P GK +VFRSGRSGHKNLYI+D+ +GE  G G   IR+LTDG WIDTMPSWSPDG LIAF
Sbjct  456  PCGKWVVFRSGRSGHKNLYIVDAAHGEDVGAGEGTIRRLTDGEWIDTMPSWSPDGSLIAF  515

Query  173  SSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTA  352
            SSNRH+P NA  FSIY+VRPDG+GLRR+HVAG  GS   +RER+NHVCFS DS W+LFTA
Sbjct  516  SSNRHDPTNAAVFSIYLVRPDGSGLRRVHVAGPAGSAAADRERINHVCFSPDSRWLLFTA  575

Query  353  NLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE--VDLARL  526
            N GGV AEP+S PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P +     L  L
Sbjct  576  NFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPASSPAAGLESL  635

Query  527  SLGK-SGEKLRGKFDEPLWINSD  592
            SLG  +G++  G+FDEPLW+  D
Sbjct  636  SLGPGAGDESLGEFDEPLWLTCD  658



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score =   281 bits (720),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 161/202 (80%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG--IRQLTDGAWIDTMPSWSPDGKLIAFS  175
            P G+ +VFRSGRSGHKNLYIID+ +GE +     I++LTDG WIDTMP W+PDGKL+AFS
Sbjct  472  PCGRWVVFRSGRSGHKNLYIIDAAHGENEPATAPIQRLTDGEWIDTMPCWAPDGKLVAFS  531

Query  176  SNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTAN  355
            SNRH+PGNA  FSIY+VRPDGTGLRR+HVAG  GSEE ++ER+NHVCFS D EW+LFTAN
Sbjct  532  SNRHDPGNAAVFSIYLVRPDGTGLRRVHVAGPPGSEEADKERINHVCFSPDGEWLLFTAN  591

Query  356  LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG  535
            LGGV AEPVS PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P  +++    SLG
Sbjct  592  LGGVNAEPVSGPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPALDLEDGVGSLG  651

Query  536  ---KSGEKLRGKFDEPLWINSD  592
                + E   G+FDEPLW+  D
Sbjct  652  LGNPAAEDSLGEFDEPLWLTCD  673



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 159/203 (78%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG---IRQLTDGAWIDTMPSWSPDGKLIAF  172
            P GK +VFRSGRSGHKNLYI+D+ +GE  G G   IR+LTDG WIDTMPSWSPDG LIAF
Sbjct  456  PCGKWVVFRSGRSGHKNLYIVDAAHGEDVGAGEGTIRRLTDGEWIDTMPSWSPDGSLIAF  515

Query  173  SSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTA  352
            SSNRH+P NA  FSIY+VRPDG+GLRR+HVAG  GS   +RER+NHVCFS DS W+LFTA
Sbjct  516  SSNRHDPTNAAVFSIYLVRPDGSGLRRVHVAGPAGSAAADRERINHVCFSPDSRWLLFTA  575

Query  353  NLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE--VDLARL  526
            N GGV AEP+S PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P +     L  L
Sbjct  576  NFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPASSPAAGLESL  635

Query  527  SLGK-SGEKLRGKFDEPLWINSD  592
            SL   +G++  G+FDEPLW+  D
Sbjct  636  SLVPGAGDESLGEFDEPLWLTCD  658



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   279 bits (714),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 161/199 (81%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            P G+ +VFRSGR+GHKNLY++D+  GE   GG+R+LT+G WIDTMPSWSPDG LIAFSSN
Sbjct  470  PCGRWLVFRSGRTGHKNLYVVDTARGE--EGGVRRLTEGEWIDTMPSWSPDGSLIAFSSN  527

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+P N   FSIY+VRPDG+GLRR++VAGAEGS E ++ER+NHVCFS DS+W+LFTANLG
Sbjct  528  RHDPANPAVFSIYLVRPDGSGLRRVYVAGAEGSAEADKERINHVCFSPDSQWLLFTANLG  587

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLG-  535
             V AEP+S PNQFQPYGDLY+ RLDG+ L+RLT N YENGTP W P  A + L  LS+G 
Sbjct  588  SVVAEPISGPNQFQPYGDLYVCRLDGSDLRRLTCNAYENGTPVWGPASAGLGLESLSMGP  647

Query  536  KSGEKLRGKFDEPLWINSD  592
             SGE   G+FDEPLW+  D
Sbjct  648  PSGEDALGQFDEPLWLTCD  666



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score =   276 bits (707),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 163/201 (81%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  +VFRSGR+GHKNLYIID+++GE +G  +RQLT+G  IDTMPSWSP G LIAFSSN
Sbjct  466  PDGMSLVFRSGRTGHKNLYIIDAVDGEFNGS-VRQLTEGPCIDTMPSWSPKGDLIAFSSN  524

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP +A  F IYVV+PDGTGLRRI VAG E     +RER+NHVCFS D EW+LFTANL 
Sbjct  525  RHNPDDAAVFGIYVVKPDGTGLRRIPVAGNES----HRERINHVCFSKDXEWLLFTANLS  580

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA-EVDLARLSLGK  538
            GV AEPVS+PNQFQPYGDLY++R DG+GL+RLTWNGYENGTPAWH    E+D+  L LG 
Sbjct  581  GVIAEPVSLPNQFQPYGDLYVVRXDGSGLRRLTWNGYENGTPAWHEGGDELDMGGLRLGN  640

Query  539  S--GEKLRGKFDEPLWINSDF  595
               G++L+G+F++P WI+ DF
Sbjct  641  EVGGDELKGQFEDPHWISCDF  661



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 161/199 (81%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            P G+ +VFRSGR+GHKNLY++D+  GE   GG+ +LT+G WIDTMPSWSPDG LIAFSSN
Sbjct  472  PCGRWLVFRSGRTGHKNLYVVDTARGE--DGGVLRLTEGEWIDTMPSWSPDGSLIAFSSN  529

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+P N   FSIY+VRPDG+GLRR++VAG EGS E ++ER+NHVCFS DS+W+LFTANLG
Sbjct  530  RHDPANPAVFSIYLVRPDGSGLRRVYVAGPEGSAEADKERINHVCFSPDSQWLLFTANLG  589

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLG-  535
             V AEP+S PNQFQPYGDLY+ RLDG+GL+RLT N YENGTPAW P  A + L  L++G 
Sbjct  590  SVVAEPISGPNQFQPYGDLYVCRLDGSGLRRLTCNAYENGTPAWGPASAGLGLESLAIGP  649

Query  536  KSGEKLRGKFDEPLWINSD  592
             +GE   G+FDEPLW+  D
Sbjct  650  PAGEDALGQFDEPLWLTCD  668



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 162/201 (81%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  +VFRSGR+GHKNLYIID+++GE +   +RQLT+G  IDTMPSWSP G LI FSSN
Sbjct  520  PDGMSLVFRSGRTGHKNLYIIDAVDGEFNDS-VRQLTEGPCIDTMPSWSPKGDLIVFSSN  578

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP +A  F IYVV+PDGT LRRI VAG E     +RER+NHVCFS D EW+LFTANL 
Sbjct  579  RHNPDDAAVFGIYVVKPDGTDLRRIPVAGNES----HRERINHVCFSKDGEWLLFTANLS  634

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA-EVDLARLSLGK  538
            GVTAEPVS PNQFQPYG+LY++RLDG+GL+RLTWNGYENGTPAWH    E+D+  L LG 
Sbjct  635  GVTAEPVSWPNQFQPYGELYVVRLDGSGLRRLTWNGYENGTPAWHEGGDELDMGGLRLGN  694

Query  539  S--GEKLRGKFDEPLWINSDF  595
               G++L+G+F+EPLWI+ DF
Sbjct  695  EVGGDELKGRFEEPLWISCDF  715



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 156/198 (79%), Gaps = 6/198 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            P G+ +VFRSGRSGHKNLYI+D+  GE     IR++TDG WIDTMPSWSPDG+LIAFSSN
Sbjct  461  PCGRWVVFRSGRSGHKNLYIVDAARGEET---IRRVTDGEWIDTMPSWSPDGELIAFSSN  517

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH P NA  FSIY+VRPDGTGLRR+HVAG  GS E ++ER+NHVCFS D +W+LFTANLG
Sbjct  518  RHEPANAAVFSIYLVRPDGTGLRRVHVAGPAGSAEADKERINHVCFSPDGQWLLFTANLG  577

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-  538
            GV AEP+S PNQFQPYGDLY+ RLDG+G+ RLT N YENGTP W P   VD   LSLG  
Sbjct  578  GVMAEPISGPNQFQPYGDLYVCRLDGSGVLRLTCNAYENGTPTWGPALGVD--SLSLGAP  635

Query  539  SGEKLRGKFDEPLWINSD  592
            + +   G+FDEPLW+  +
Sbjct  636  AADDSLGQFDEPLWLTCN  653



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 160/210 (76%), Gaps = 19/210 (9%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++ GE D   IRQLT+G WIDTMPSWSPDGKLIAFSSN
Sbjct  466  PDGKLVVFRSGRSGHKNLYIMDAVEGE-DSNNIRQLTNGPWIDTMPSWSPDGKLIAFSSN  524

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+P N   F IY+V  DG+ L+R+HV+      +V  ER+NHVCFS + EW+LFTAN+G
Sbjct  525  RHDPSNMVTFGIYLVAVDGSDLKRVHVS------DVAMERINHVCFSPNGEWLLFTANMG  578

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GVTAEPVS PNQFQPYGDL++ +LDGTGL+RLTW+GYENGTPAWH +  +D+   +L   
Sbjct  579  GVTAEPVSFPNQFQPYGDLFIAKLDGTGLRRLTWSGYENGTPAWHSRQLLDIPLGNLSLE  638

Query  542  G------------EKLRGKFDEPLWINSDF  595
            G            +KL+GKFDEPLWI  DF
Sbjct  639  GIEKADAHHQVDADKLKGKFDEPLWITCDF  668



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 155/198 (78%), Gaps = 6/198 (3%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            P G+ +VFRSGRSGHKNLYI+D+  GE     IR++TDG WIDTMPSWSPDG+LIAFSSN
Sbjct  461  PCGRWVVFRSGRSGHKNLYIVDAARGEET---IRRVTDGEWIDTMPSWSPDGELIAFSSN  517

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH P NA  FSIY+VRPDGTGLRR+HVAG  GS E ++ER+NHVCFS D +W+LFTA LG
Sbjct  518  RHEPANAAVFSIYLVRPDGTGLRRVHVAGPAGSAEADKERINHVCFSPDGQWLLFTATLG  577

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-  538
            GV AEP+S PNQFQPYGDLY+ RLDG+G+ RLT N YENGTP W P   VD   LSLG  
Sbjct  578  GVMAEPISGPNQFQPYGDLYVCRLDGSGVLRLTCNAYENGTPTWGPALGVD--SLSLGAP  635

Query  539  SGEKLRGKFDEPLWINSD  592
            + +   G+FDEPLW+  +
Sbjct  636  AADDSLGQFDEPLWLTCN  653



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 160/202 (79%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDG---GGIRQLTDGAWIDTMPSWSPDGKLIAF  172
            P G+ +VFRSGR+GHKNLY+ID+  GE +      +R+LT+G WIDTMPSWSPDG LIAF
Sbjct  464  PCGRWLVFRSGRTGHKNLYVIDTARGEEEEGGGAAVRRLTEGEWIDTMPSWSPDGSLIAF  523

Query  173  SSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTA  352
            SSNRH+P N   FSIY+VRPDG+ LRR++VAG EGS E ++ER+NHVCFS DS W+LFTA
Sbjct  524  SSNRHDPANPAVFSIYLVRPDGSRLRRVYVAGPEGSAEADKERINHVCFSPDSRWLLFTA  583

Query  353  NLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLS  529
            NLGGV AEPVS PNQFQPYGDLY+ RLDG+GLQRLT N YENGTPAW P  A + +  +S
Sbjct  584  NLGGVMAEPVSGPNQFQPYGDLYVCRLDGSGLQRLTCNAYENGTPAWGPSSAGLGVEAMS  643

Query  530  LGK-SGEKLRGKFDEPLWINSD  592
            LG  +GE   G+FDEPLW+  D
Sbjct  644  LGAPAGEDPMGQFDEPLWLTCD  665



>ref|XP_010456117.1| PREDICTED: uncharacterized protein LOC104737601 [Camelina sativa]
Length=426

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSN
Sbjct  255  PDGKSVVFRSGRSGHKNLYILDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSN  314

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNP N   F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W +FTANL 
Sbjct  315  RHNPENTAAFGAYVVRPDGSGLRRIQIAGLEGSEEAARERVNHVSFNKDGDWTVFTANLC  374

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  484
            G+TAEPV+IPNQFQPYGDLY++++DGTGL+RLTWNGYE+GT
Sbjct  375  GITAEPVAIPNQFQPYGDLYVVKVDGTGLRRLTWNGYEDGT  415



>ref|XP_006840287.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 151/195 (77%), Gaps = 8/195 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+ NGE   GGIRQLT+G WIDTMPSWSPDGK IAFSSN
Sbjct  453  PDGKFLVFRSGRSGHKNLYIMDATNGE--DGGIRQLTEGPWIDTMPSWSPDGKFIAFSSN  510

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+P N + F IYV+ PDGTGLRR+HVA     E+++  R NHVCFS DS+W+LFTAN G
Sbjct  511  RHSPENTEVFGIYVIHPDGTGLRRVHVA-----EDMDMVRTNHVCFSPDSKWLLFTANFG  565

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLGK  538
             V+AEP+S+PNQFQPYGDLY+  L+GT L+RLT N YENGTPAWH      D+  L L  
Sbjct  566  AVSAEPISLPNQFQPYGDLYVCGLEGTHLKRLTCNAYENGTPAWHSGDGGPDIGSLCLND  625

Query  539  SGEKLRGKFDEPLWI  583
             GE L+G F EP W+
Sbjct  626  VGEDLKGDFGEPHWL  640



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 156/201 (78%), Gaps = 10/201 (5%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D + GE +GG IR+LT+GAWIDTMP WSP G LIAFSSN
Sbjct  492  PDGKSVVFRSGRSGHKNLYIVDGVEGEFNGG-IRRLTEGAWIDTMPCWSPKGDLIAFSSN  550

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVA-GAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            RH P N++ F IY+VRPDG+GLRR+ VA G EG     RERLNHV FS D EW++FTANL
Sbjct  551  RHEPKNSEVFGIYLVRPDGSGLRRVEVAMGVEGG----RERLNHVSFSGDGEWLVFTANL  606

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK  538
            GGVTAEP+ +PNQFQPYGDLY++R+DG+GL+RLT N YENGTP WH   ++ L  +    
Sbjct  607  GGVTAEPIGLPNQFQPYGDLYVVRVDGSGLRRLTCNAYENGTPTWH-NGDLVLCHVDGDG  665

Query  539  SGE---KLRGKFDEPLWINSD  592
             GE   KL+ +F EPLWI  D
Sbjct  666  EGENWDKLKAEFAEPLWITCD  686



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 158/206 (77%), Gaps = 16/206 (8%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR G+KNLYI+D++ GE DGG IR+LT+G WIDTMP WSP G LIAFSSN
Sbjct  507  PDGKSIVFRSGREGYKNLYIVDAVKGEFDGG-IRRLTEGEWIDTMPCWSPKGDLIAFSSN  565

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVA-GAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            RH+P N++ F IY+V P+G+GLRR+ VA G EG     +ERLNHVCFS D EW+LFTANL
Sbjct  566  RHDPKNSEVFGIYLVGPNGSGLRRVEVAKGVEGM----KERLNHVCFSRDGEWLLFTANL  621

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL--  532
            GGV+AEPV +PNQFQPYGDLY++RLDG+GL+RLT N YENGTP WH     DLA  +   
Sbjct  622  GGVSAEPVGLPNQFQPYGDLYVVRLDGSGLRRLTCNAYENGTPTWH---HGDLALCAPRE  678

Query  533  -----GKSGEKLRGKFDEPLWINSDF  595
                 G+  +KL+G+F EPLWI  D 
Sbjct  679  DDGEGGQDWDKLKGEFQEPLWITCDI  704



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 155/198 (78%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG+KNLYI+D+L+GE +GG +R+LT+G WIDTMP WSP G  IAFSSN
Sbjct  461  PDGKFVVFRSGRSGYKNLYIMDALDGEFNGG-LRRLTEGEWIDTMPCWSPKGDWIAFSSN  519

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHV-AGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
            RH+ GN++ F IYVVRPDG+ LRR+ V  G +G     RERLNHVCFS D EW+LFTANL
Sbjct  520  RHDAGNSEVFGIYVVRPDGSDLRRVEVGKGVDGE----RERLNHVCFSGDGEWLLFTANL  575

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK  538
            GGV AEPVS+PNQFQPYGDL+++RLDG+GL+RLT N YENGTP WH +    L R   G 
Sbjct  576  GGVMAEPVSMPNQFQPYGDLFVVRLDGSGLKRLTCNAYENGTPMWHAREGAALLRSGKGD  635

Query  539  SGEKLRGKFDEPLWINSD  592
              + L+G F+EPLWI  +
Sbjct  636  E-DVLKGGFEEPLWITCE  652



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 151/198 (76%), Gaps = 16/198 (8%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNL+++D+L GE  GG IRQLTDG WIDTMP WSPDGKLIAFSSN
Sbjct  451  PDGKSVVFRSGRSGHKNLFVVDALEGEF-GGDIRQLTDGPWIDTMPCWSPDGKLIAFSSN  509

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH       F IY++  DG+GLRR+  AG++  EE  RERLNHVCFS DSEW+LFT+N  
Sbjct  510  RHT-SKEGAFGIYLINSDGSGLRRVKFAGSD--EE--RERLNHVCFSPDSEWLLFTSNFA  564

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-  538
            GVTAEPVS+PN FQPYGDLY  RLDG+GL+RLT+NGYENGTPAW      D   L + K 
Sbjct  565  GVTAEPVSLPNHFQPYGDLYTARLDGSGLRRLTFNGYENGTPAW------DREFLQVSKR  618

Query  539  ---SGEKLRGKFDEPLWI  583
                 ++L G+F+EPLW+
Sbjct  619  HAADEDELEGQFEEPLWL  636



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 149/201 (74%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+G KNLYI+D++NGE   GG+R+LT+G WIDTMP WSP G LIAFSSN
Sbjct  453  PDGKFIVFRSGRTGFKNLYIVDAVNGEEVDGGLRRLTEGEWIDTMPCWSPKGDLIAFSSN  512

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+  N++ F IYVV  DG+G+RR+ +      E   RERLNHVCFS D EW+LFTANLG
Sbjct  513  RHDAKNSEVFGIYVVNVDGSGVRRVEIGKGVDGE---RERLNHVCFSGDGEWLLFTANLG  569

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLA----RLS  529
            GV+AEPV +PNQFQPYGDL++++LDG+GL+RLT N YENGTP WH   E+ L        
Sbjct  570  GVSAEPVGLPNQFQPYGDLFVVKLDGSGLRRLTCNAYENGTPTWH-HGELLLCNDGDEDG  628

Query  530  LGKSGEKLRGKFDEPLWINSD  592
                 +KL+G F EPLWI  D
Sbjct  629  DNGDWDKLKGAFQEPLWITCD  649



>ref|XP_006840288.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 152/203 (75%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG+KNLYIID+++GE   G IR+LT+G WIDTMP WSPDGK IAFSSN
Sbjct  453  PDGKFLVFRSGRSGYKNLYIIDAIDGE--DGSIRRLTEGPWIDTMPHWSPDGKYIAFSSN  510

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +P +   FS+Y+  PDGT L  +HV  A    E+ +ER+NHVCFS DS+++LFTANLG
Sbjct  511  RESPKSTQGFSVYLTNPDGTDLHHVHVTAASAFNEMAKERINHVCFSPDSKFLLFTANLG  570

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH-----PKAEVDLARL  526
             V AE +S+PNQFQPYGDLY+  LDG+GL+RLT N YE+GTPAW+     P+    L  +
Sbjct  571  AVNAEAISLPNQFQPYGDLYICGLDGSGLRRLTCNAYEDGTPAWNSGWWGPEPGSSLEDV  630

Query  527  SLGKSGEKLRGKFDEPLWINSDF  595
                 GE+L+G+F+EPLW+ S F
Sbjct  631  ----VGEELKGEFEEPLWLGSTF  649



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 148/199 (74%), Gaps = 13/199 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSG    Y +D++NGE +G  +R+LT+G WIDTMP WSP G +IAFSSN
Sbjct  456  PDGKSIVFRSGRSG----YTVDAVNGEFNGS-LRRLTEGNWIDTMPCWSPKGDVIAFSSN  510

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             HNP N + F IYVV PDG GLRRI VA      E  RERLNHVCFS D EW+LFTANLG
Sbjct  511  MHNPENGEGFGIYVVGPDGNGLRRIEVAKGV---EAERERLNHVCFSGDGEWLLFTANLG  567

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV AEPVS+PNQFQPYGDLY++RLDG+GL+RLT N YENGTP WH +   DL   S    
Sbjct  568  GVQAEPVSLPNQFQPYGDLYVVRLDGSGLRRLTCNSYENGTPTWHDR---DLVLCSGDGD  624

Query  542  G--EKLRGKFDEPLWINSD  592
            G  +K++G+F EPLWI  +
Sbjct  625  GDRDKVKGEFQEPLWITCE  643



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 141/169 (83%), Gaps = 4/169 (2%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK++VFRSGRSGHKNLYI+D++ GE  G  IR LT+GA IDTMP WSP G LIAFSSN
Sbjct  397  PDGKYLVFRSGRSGHKNLYIMDAVEGEFKGD-IRPLTEGACIDTMPCWSPKGDLIAFSSN  455

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR---ERLNHVCFSSDSEWVLFTA  352
            RH P +A+ FSIYV++PDG+GLRRIH+ G+E   E  R   ER+NHV FSSD EW+LFTA
Sbjct  456  RHKPEHANPFSIYVIKPDGSGLRRIHLEGSERLSEEEREWMERINHVTFSSDGEWLLFTA  515

Query  353  NLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            NLGG++AEPV++P Q QPYGD+Y+ RLDG+GL+RLTWNGYENGTP W+P
Sbjct  516  NLGGLSAEPVAVPRQIQPYGDIYVARLDGSGLRRLTWNGYENGTPVWYP  564



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 147/204 (72%), Gaps = 12/204 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG KNLYI+D++NGE DGG +R+LT+G WIDTMP WSP G LIAFSSN
Sbjct  455  PDGKFVVFRSGRSGFKNLYIVDAVNGEFDGG-LRRLTEGEWIDTMPCWSPKGDLIAFSSN  513

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+ GN+  F IYVVR DG+GLRR+ V      E   RE LNHV FS D EW+LFT NL 
Sbjct  514  RHDGGNSQAFGIYVVRVDGSGLRRVEVGKGVDGE---REMLNHVRFSGDGEWLLFTGNLV  570

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH--------PKAEVDL  517
            G+TAEP SIPNQ+QPYGDL++++LDG+GL+RLT N YENGTPAWH           + D 
Sbjct  571  GLTAEPASIPNQYQPYGDLFVVKLDGSGLRRLTCNAYENGTPAWHYGDLLLSNDDDDDDD  630

Query  518  ARLSLGKSGEKLRGKFDEPLWINS  589
                     +KL+G F+E LWI +
Sbjct  631  DDDGDACDWDKLKGAFEESLWITT  654



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 139/196 (71%), Gaps = 12/196 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK++VFRSGRSGHKNLYI+D+  GE   GGIR LT+G W+DTMP WSPDG  IAFSS+
Sbjct  475  PDGKNLVFRSGRSGHKNLYIMDAELGE--DGGIRALTEGPWVDTMPCWSPDGNWIAFSSS  532

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  P N + F+IY+V PDG+ L R+        E   R R NHVCFS DS+ +LFTA+ G
Sbjct  533  RDGPSN-EFFAIYLVHPDGSELHRVF------PESSTRGRCNHVCFSPDSQTLLFTADCG  585

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEPVS+ NQFQPYG+L+  +LDG+ L+R T N YE+GTP W P   + L   S+ K 
Sbjct  586  GISAEPVSLANQFQPYGELFSCKLDGSELRRWTHNAYEDGTPCWGP---LRLDPSSISKQ  642

Query  542  GEKLRGKFDEPLWINS  589
            G++L   F + LW+++
Sbjct  643  GQELHANFQDCLWLSA  658



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 133/195 (68%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GAW DTM SWS DG+ IAFSS+
Sbjct  532  PDGKWIVFRSGRSGHKNLYIMDAIHGE--EASLRRLTEGAWTDTMASWSHDGEWIAFSSD  589

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG    F +Y VRPDG+ L R+  +   G       R+NH  FS DS  ++FT +  
Sbjct  590  RHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------RVNHPFFSPDSRSLVFTTDYA  641

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+GTP+W P   V L   +L   
Sbjct  642  GVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDGTPSWGP---VKLDSSALTGE  698

Query  542  GEKLRGKFDEPLWIN  586
            G+K R  F +  W+ 
Sbjct  699  GKKARCGFRDTRWLK  713



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 133/195 (68%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GAW DTM SWS DG+ IAFSS+
Sbjct  532  PDGKWIVFRSGRSGHKNLYIMDAIHGE--EASLRRLTEGAWTDTMASWSHDGEWIAFSSD  589

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG    F +Y VRPDG+ L R+  +   G       R+NH  FS DS  ++FT +  
Sbjct  590  RHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------RVNHPFFSPDSRSLVFTTDYA  641

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+GTP+W P   V L   +L   
Sbjct  642  GVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDGTPSWGP---VKLDSSALTGE  698

Query  542  GEKLRGKFDEPLWIN  586
            G+K R  F +  W+ 
Sbjct  699  GKKARCGFRDTRWLK  713



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 137/195 (70%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ IAF+S+
Sbjct  521  PDGKFVVFRSGRTGHKNLYIMDAEEGE--EGGLWQLTEGPWTDTMCNWSPDGEWIAFASD  578

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F++Y + P+GTGL R+  +   G       R+NH  FS DS+ ++FT++  
Sbjct  579  RDSPGSGG-FAMYFIHPNGTGLHRVLNSSTAG-------RVNHPWFSPDSKSLVFTSDYA  630

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV+AEP+S+P+QFQPYG+++M R+DG+ LQRLT N YE+GTP+W     + +A   L   
Sbjct  631  GVSAEPISVPHQFQPYGEIFMARVDGSELQRLTHNAYEDGTPSW---GRIFIAASDLTGE  687

Query  542  GEKLRGKFDEPLWIN  586
            GE ++  FD+  W+ 
Sbjct  688  GESVKCDFDDDHWLQ  702



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 141/196 (72%), Gaps = 13/196 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+++GE +G  +++LT+G W DTM +WSPDG+ IAF+S+
Sbjct  486  PDGKWIVFRSGRSGHKNLYIMDAVHGEKNG--LKRLTEGPWSDTMCNWSPDGEWIAFASD  543

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+PG+   F IY++ PDGTGLR++  +G+ G       R NH  FS D + ++FT++  
Sbjct  544  RHDPGSG-SFEIYLIHPDGTGLRKLIHSGSGG-------RTNHPYFSPDGKSMVFTSDYA  595

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +    + + K 
Sbjct  596  GISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKPVNVEMPKG  654

Query  542  GEKLRGKFDEPLWINS  589
            G      F++  W+N+
Sbjct  655  GPYC--SFEDCHWLNN  668



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 127/167 (76%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+++GE  G  +R+LT+G W DTM +WSPDGK IAF+S+
Sbjct  492  PDGKWIVFRSGRSGHKNLYIMDAVDGERKG--LRRLTEGPWTDTMCNWSPDGKWIAFASD  549

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH PG+   F++Y++  DG+GLR++  +G+ G       R NH  FS D + + FT++  
Sbjct  550  RHAPGSG-SFALYLIEADGSGLRKVFESGSGG-------RTNHPYFSPDGKSLTFTSDYA  601

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+ +QPYG+++ +RLDG+G+QRLT N YE+GTPAW PK
Sbjct  602  GISAEPISNPHHYQPYGEIFSVRLDGSGIQRLTHNSYEDGTPAWSPK  648



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 126/166 (76%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+  GE   GGIR+LTDG W DTM +WSPDG+ IAF+S+
Sbjct  501  PDGKWLVFRSGRSGHKNLYIMDAEEGE--AGGIRRLTDGPWTDTMCNWSPDGEWIAFASD  558

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG    F+IY+V P+ TGLRR+ V  A+G       R NH  FS DS+ ++FT++L 
Sbjct  559  RHNPGGG-SFAIYMVHPNSTGLRRV-VHSADGG------RTNHPWFSPDSKRMVFTSDLA  610

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEP+S P+ +QPYG+++ + +DG+GLQRLT N +E+GTP+W P
Sbjct  611  AVSAEPISNPHHYQPYGEIFTINIDGSGLQRLTHNSFEDGTPSWTP  656



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 139/195 (71%), Gaps = 15/195 (8%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  524  PDGKWIVFRSGRSGHKNLYIMDAVDGE--KKELRRLTEGPWTDTMCNWSPDGEWIAFASD  581

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+PG+   F IY++ P+GTGLR++  +G+ G       R NH  FS D + + FT++  
Sbjct  582  RHDPGSG-SFEIYLIHPNGTGLRKLIQSGSGG-------RTNHPYFSPDGKSLTFTSDYA  633

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ +RLDG+G++RLT N YE+GTPAW PK    +  +++ K 
Sbjct  634  GISAEPISNPHHYQPYGEIFTVRLDGSGIKRLTHNSYEDGTPAWSPKY---MPPVNVPKG  690

Query  542  GEKLRGKFDEPLWIN  586
            G      FD+  W+N
Sbjct  691  GPYC--SFDDCHWLN  703



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score =   188 bits (478),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 124/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D++ GE   GG+R+LT+G W DTM +WSPDG  IAF+S+
Sbjct  509  PDGKWIVFRSGRTGHKNLYIMDAIEGE--AGGLRRLTEGPWTDTMCNWSPDGDWIAFASD  566

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +Y++ P+GTGLRR+  +G+ G       R NH  FS D  +V+FT++  
Sbjct  567  RDNPGSG-SFELYLIHPNGTGLRRLVKSGSAG-------RANHPSFSPDGTYVVFTSDFA  618

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            G++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  619  GISAEPISNPHHYQPYGEIFTIKLDGSDLKRLTHNSYEDGTPTWAP  664



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 126/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+  GE   GG+  LT+GAW DTM +WSPDG+ IAF+S+
Sbjct  509  PDGKRIVFRSGRSGHKNLYLMDAEKGE--AGGLWSLTEGAWSDTMCTWSPDGEWIAFASD  566

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++++ P+GTGLR++  +G+ G       R NH  FS DS+ ++FT++  
Sbjct  567  RENPGSG-SFELFLIHPNGTGLRKLIQSGSGG-------RTNHPIFSPDSKTIVFTSDYA  618

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  619  GISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPR  665



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 127/166 (77%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+ +GE   GGI +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  543  PDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIHRLTNGPWSDTMCNWSPDGEWIAFASD  600

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG    F+IY++ P+GTGLRR+ V  A+G       R NH  FS DS+ ++FT++L 
Sbjct  601  RHNPGGG-SFAIYLIHPNGTGLRRL-VHSADGG------RTNHPWFSPDSKSIVFTSDLA  652

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEP+S P+ +QPYG+++ + +DG+GLQRLT N +E+GTP+W P
Sbjct  653  AVSAEPISNPHHYQPYGEIFTINIDGSGLQRLTHNSFEDGTPSWTP  698



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 134/195 (69%), Gaps = 14/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++ GE     I +LTDG W DTM +WSPDG  IAFSS+
Sbjct  510  PDGKRIVFRSGRSGHKNLYIMDAIEGET--SWIERLTDGPWTDTMCNWSPDGDWIAFSSD  567

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+PG+   F +Y++ P+GTGLRR+  +G+ G       R+NH  F  D + ++FT + G
Sbjct  568  RHDPGSGS-FELYMIHPNGTGLRRLLRSGSSG-------RVNHPSFRPDGKLLVFTTDYG  619

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ M+LDG+ L+RLT N YE+GTP W P   ++   +   + 
Sbjct  620  GISAEPISNPHHYQPYGEIFTMKLDGSDLKRLTHNSYEDGTPTWAP-LYINPVDVEWPRK  678

Query  542  GEKLRGKFDEPLWIN  586
            GE     F++  W+N
Sbjct  679  GE---CAFEDCHWLN  690



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 138/199 (69%), Gaps = 20/199 (10%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+ +GE   GGIR+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  493  PDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIRRLTEGPWSDTMCNWSPDGEWIAFASD  550

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG    F+IY+V P+GTGLRR+ V  A+G       R NH  FS DS+ ++FT++  
Sbjct  551  RHNPGGG-SFAIYMVHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKTLVFTSDYA  602

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             V+AEP+S P+ +QPYG+++ + +DG+G++RLT N +E+GTP+W P        L     
Sbjct  603  AVSAEPISNPHHYQPYGEIFTVNIDGSGIRRLTHNSFEDGTPSWTPY------HLKAEDV  656

Query  542  GEKLRGK----FDEPLWIN  586
            GE L+      F++  W+N
Sbjct  657  GETLQASGTCAFEDCHWLN  675



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 125/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+  GE   GG+ +LTDG W DTM +WSPDG+LIAF+S+
Sbjct  530  PDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGLFRLTDGPWTDTMCNWSPDGELIAFASD  587

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++++ P+GTG+R++  +G+ G       R NH  FS D + + FT++ G
Sbjct  588  RENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-------RTNHPIFSPDGQTIAFTSDYG  639

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
             ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N +E+GTPAW PK
Sbjct  640  AISAEPISNPHHYQPYGEIFTVKLDGSDLRRLTHNSFEDGTPAWAPK  686



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 125/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+  GE   GG+ +LTDG W DTM +WSPDG+LIAF+S+
Sbjct  529  PDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGLFRLTDGPWTDTMCNWSPDGELIAFASD  586

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++++ P+GTG+R++  +G+ G       R NH  FS D + + FT++ G
Sbjct  587  RENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-------RTNHPIFSPDGQTIAFTSDYG  638

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
             ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N +E+GTPAW PK
Sbjct  639  AISAEPISNPHHYQPYGEIFTVKLDGSDLRRLTHNSFEDGTPAWAPK  685



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 125/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+L GE   GG+R+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  492  PDGKWIVFRSGRSGHKNLYIMDALEGE--AGGLRRLTEGPWTDTMCNWSPDGEWIAFASD  549

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FS D ++++FT++  
Sbjct  550  RENPGSG-SFEMYMIHPNGTGLKKVIQSGMGG-------RTNHPYFSPDGKYIVFTSDYA  601

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  602  AVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  647



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 127/167 (76%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D+  GE  GGG+ +LT+GAW DTM +WSP+G+ IAF+S+
Sbjct  517  PDGKRIVFRSGRTGHKNLYIMDAEKGE--GGGLWRLTEGAWTDTMCNWSPNGEWIAFASD  574

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  575  RESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPVFSPDSKSLVFTSDYA  626

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  627  GISAEPISNPHSYQPYGDIFTVKLDGSNLKRLTHNSYEDGTPAWSPR  673



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 126/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG+ IAF+S+
Sbjct  514  PDGKLIVFRSGRTGHKNLYIMDAEKGER--GGLWRLTEGAWTDTMCNWSPDGEWIAFASD  571

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++++ P+GTGL+++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  572  RENPGSG-SFELFLIHPNGTGLKKLIQSGTGG-------RTNHPVFSPDSKSLVFTSDYA  623

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+ FQPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  624  GISAEPISNPHHFQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWSPR  670



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 137/201 (68%), Gaps = 20/201 (10%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+ +GE   GGI +LT+G W DTM +WSPDG+ IAFSS+
Sbjct  495  PDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIHRLTEGPWSDTMCNWSPDGEWIAFSSD  552

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG    F+IY++ P+GTGLRR+ V  A+G       R NH  FS DS+ ++FT++  
Sbjct  553  RHNPGGG-SFAIYMIHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKTLVFTSDYA  604

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             V+AEP+S P+ +QPYG+++ + +DGTG++RLT N +E+GTP+W P        L     
Sbjct  605  AVSAEPISNPHHYQPYGEIFTVNIDGTGIRRLTHNSFEDGTPSWTPY------YLEPEDV  658

Query  542  GEKLRG----KFDEPLWINSD  592
            GE L+     KF +  W+  D
Sbjct  659  GETLQASGTCKFRDCHWLTVD  679



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 140/197 (71%), Gaps = 12/197 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG+ IAF+S+
Sbjct  473  PDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDGEWIAFASD  530

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  531  RESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKSIVFTSDYA  582

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ + + L K 
Sbjct  583  GISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INPSDVVLRKK  641

Query  542  GEKLRGKFDEPLWINSD  592
             +     F++  W+N +
Sbjct  642  NDS-SCAFEDCHWLNKN  657



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 127/171 (74%), Gaps = 10/171 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK + FRSGRSGHKNLY++D+L GE   GG+ +LT+G W DTM +WSPDG+ I F+S+
Sbjct  523  PDGKWVAFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGPWSDTMCNWSPDGEWILFASD  580

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +++V P+GTGL ++  +G+ G       R NH CFS D ++V+FT++  
Sbjct  581  RENPGSG-TFELFMVHPNGTGLHKLVQSGSGG-------RANHPCFSPDGKYVVFTSDYA  632

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVD  514
            GV+AEP+S P+ +QPYG++++++ DG+G++RLT N YE+GTPAW PK   D
Sbjct  633  GVSAEPISNPHHYQPYGEIFVIKSDGSGIRRLTHNSYEDGTPAWGPKYMKD  683



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 126/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG+ IAF+S+
Sbjct  512  PDGKRIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGAWTDTMCNWSPDGEWIAFASD  569

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  570  RESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKSLVFTSDYA  621

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  622  GISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPR  668



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 140/197 (71%), Gaps = 12/197 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG+ IAF+S+
Sbjct  474  PDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDGEWIAFASD  531

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  532  RESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKSIVFTSDYA  583

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ + + L K 
Sbjct  584  GISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INPSDVVLRKK  642

Query  542  GEKLRGKFDEPLWINSD  592
             +     F++  W+N +
Sbjct  643  NDS-SCAFEDCHWLNKN  658



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 134/197 (68%), Gaps = 16/197 (8%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+L GE   GG+R+LT+G W DTM SWSPDG+ IAF+S+
Sbjct  502  PDGKWIVFRSGRSGHKNLYVMDALEGE--KGGLRRLTEGPWTDTMCSWSPDGEWIAFASD  559

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG    F++Y++ P+GTGL ++  +G  G       R NH  FS D   ++FT++  
Sbjct  560  RDNPGGGG-FALYLIHPNGTGLMKVVHSGEGG-------RTNHPSFSPDGRSIVFTSDYV  611

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK--AEVDLARLSLG  535
            GV+AEP+S P+ +QPYG++++ R DG+G++RLT N YE+GTPAW P      D+     G
Sbjct  612  GVSAEPISNPHHYQPYGEIFIARSDGSGIKRLTHNSYEDGTPAWGPTFMRPADVVESPFG  671

Query  536  KSGEKLRGKFDEPLWIN  586
            + G      FD+  W+N
Sbjct  672  EPG----CSFDDCHWLN  684



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 140/197 (71%), Gaps = 12/197 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG+ IAF+S+
Sbjct  511  PDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDGEWIAFASD  568

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  569  RESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKSIVFTSDYA  620

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ + + L K 
Sbjct  621  GISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INPSDVVLRKK  679

Query  542  GEKLRGKFDEPLWINSD  592
             +     F++  W+N +
Sbjct  680  NDS-SCAFEDCHWLNKN  695



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 139/197 (71%), Gaps = 12/197 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG+ IAF+S+
Sbjct  511  PDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDGEWIAFASD  568

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  569  RESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKSIVFTSDYA  620

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  +D   + L + 
Sbjct  621  GISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-IDPNDVVLRRK  679

Query  542  GEKLRGKFDEPLWINSD  592
             +     F++  W+N +
Sbjct  680  NDS-SCAFEDCHWLNKN  695



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 136/195 (70%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D++ GE    G+R+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  490  PDGKWIVFRSGRSGHKNLYVMDAVEGE--KKGLRRLTEGPWTDTMCNWSPDGEWIAFASD  547

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F +Y++ P+GTGL+++  +G+ G       R NH  FS D + ++FT++  
Sbjct  548  RDDPGSG-SFELYLIHPNGTGLKKLIQSGSGG-------RTNHPYFSPDGKSIVFTSDYS  599

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +    +   K 
Sbjct  600  GISAEPISNPHAYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKPVNVERPKG  658

Query  542  GEKLRGKFDEPLWIN  586
            G      FD+  W+N
Sbjct  659  GPYC--SFDDCHWLN  671



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 138/195 (71%), Gaps = 12/195 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG+ IAF+S+
Sbjct  512  PDGKRIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGAWTDTMCNWSPDGEWIAFASD  569

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  570  RESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKSLVFTSDYA  621

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYGD++ ++LDG+ ++RLT N YE+GTPAW P+  +    + L + 
Sbjct  622  GISAEPISNPHHYQPYGDIFTVKLDGSNVRRLTHNSYEDGTPAWAPRF-IHPNNVELQRR  680

Query  542  GEKLRGKFDEPLWIN  586
             +  R  F++  W+N
Sbjct  681  NDS-RCSFEDCHWLN  694



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 135/195 (69%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D+LNGE   G + +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  491  PDGKWIVFRSGRTGHKNLYIMDALNGE--AGWLYRLTEGQWTDTMCNWSPDGEWIAFASD  548

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++ + P+GTGL+++  +G  G       R NH  FS D  +++ T++  
Sbjct  549  RENPGSG-SFELFKIHPNGTGLQKVIHSGVGG-------RTNHPWFSPDGNYIVLTSDYA  600

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV+AEP++ P+ +QPYGD++++R DG+G++RLT N YE+GTPAW PK  +  A +     
Sbjct  601  GVSAEPIANPHHYQPYGDIFVIRADGSGIRRLTHNSYEDGTPAWSPKF-LSPANVEWPNG  659

Query  542  GEKLRGKFDEPLWIN  586
            G K    FD+  W+N
Sbjct  660  GSKC--SFDDCHWLN  672



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 138/195 (71%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLYI+D+LNGE DG  + QLT+G W DTMP+WSP+G+ IAF+S+
Sbjct  516  PDGKRVVFRSGRTGHKNLYIMDALNGEKDG--LYQLTEGPWSDTMPNWSPNGEWIAFASD  573

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++ + P+GTGL+++  +G+ G       R+NH  FS D + ++ T++  
Sbjct  574  RENPGSGG-FELFKIHPNGTGLQKVIQSGSGG-------RVNHPWFSPDGKHIVLTSDYA  625

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV+AEP+S P+ FQPYGD+++++ DG+ ++RLT N YE+GTP W PK+ +    +     
Sbjct  626  GVSAEPISNPHHFQPYGDIFVIKSDGSWIRRLTHNSYEDGTPTWIPKS-MKPGNVEWPNG  684

Query  542  GEKLRGKFDEPLWIN  586
            G  L+  FD+  W+N
Sbjct  685  G--LKCSFDDCHWLN  697



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 124/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+L GE+  GG+R LT+G W DTM +WSPD + IAF+S+
Sbjct  476  PDGKWIVFRSGRSGHKNLYIMDALEGEV--GGLRPLTEGPWTDTMCNWSPDDEWIAFASD  533

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FS D ++++FT++  
Sbjct  534  RENPGSG-SFEMYMIHPNGTGLKKVIQSGIGG-------RTNHPYFSPDGKYIVFTSDYA  585

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  586  AVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  631



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 109/158 (69%), Gaps = 16/158 (10%)
 Frame = +2

Query  128  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  307
            D  P+ SP GK +              F IY+VRPDG+GLRR+HVAG  GS   +RER+N
Sbjct  449  DAFPAVSPCGKWV-------------VFRIYLVRPDGSGLRRVHVAGPAGSAAADRERIN  495

Query  308  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  487
            HVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL RLT N YENGTP
Sbjct  496  HVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTP  555

Query  488  AWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  592
            AW P +     L  LSLG  +G++  G+FDEPLW+  D
Sbjct  556  AWGPASSPAAGLESLSLGPGAGDESLGEFDEPLWLTCD  593



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 137/195 (70%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+  GE+  GGIR+LT+G W DTM +WSPDG+ IAFSS+
Sbjct  518  PDGKWIVFRSGRSGHKNLYIMDAEEGEI--GGIRRLTEGPWSDTMCNWSPDGEWIAFSSD  575

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F I+++ P+GTGL ++  +G  G       R NH  FS D + ++FT++ G
Sbjct  576  RENPGSG-SFEIFMMHPNGTGLHKVIQSGIGG-------RANHPWFSPDGKSIVFTSDYG  627

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV+AEP+S P+ +QPYG++++ ++DG+ ++RLT N YE+GTP W P   + L+ + + + 
Sbjct  628  GVSAEPISNPHHYQPYGEIFIAKVDGSDIRRLTHNSYEDGTPTWGP---MFLSPIDVAEP  684

Query  542  GEKLRGKFDEPLWIN  586
              + +  F +  W+N
Sbjct  685  TSEPKCLFQDCHWLN  699



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 125/164 (76%), Gaps = 10/164 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+L GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  520  PDGKWVVFRSGRSGHKNLYIMDALEGET--GGLSRLTEGPWSDTMCNWSPDGEWIAFASD  577

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +++V P+GTGL ++  +G+ G       R NH  FS DS++V+FT++  
Sbjct  578  RENPGSG-SFELFMVHPNGTGLHKLIQSGSGG-------RTNHPWFSPDSKYVVFTSDYA  629

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            GV+AEP+S P+ +QPYGD+++++ DG+G++RLT N YE+GTP W
Sbjct  630  GVSAEPISNPHHYQPYGDIFVIKSDGSGIRRLTHNSYEDGTPTW  673



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 125/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  490  PDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEGPWSDTMCNWSPDGEWIAFASD  547

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH PG+   F+IY+V P+GTGLRR+  +G  G       R NH  FS DS+ ++FT++  
Sbjct  548  RHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-------RTNHPWFSPDSKSLVFTSDYA  599

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+GTP+W P
Sbjct  600  AVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLTHNSFEDGTPSWTP  645



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 137/195 (70%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSG+KNLYI+D++ GE   GG+ +LT+G W DTM SWS DG+ IAF+S+
Sbjct  506  PDGKWIVFRSGRSGYKNLYIMDAVEGE--KGGLYRLTEGPWGDTMCSWSIDGEWIAFASD  563

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+A  F ++++ P+GTGL+R+  +G  G       R NH  FS D + ++FT + G
Sbjct  564  RENPGSA-SFELFLIHPNGTGLKRLVKSGLGG-------RTNHPYFSPDGKSIVFTTDYG  615

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ FQPYG++Y ++LDG+ L+RLT N +E+GTPAW P A ++   L   K 
Sbjct  616  GISAEPISNPHHFQPYGEIYTVKLDGSDLKRLTHNSFEDGTPAWGP-AYIEPVDLEWPKY  674

Query  542  GEKLRGKFDEPLWIN  586
            G +    FD+  W++
Sbjct  675  GPQC--SFDDCHWLS  687



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 125/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  490  PDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEGPWSDTMCNWSPDGEWIAFASD  547

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH PG+   F+IY+V P+GTGLRR+  +G  G       R NH  FS DS+ ++FT++  
Sbjct  548  RHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-------RTNHPWFSPDSKSLVFTSDYA  599

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+GTP+W P
Sbjct  600  AVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLTHNSFEDGTPSWTP  645



>ref|XP_006434259.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
 gb|ESR47499.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
Length=721

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 127/167 (76%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  520  PDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDGEWIAFASD  577

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R+NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + ++FT++ G
Sbjct  578  RYNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKSIVFTSDYG  629

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  630  GISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 134/195 (69%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  507  PDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDGEWIAFASD  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++++ P+GTGLR++  +G+ G       R+NH  FS D   + FT++ G
Sbjct  565  RENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RVNHPYFSPDGNSIAFTSDYG  616

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +    +   
Sbjct  617  GISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---IKPKDVEWP  673

Query  542  GEKLRGKFDEPLWIN  586
            G   +  F+E  W+N
Sbjct  674  GHGPQCSFEECHWLN  688



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 134/195 (69%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  507  PDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDGEWIAFASD  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++++ P+GTGLR++  +G+ G       R+NH  FS D   + FT++ G
Sbjct  565  RENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RVNHPYFSPDGNSIAFTSDYG  616

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +    +   
Sbjct  617  GISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---IKPKDVEWP  673

Query  542  GEKLRGKFDEPLWIN  586
            G   +  F+E  W+N
Sbjct  674  GHGPQCSFEECHWLN  688



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 125/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLY++D+  GE    G+ +LT+GAW DTM SWSPDG+ IAF+S+
Sbjct  516  PDGKLIVFRSGRTGHKNLYLMDAEKGET--SGLWRLTEGAWTDTMCSWSPDGEWIAFASD  573

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F ++++ P+GTGLR++  +G+ G       R NH  FS DS+ ++FT++  
Sbjct  574  RESPGSG-SFELFLIHPNGTGLRKLIQSGSGG-------RTNHPIFSPDSKSIVFTSDYA  625

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTP W P+
Sbjct  626  GISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPVWAPR  672



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 135/199 (68%), Gaps = 20/199 (10%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+ +GE    GIR+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  494  PDGKWVVFRSGRSGHKNLYIMDAEDGE--ASGIRRLTEGPWSDTMCNWSPDGEWIAFASD  551

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RHNPG    F IY+V P+GTGLRR+ V   +G       R NH  FS DS+ ++FT++  
Sbjct  552  RHNPGGG-SFGIYMVHPNGTGLRRV-VHSTDGG------RTNHPWFSPDSKTLVFTSDYA  603

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             V+AEP+S P+ +QPYG+++ + +DG+G++RLT N +E+GTP+W P        L     
Sbjct  604  AVSAEPISNPHHYQPYGEIFTVNIDGSGIRRLTHNSFEDGTPSWTPH------YLKPEDV  657

Query  542  GEKLRGK----FDEPLWIN  586
            GE L+      F++  W+N
Sbjct  658  GETLQASGTCAFEDCHWLN  676



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 134/195 (69%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  507  PDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDGEWIAFASD  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F ++++ P+GTGLR++  +G+ G       R NH  FS D   ++FT++ G
Sbjct  565  RENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RANHPYFSPDGNSIVFTSDYG  616

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +    +   
Sbjct  617  GISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---IKPEDVEWP  673

Query  542  GEKLRGKFDEPLWIN  586
            G   +  F+E  W+N
Sbjct  674  GHGPQCSFEECHWLN  688



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 124/167 (74%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  516  PDGKQIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGVWTDTMCNWSPDGEWIAFASD  573

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F ++++ P+GTG+R++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  574  RESPGSG-SFELFLIHPNGTGIRKLIQSGTGG-------RTNHPVFSPDSKSLVFTSDYA  625

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++ EP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  626  GISGEPISNPHSYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWSPR  672



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 135/199 (68%), Gaps = 20/199 (10%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++ GE    GI +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  518  PDGKWVVFRSGRSGHKNLYIMDAVEGE--SAGIHRLTEGPWSDTMCNWSPDGEWIAFASD  575

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG    F+IY+V P+GTGLRR+  +G+ G       R NH  FS DS+ ++FT++ G
Sbjct  576  RDNPGGG-SFAIYMVHPNGTGLRRVVHSGSGG-------RTNHPWFSPDSKSLVFTSDYG  627

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
             V+AEP+S P+ +QPYG+++ + +DG+ ++RLT N +E+GTP W P        L     
Sbjct  628  AVSAEPISNPHHYQPYGEIFTVGIDGSDIRRLTHNSFEDGTPTWTPYF------LEPADV  681

Query  542  GEKLRG----KFDEPLWIN  586
             E L+G    +FD+  W+N
Sbjct  682  AESLQGSAWCEFDDCHWLN  700



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 123/164 (75%), Gaps = 10/164 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +WSPDG  IAF+S+
Sbjct  506  PDGKWIVFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGSWTDTMCNWSPDGDWIAFASD  563

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS D ++++FT++  
Sbjct  564  RENPGSGS-FEMFMVHPNGTGLRKVIQSGMGG-------RTNHPYFSPDGKYIVFTSDYA  615

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
             V+AEP+S P+ +QPYGD+++++ DG+ ++RLT N YE+GTPAW
Sbjct  616  AVSAEPISNPHHYQPYGDIFVIKSDGSEIRRLTHNSYEDGTPAW  659



>ref|XP_006472827.1| PREDICTED: uncharacterized protein LOC102617553 [Citrus sinensis]
Length=721

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 126/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  520  PDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDGEWIAFASD  577

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + ++FT++ G
Sbjct  578  RDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKSIVFTSDYG  629

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  630  GISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 124/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +WSPDG  IAF+S+
Sbjct  502  PDGKWIVFRSGRSGHKNLYVMDALEGET--GGLYRLTEGSWTDTMCNWSPDGDWIAFASD  559

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS D ++++FT++  
Sbjct  560  RENPGSG-SFEMFMVHPNGTGLRKVIQSGTGG-------RTNHPYFSPDGKYIVFTSDYA  611

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEP++ P+ +QPYGD+++++ DG+ ++R+T N YE+GTPAW P
Sbjct  612  AVSAEPIANPHHYQPYGDIFVIKSDGSEIRRMTHNSYEDGTPAWGP  657



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 126/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  520  PDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDGEWIAFASD  577

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + ++FT++ G
Sbjct  578  RDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKSIVFTSDYG  629

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  630  GISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_010269111.1| PREDICTED: uncharacterized protein LOC104605872 [Nelumbo nucifera]
Length=623

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 132/196 (67%), Gaps = 16/196 (8%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLY++D+L GE    G+R+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  420  PDGKWVVFRSGRSGHKNLYVMDALEGER--AGVRRLTEGPWTDTMCNWSPDGEWIAFASD  477

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG    F+IY + P+GTGL+++  +G  G       R NH  FS D + ++FT++  
Sbjct  478  RDNPGGG-SFAIYFIHPNGTGLKKVVHSGEGG-------RTNHPWFSPDGKSLVFTSDYA  529

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEVDLARLSLG  535
             V+AEP++ P+ +QPYGD+++ R DG+G++RLT N YE+GTP+W P     +D+     G
Sbjct  530  AVSAEPIANPHHYQPYGDIFIARSDGSGIRRLTHNSYEDGTPSWGPMFMRPIDVVESPFG  589

Query  536  KSGEKLRGKFDEPLWI  583
                  R  FD+  W+
Sbjct  590  GP----RCSFDDCHWL  601



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 121/168 (72%), Gaps = 10/168 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK I FRSGRSG+KNLYI+D+++GE   GGI +LT+G W DTM +WSPDG  I F+S+
Sbjct  511  PDGKWIAFRSGRSGYKNLYIMDAVDGER--GGIHRLTEGPWTDTMCNWSPDGDWIVFASD  568

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG    F +YV+ P+GTGLR++  +G+ G       R NH  FS D + ++FT++  
Sbjct  569  RENPGGGG-FELYVIHPNGTGLRKVVHSGSAG-------RTNHPWFSPDGKSIVFTSDYA  620

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  505
             V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE+GTPAW PK 
Sbjct  621  AVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYEDGTPAWAPKV  668



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 10/168 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK I FRSGRSG+KNLYI+D++ GE   GGI +LT+G W DTM +WSPDG  I F+S+
Sbjct  511  PDGKWIAFRSGRSGYKNLYIMDAVXGER--GGIHRLTEGPWTDTMCNWSPDGDWIVFASD  568

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG    F +YV+ P+GTGLR++  +G+ G       R NH  FS D + ++FT++  
Sbjct  569  RENPGGGG-FELYVIHPNGTGLRKVVHSGSAG-------RTNHPWFSPDGKSIVFTSDYA  620

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  505
             V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE+GTPAW PK 
Sbjct  621  AVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYEDGTPAWAPKV  668



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 124/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++ GE   GG+ +LTDG W DTM +WSPDG+ IAF+S+
Sbjct  527  PDGKWIVFRSGRSGHKNLYIMDAVKGE--EGGLYRLTDGPWSDTMCNWSPDGEWIAFASD  584

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   FS+Y++ P+GTGLR++  +G+ G       R NH  FS D + ++FT++  
Sbjct  585  REDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG-------RANHPYFSPDGKSIVFTSDYA  636

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEP+S  + +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P
Sbjct  637  AVSAEPISNSHHYQPYGEIFTIKLDGSDLKRLTHNSYEDGTPAWGP  682



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 124/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  484  PDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEGPWSDTMCNWSPDGEWIAFASD  541

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH PG+   F+IY+V P+GTGLRR+  +G  G       R NH  F  DS+ ++FT++  
Sbjct  542  RHAPGSG-SFAIYMVHPNGTGLRRVVHSGDGG-------RTNHPWFGPDSKSLVFTSDYA  593

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+GTP+W P
Sbjct  594  AVSAEPVSNPHHYQPYGEIFTVHIDGSNIRRLTHNSFEDGTPSWTP  639



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 134/195 (69%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLY +D+  GE   GGI +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  501  PDGKWVVFRSGRAGHKNLYAMDAEEGE--KGGIHRLTEGPWSDTMCNWSPDGEWIAFASD  558

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F +Y++ P+GTGLR++  +G  G       R NH  FS D + V+FT +  
Sbjct  559  REDPGSG-SFELYLIHPNGTGLRKLVQSGLGG-------RTNHPYFSPDGKSVVFTTDYA  610

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG++Y ++LDG+ L+RLT N +E+GTPAW P   + +    +   
Sbjct  611  GISAEPISNPHHYQPYGEIYTIKLDGSDLKRLTHNSFEDGTPAWGP---IYIEPNDVEWP  667

Query  542  GEKLRGKFDEPLWIN  586
             E+ + +F++  W+N
Sbjct  668  NERPQCQFEDCHWLN  682



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 123/166 (74%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLYI+D++ G  D   +R+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  502  PDGKWVVFRSGRSGHKNLYIMDAVEG--DSAALRRLTEGPWSDTMCNWSPDGEWIAFASD  559

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F+IY++ P+GTGLR++  +G  G       R NH  FS DS+ + FT++  
Sbjct  560  RDNPGSG-SFAIYMIHPNGTGLRKVVHSGDGG-------RTNHPWFSPDSKSLAFTSDYA  611

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            GV+AEP+S P+ +QPYG+++ +++DG+ ++RLT N +E+GTP W P
Sbjct  612  GVSAEPISNPHHYQPYGEIFTVKIDGSDIRRLTHNSFEDGTPTWAP  657



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 122/167 (73%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSG++G+KNLYI+D+++GE    G+R+LT+G W DTM SWSPDG  IAFSS+
Sbjct  502  PDGKWIVFRSGQTGYKNLYIMDAVDGE--SKGLRRLTEGLWTDTMCSWSPDGDWIAFSSD  559

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG A  F ++++ P+GTGLR++  +G  G       R NH  +  D + ++FT +  
Sbjct  560  RENPG-AGSFDLFLIHPNGTGLRKLFQSGLGG-------RANHPNWRPDGKALVFTTDNA  611

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++AEPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GTP W P+
Sbjct  612  GISAEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGTPTWSPR  658



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 120/166 (72%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+G W DTM +WSPDG  IAF+S+
Sbjct  493  PDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTEGPWTDTMCNWSPDGNWIAFASD  550

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F +YV+RP+G GLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  551  REDPGSG-SFELYVIRPNGAGLRKVIQSGTGG-------RTNHPWFSPDSKSLVFTSDYR  602

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  603  AISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTQNSYEDGTPVWVP  648



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 122/166 (73%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D+  GE  G  +++LT+G W DTM +WSPDG  IAF+S+
Sbjct  513  PDGKRIVFRSGRSGHKNLYIMDAEEGERIG--LQRLTEGPWTDTMCNWSPDGDWIAFASD  570

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +YV+ P+GTGLR++  +G+ G       R NH  FS D + ++FT++ G
Sbjct  571  RENPGSG-SFELYVIHPNGTGLRKVIQSGSGG-------RTNHPWFSPDGKSLVFTSDYG  622

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             ++AEP+S P+ +QPYG+++ +++DG+ L+RLT N +E+GTP W P
Sbjct  623  AISAEPISNPHHYQPYGEIFTVKVDGSDLRRLTQNSFEDGTPVWVP  668



>ref|XP_007223068.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
 gb|EMJ24267.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
Length=553

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 121/166 (73%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSG SGHKNLYI+D+ +GE    G+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  350  PDGKRIVFRSGLSGHKNLYIMDAEDGER--SGLHRLTEGMWTDTMCNWSPDGEWIAFASD  407

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +YV+ P+GTGLR++  +G+ G       R NH  FS D + ++FT++ G
Sbjct  408  RDNPGSG-SFELYVIHPNGTGLRKVIESGSGG-------RTNHPWFSPDGKSLVFTSDYG  459

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             ++AEP+S P+ +QPYG+++ + LDG+ L+RLT N YE+GTP W P
Sbjct  460  AISAEPISNPHHYQPYGEIFTINLDGSDLRRLTQNSYEDGTPVWIP  505



>ref|XP_001780675.1| predicted protein [Physcomitrella patens]
 gb|EDQ54561.1| predicted protein [Physcomitrella patens]
Length=710

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 123/190 (65%), Gaps = 12/190 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK++VFRSGR+G KNLYI+D+  GE     +R+LT+G W DTMP+WSPD + IAFSSN
Sbjct  496  PDGKYVVFRSGRTGRKNLYIMDAAGGEEKY--LRRLTEGRWRDTMPAWSPDNEWIAFSSN  553

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +P     FS+Y++RP+GT L  +   G  G          H  FS DS+ + FT+N  
Sbjct  554  RAHPTGERSFSLYLIRPNGTDLHMLLDTGVGGLAM-------HAVFSPDSKRIAFTSNWA  606

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            GV+AEP+S P+ +QPYG ++++ +DGTGL RLT N YE+GTP W     + L + ++   
Sbjct  607  GVSAEPISFPHAYQPYGTIFVINIDGTGLTRLTHNAYEDGTPTW---GRLPLPKPAISSD  663

Query  542  GEKLRGKFDE  571
            G +    FD+
Sbjct  664  GRRSSCDFDD  673



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 118/166 (71%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+G W DTM +WSPDG  IAF+S+
Sbjct  493  PDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTEGPWTDTMCNWSPDGNWIAFASD  550

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F +YV+RP+GTGLR++  +G  G       R NH  FS DS+ ++FT++  
Sbjct  551  REDPGSG-SFELYVIRPNGTGLRKVIQSGTGG-------RTNHPWFSPDSKSLVFTSDYR  602

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             ++AEP+     +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  603  AISAEPIXNXXHYQPYGEIFTVKLDGSDLKRLTQNSYEDGTPVWVP  648



>ref|XP_004160721.1| PREDICTED: protein TolB-like [Cucumis sativus]
Length=703

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 120/167 (72%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSG++G+KNLYI+D++ GE    G+R+LT+G W DTM SWSP+G  IAFSS+
Sbjct  502  PDGKWIVFRSGQTGYKNLYIMDAVEGE--SKGLRRLTEGQWTDTMCSWSPEGDWIAFSSD  559

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG  + F ++++ P+GTGLR++  +G  G       R NH  +  D + ++FT +  
Sbjct  560  RENPGGGN-FDLFLIHPNGTGLRKLFQSGLGG-------RANHPNWRPDGKALVFTTDNA  611

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++ EPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GTP W P+
Sbjct  612  GISGEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGTPTWSPR  658



>ref|XP_008219596.1| PREDICTED: uncharacterized protein LOC103319783 [Prunus mume]
Length=697

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 121/166 (73%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSG SGHKNLYI+D+ +GE    G+++LT+G W DTM +WSPDG+ IAF+S+
Sbjct  494  PDGKRIVFRSGLSGHKNLYIMDAEDGER--SGLQRLTEGMWTDTMCNWSPDGEWIAFASD  551

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R +PG+   F +YV+ P+GTGLR++  +G+ G       R NH  FS D + ++FT++  
Sbjct  552  RDDPGSG-SFELYVIHPNGTGLRKVIQSGSGG-------RTNHPWFSPDGKSLVFTSDYR  603

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             ++AEP+S P+ +QPYG+++ + LDG+ L+RLT N YE+GTP W P
Sbjct  604  AISAEPISNPHHYQPYGEIFTINLDGSDLKRLTQNSYEDGTPVWIP  649



>ref|XP_004149439.1| PREDICTED: protein TolB-like [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 119/167 (71%), Gaps = 10/167 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSG++G+KNLYI+D++ GE    G+R+LT+G W DTM SWSP+G  IAFSS+
Sbjct  502  PDGKWIVFRSGQTGYKNLYIMDAVEGE--SKGLRRLTEGQWTDTMCSWSPEGDWIAFSSD  559

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG    F ++++ P+GTGLR++  +G  G       R NH  +  D + ++FT +  
Sbjct  560  RENPGGG-SFDLFLIHPNGTGLRKLFQSGLGG-------RANHPNWRPDGKALVFTTDNA  611

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            G++ EPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GTP W P+
Sbjct  612  GISGEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGTPTWSPR  658



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 132/195 (68%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IVFRSG++G KNLYI+D++ GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+
Sbjct  526  PDGNRIVFRSGQTGFKNLYIMDAVKGE--EGGLHRLTEGPWTDTMCNWSPDGEWIAFASD  583

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R NPG+   F +Y++ P+GTGLR +  +G+ G       R NH  FS D + + FT++  
Sbjct  584  RENPGSG-SFELYLIHPNGTGLRTLIESGSGG-------RTNHPWFSPDGKKLAFTSDYA  635

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS  541
            G++AEP+S P+ +QPYG+++ +  DG+ ++RLT N YE+GTP W PK    +  + +   
Sbjct  636  GISAEPISNPHHYQPYGEIFTVNFDGSDVRRLTHNSYEDGTPTWVPKF---IRPVDVEWP  692

Query  542  GEKLRGKFDEPLWIN  586
             ++ R +F++  W+N
Sbjct  693  VDRPRCEFEDLHWLN  707



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 112/168 (67%), Gaps = 12/168 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS  SG+KNLYI+D+  GE   GG+ +LTDGAW DTM SWSPDG  IAF+SN
Sbjct  482  PDGKRIVFRSSMSGNKNLYIMDAEKGET--GGLFRLTDGAWNDTMCSWSPDGDWIAFASN  539

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL-NHVCFSSDSEWVLFTANL  358
            R NPG  + F ++++ P+GTGLR++         E    R+ NH  FS D + V FT+N 
Sbjct  540  RENPGT-ESFGLFLIHPNGTGLRKL--------TETGLGRMSNHPVFSPDGKTVAFTSNY  590

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
              ++AEP+S P+     G+++ ++LDG+ L R+T N Y +GTP W PK
Sbjct  591  AAISAEPISNPDIAISAGEIFTVKLDGSDLSRVTHNSYMDGTPIWAPK  638



>ref|XP_006652005.1| PREDICTED: uncharacterized protein LOC102702184, partial [Oryza 
brachyantha]
Length=391

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGRSGHKNLY++D+ +GE   GG+R+LT+G W DTM +WSPDG+ IAF+S+
Sbjct  193  PDGKWVVFRSGRSGHKNLYVMDAEHGE--AGGVRRLTEGPWSDTMCNWSPDGEWIAFASD  250

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            RH+PG+         R               G       R NH  FS DS+ ++FT++  
Sbjct  251  RHDPGSG--------RFAXXXXXXXGPGRRGGVHSGGGGRTNHPWFSPDSKSIVFTSDYA  302

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GTPAW P
Sbjct  303  AVSAEPVSNPHHYQPYGEIYTVSIDGSNIRRLTHNSFEDGTPAWTP  348



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 113/175 (65%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KN+YIID+  GE   GG+ +LT+G W D++P+WSPDG  I FSSN
Sbjct  503  PDGKRIVFRSARSGAKNIYIIDAEKGE--SGGLFRLTNGNWNDSIPTWSPDGNWIVFSSN  560

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ ++FT    
Sbjct  561  REFPGTF-LDNLYVVHPDGTGLRKL-------AQNLTGGLSMHSTFSPDSKRIVFTTTYA  612

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEVDLA  520
            G++AEP+ +P+ F   G+++ + LDG+ L RLT N  E+G P W P  KA VD+A
Sbjct  613  GISAEPIGVPHFFIAGGEIFTVNLDGSDLTRLTHNSVEDGPPMWFPKIKATVDVA  667



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 111/156 (71%), Gaps = 11/156 (7%)
 Frame = +2

Query  32   GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  211
            G  GHKNLYI+D+ +GE   GGIR+LT+G W DTM +WSP  + IAF+S+RH PG+   F
Sbjct  284  GCRGHKNLYIMDAKDGE--AGGIRRLTEGPWSDTMCNWSPHDEWIAFASDRHAPGSGS-F  340

Query  212  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP  391
            +I +V P+GTGLRR+  +G  G       R NH  FSSD + ++FT++   V+AEPVS P
Sbjct  341  AI-MVHPNGTGLRRVVHSGDGG-------RTNHPWFSSDFKSLVFTSDYAAVSAEPVSNP  392

Query  392  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            + +QPYG++Y + +DG+ ++RLT N +E+GTP+W P
Sbjct  393  HHYQPYGEIYTVDIDGSNIRRLTHNSFEDGTPSWTP  428



>emb|CBI18981.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 97/139 (70%), Gaps = 8/139 (6%)
 Frame = +2

Query  89   GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  268
            GGGI +LT+G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G
Sbjct  372  GGGIHRLTEGPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSG  430

Query  269  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  448
            + G       R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL
Sbjct  431  SAG-------RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGL  483

Query  449  QRLTWNGYENGTPAWHPKA  505
             RLT N YE+GTPAW PK 
Sbjct  484  HRLTHNSYEDGTPAWAPKV  502



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 107/169 (63%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD   I F+SN
Sbjct  497  PDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDNNWIVFASN  554

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ ++FT+   
Sbjct  555  REFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKRIVFTSIYA  606

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
            G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  607  GLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 107/169 (63%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD   I F+SN
Sbjct  497  PDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDNNWIVFASN  554

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ ++FT+   
Sbjct  555  REFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKRIVFTSIYA  606

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
            G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  607  GLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 106/169 (63%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD   I F+SN
Sbjct  497  PDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDNNWIVFASN  554

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ ++FT+   
Sbjct  555  REFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKRIVFTSIYA  606

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
            G++AEP+  P    P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  607  GLSAEPIGTPRFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 107/169 (63%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD   I F+SN
Sbjct  496  PDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDNNWIVFASN  553

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ ++FT+   
Sbjct  554  REFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKRIVFTSIYA  605

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
            G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  606  GLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  654



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 106/169 (63%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPDG  I F+SN
Sbjct  499  PDGKRIVFRSARSGTKNLYIMDAEKGE--SGGLFRLTNGNWNDTIATWSPDGNWIVFASN  556

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     +IYVV PDGTGLR++       ++ +      H  FS DS+ ++FT    
Sbjct  557  REFPGTL-LMNIYVVHPDGTGLRKL-------AQNLTGLVSMHPMFSPDSKRIVFTTIYA  608

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
            G++AE +  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  609  GISAEQIGNPHFNVPSSEIFTVNLDGSGLTRLTHNSVEDGPPMWFPKIK  657



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 106/169 (63%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPDG  I F+SN
Sbjct  499  PDGKRIVFRSSRSGTKNLYIMDAEKGE--SGGLFRLTNGNWNDTIATWSPDGNWIVFASN  556

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     +IYVV PDGTGLR++       ++ +      H  FS DS+ ++FT    
Sbjct  557  REFPGTL-LMNIYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKRIVFTTIYA  608

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
            G++AE +  P+   P  +++ + LDG+G+ RLT N  E+G P W PK +
Sbjct  609  GISAEQIGNPHFNVPSSEIFTVNLDGSGMTRLTHNSVEDGPPMWFPKIK  657



>ref|XP_002520327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42113.1| conserved hypothetical protein [Ricinus communis]
Length=540

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 106/161 (66%), Gaps = 14/161 (9%)
 Frame = +2

Query  20   VFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN  199
            VFR  R+    LYI+D++ GE   GG+ ++ +G W DTM  WSPDG+ I F S+R  PG 
Sbjct  344  VFRVVRT----LYIMDAVEGE--KGGLYRVIEGLWDDTMCDWSPDGEWIVFCSDREEPGT  397

Query  200  ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEP  379
               F +Y + P+GTGLR++  +G+ G       R+NH+  S + + ++FT +   ++AEP
Sbjct  398  G-SFDLYFIHPNGTGLRKLLQSGSGG-------RVNHLYISPNGKSIVFTTDYTAISAEP  449

Query  380  VSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  502
            +S    FQPYG++Y++ LDG+GL+RLT N +E+GTPAW P+
Sbjct  450  ISNQQMFQPYGEIYIINLDGSGLKRLTHNSFEDGTPAWGPR  490



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 102/169 (60%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D + +WSPDG  I F+SN
Sbjct  500  PDGKRIVFRSARSGTKNLYIMDAEKGET--GGLFRLTNGNWSDVIATWSPDGNWIVFASN  557

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ ++FT    
Sbjct  558  REFPGTL-LMNLYVVHPDGTGLRKV-------AQNLTGAVSMHPMFSPDSKRIVFTTTYA  609

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
             ++AE +  P+   P  +++ + LDG+   RLT N  E+G P W PK +
Sbjct  610  AISAESIGNPHFNVPSSEIFTVNLDGSDFTRLTHNSLEDGPPMWFPKIK  658



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 100/169 (59%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD   I F+SN
Sbjct  500  PDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDNNWIVFASN  557

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   G      +YVV PDGTGLR++       ++ +      H  FS DS+ ++FT    
Sbjct  558  REYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMHPMFSPDSKRIVFTTTYA  609

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
            G++AEP+  P       +++ + LDG+   RLT N  E+G P W PK +
Sbjct  610  GISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPLWFPKIK  658



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 107/175 (61%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG  NLYI+D+  GE   GG+ +LT+G   DT+ +WSPDG  I F+SN
Sbjct  494  PDGKRIVFRSARSGSFNLYIMDAKKGET--GGLFRLTNGHGNDTIATWSPDGNWIVFASN  551

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R  PG     ++YVV PDGTGL+++       +E++      H  FS DS+ ++FT    
Sbjct  552  REFPGTL-FLNLYVVHPDGTGLKKV-------TEKLTGGISMHPMFSPDSKRIVFTTIHA  603

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEVDLA  520
             ++AEP+  P+   P  +++ + LDG+ L R+T N  E+G P W P  KA  D+A
Sbjct  604  AISAEPIGNPHFNVPSSEIFTVNLDGSDLTRITHNSVEDGPPMWFPKIKATSDVA  658



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 99/169 (59%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD   I F+SN
Sbjct  507  PDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDNNWIVFASN  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   G      +YVV PDGTGLR++       ++ +      H  FS DS+ ++FT    
Sbjct  565  REYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMHPMFSPDSKRIVFTTTYA  616

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
             ++AEP+  P       +++ + LDG+   RLT N  E+G P W PK +
Sbjct  617  AISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPLWFPKIK  665



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 99/169 (59%), Gaps = 10/169 (6%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD   I F+SN
Sbjct  507  PDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDNNWIVFASN  564

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   G      +YVV PDGTGLR++       ++ +      H  FS DS+ ++FT    
Sbjct  565  REYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMHPMFSPDSKRIVFTTTYA  616

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
             ++AEP+  P       +++ + LDG+   RLT N  E+G P W PK +
Sbjct  617  AISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPLWFPKIK  665



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 101/166 (61%), Gaps = 18/166 (11%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DG  IVFRSGRSG KNLYI+ +   E +  G+ +LT+G W DTMP W+P    I F+S+R
Sbjct  510  DGSEIVFRSGRSGFKNLYIMPT---EGEAAGLIRLTEGPWDDTMPGWTPASGWIVFASSR  566

Query  185  HNPGN---ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTAN  355
                +   A  F I+++R DG+GL+++         + +    NH  FS     V+FT  
Sbjct  567  EYVESNRPAGAFDIFMIRTDGSGLQKVF--------DSHGGLANHPHFSPSQTSVVFTR-  617

Query  356  LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
                +AE +S P+QFQPYGDL+ +  DGT L+RLT + YENGTPAW
Sbjct  618  ---YSAEEISTPHQFQPYGDLFAIDTDGTNLRRLTHDPYENGTPAW  660



>gb|EMT16880.1| hypothetical protein F775_15390 [Aegilops tauschii]
Length=390

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 107/180 (59%), Gaps = 33/180 (18%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDG-GGIRQLTDGAWIDTMPSWSPDGKL-----  163
            PDGK I F     G   LY+++S     DG GG R++  G    T   W   G +     
Sbjct  176  PDGKRIAF----VGLPGLYVVNS-----DGSGGRRKIFSGNAFPTSWDWKRKGVIYTSIG  226

Query  164  ----------IAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHV  313
                      IAF+S+RHNPG A  F+IY++ P+GTGLRR+ V  A+G       R NH 
Sbjct  227  PDFASESTEWIAFASDRHNPG-AGSFAIYMIHPNGTGLRRV-VHSADGG------RTNHP  278

Query  314  CFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
             FS DS+ ++FT++L  V+AEP+S P  +QPYG+++ + +DG+GLQRLT N +E+GTP+W
Sbjct  279  WFSPDSKRMVFTSDLAAVSAEPISNPRHYQPYGEIFTINIDGSGLQRLTHNSFEDGTPSW  338



>ref|NP_001173830.1| Os04g0278101 [Oryza sativa Japonica Group]
 dbj|BAH92558.1| Os04g0278101 [Oryza sativa Japonica Group]
Length=378

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 91/143 (64%), Gaps = 30/143 (21%)
 Frame = +2

Query  71   LNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLR  250
            L+GE   GGIR+LT+G W DTM +WSPD + IAF+S+RH PG+   F+I +V P+GTG  
Sbjct  224  LDGE--AGGIRRLTEGPWSDTMCNWSPDDEWIAFASDRHAPGSG-SFAI-MVHPNGTG--  277

Query  251  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMR  430
                                    SDS+ ++FT++   V+AEPVS P+ +QPYG++Y + 
Sbjct  278  ------------------------SDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVD  313

Query  431  LDGTGLQRLTWNGYENGTPAWHP  499
            +DG+ ++RLT N +E+GTP+W P
Sbjct  314  IDGSNIRRLTHNSFEDGTPSWTP  336



>ref|XP_002467956.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
 gb|EER94954.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
Length=724

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 106/190 (56%), Gaps = 31/190 (16%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG   VFRS R G    +KNLYI+ D+  GE+ GG + +LT+G+WIDT   WSPDG L+
Sbjct  491  PDGTKFVFRSTRDGGDKNYKNLYIMEDAEFGEVGGGKVTRLTEGSWIDTHCQWSPDGNLV  550

Query  167  AFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  319
             F+SNR  P +A           F++Y++      + R+  +G + S  V     NH  F
Sbjct  551  VFASNRDKPADAPERDHGLDPGYFAVYLMNVSDRSVVRVIRSGYDLSGHV-----NHPVF  605

Query  320  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ---------RLTW  463
            S D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   ++         R+T 
Sbjct  606  SPDGRSIAVTSDLAAVSADPMSLPTFLHSVRPYGDIFSVDIDPDDMEKNKDLDKFVRVTH  665

Query  464  NGYENGTPAW  493
            + YEN TPAW
Sbjct  666  SRYENSTPAW  675



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVFRSGRSGHKNLYI+D++ GE   GG+ +LTDG W DTM +WSPDG+ IAF+S+
Sbjct  527  PDGKWIVFRSGRSGHKNLYIMDAVKGE--EGGLYRLTDGPWSDTMCNWSPDGEWIAFASD  584

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  322
            R +PG+   FS+Y++ P+GTGLR++  +G+ G       R NH  FS
Sbjct  585  REDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG-------RANHPYFS  623



>ref|XP_010676032.1| PREDICTED: uncharacterized protein LOC104891942 [Beta vulgaris 
subsp. vulgaris]
Length=662

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 98/190 (52%), Gaps = 27/190 (14%)
 Frame = +2

Query  5    DGKHIVFRSGRSGH--KNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  175
            DG  +V+RS R G+  KNLYI+ D+  GE  GG I +LT+G W DT   WSP+G  I F+
Sbjct  426  DGTKLVYRSSRDGNNCKNLYIMQDASKGEFMGGEITRLTEGEWTDTHCQWSPNGDWIVFA  485

Query  176  SNRHNPG--------NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE----RLNHVCF  319
            SNR NP         +   F IY+V+ D        +     S    RE     +NH  F
Sbjct  486  SNRANPTAPKKDDLPDPGYFGIYMVKADNKNAWLKVIDSGFDSTRPGRELFPGHVNHPFF  545

Query  320  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLTW  463
            S D + ++  A+L  V+ EP+S+P   +  +PYGD++ + LD          T  +RLT 
Sbjct  546  SPDGKSIVIAADLAAVSCEPISLPLFAHSVRPYGDIFTVDLDSENFENNANLTKFKRLTH  605

Query  464  NGYENGTPAW  493
            + YEN T  W
Sbjct  606  SRYENSTAVW  615



>gb|EMT08438.1| hypothetical protein F775_30261 [Aegilops tauschii]
Length=806

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 103/188 (55%), Gaps = 31/188 (16%)
 Frame = +2

Query  5    DGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  172
            DG  +VFRS R+G    +KNLY++D+  GE DGG   ++T+G WIDT   WSPD   I F
Sbjct  576  DGTKLVFRSTRNGGHKKYKNLYMMDAEIGE-DGGEAERITEGDWIDTHCQWSPDRDWIVF  634

Query  173  SSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  325
            SSNR  P +A           F++Y++      + R+  +G + S  V     NH  FS 
Sbjct  635  SSNRDKPADAPERDHGMDPGYFAVYLMNAIDRSVVRVIRSGYDFSGHV-----NHPVFSP  689

Query  326  DSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ---------RLTWNG  469
            D   ++ TA+L  V+A+P+S+P   +  +PYGD++ + +D   ++         R+T + 
Sbjct  690  DGRSIVVTADLAAVSADPMSLPLLLHSQRPYGDIFTVDIDPDDMEKNQDVEEFARVTHSR  749

Query  470  YENGTPAW  493
            YEN TP W
Sbjct  750  YENATPDW  757



>ref|XP_010675836.1| PREDICTED: uncharacterized protein LOC104891779 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 101/188 (54%), Gaps = 27/188 (14%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQLTDGAWIDTMPSWSPDGKLI  166
            PDG  +VFRS R G    +KNLYII+ L+   DG G I +LT+G W+DT   WSP+G+ I
Sbjct  490  PDGTKLVFRSTRDGGENHYKNLYIIEDLDSMEDGEGEITRLTNGPWVDTHCEWSPNGEWI  549

Query  167  AFSSNRHNPGNAD-------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  325
             F+SNRH   +          F++Y+V+ D   +  + V G+   +      +NH  FS 
Sbjct  550  VFASNRHRTTDDSDHGLDTGYFAVYLVKADDPDV-WVKVIGSRSGDLAG--HVNHPFFSP  606

Query  326  DSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------QRLTWNG  469
            D   +   A+L  V+ +P+S+P   +  +PYGDL+++ +D   +         +R+T   
Sbjct  607  DGRSLSVVADLAAVSCDPISMPLFIHSVRPYGDLFILDIDEDDIYANEDVEDYRRITHTR  666

Query  470  YENGTPAW  493
            YEN T  W
Sbjct  667  YENSTAVW  674



>ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
 gb|EES10373.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
Length=730

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 99/191 (52%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG   VFRS R G    HKNLYI  D+  GE  GG + +LT+G W DT   WSP G  I
Sbjct  496  PDGSRFVFRSTRDGGDKKHKNLYIAEDAEVGEYSGGTVTRLTNGEWTDTHCQWSPRGDWI  555

Query  167  AFSSNRHNPGNAD---------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVNRERLNHVC  316
             FSS R  P +A           +++++V+  D T + R+  +G +    V     NH  
Sbjct  556  VFSSTRDKPKDAPELDNGLDSGYYAVFMVKVSDPTVVIRVVQSGDDLGGHV-----NHPV  610

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLT  460
            FS D   +  TA+L  V+A+P+S+P   +  +PYGD++++ +D              R+T
Sbjct  611  FSPDGRSIAMTADLAAVSADPISLPLFIHSVRPYGDIFVVDIDPDDARKNKDVKKFHRVT  670

Query  461  WNGYENGTPAW  493
             + YE  TPAW
Sbjct  671  HSRYEYSTPAW  681



>ref|XP_010102639.1| hypothetical protein L484_010931 [Morus notabilis]
 gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis]
Length=714

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 105/191 (55%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG  +VFRS R G    +KNLYI+ D+ +GE   G I +LT+G WIDT   WSP G  I
Sbjct  481  PDGTKLVFRSTRDGGDERYKNLYIMEDAESGEYGDGIITRLTNGPWIDTHCQWSPRGDWI  540

Query  167  AFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVC  316
             FSS R  P +A           F++Y+V+  D + + R+  +G++ +  V     NH  
Sbjct  541  VFSSTRDKPEDAPESDNDLDPGYFAVYLVKANDPSVVVRVLGSGSDVAGHV-----NHPI  595

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------QRLT  460
            FS D + ++ TA+L  V+ +P+S+P   +  +PYGD++ + +D   +          R+T
Sbjct  596  FSPDGKSIVVTADLAAVSVDPISLPLFLHSVRPYGDIFTIDIDPDDIYMNEDVEKCNRIT  655

Query  461  WNGYENGTPAW  493
             + YEN T +W
Sbjct  656  HSRYENSTASW  666



>ref|XP_004963491.1| PREDICTED: uncharacterized protein LOC101774581 [Setaria italica]
Length=740

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 95/190 (50%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            P+G   VFRS R G    HKNLYI+ DS  GE   G + +LTDG W DT  SWSP G  I
Sbjct  526  PEGTKFVFRSTRDGGDKHHKNLYIMEDSDMGEHGEGTVTRLTDGPWTDTHCSWSPRGDWI  585

Query  167  AFSSNRHNPGNAD--------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  322
             FSS+R  P  A          F+I++V  +   +    V     S +     + H  FS
Sbjct  586  VFSSSRDKPAGAPEKDILDPGFFAIFLVNANNPDV----VVRVMKSSDTIAGHVTHPMFS  641

Query  323  SDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGT----------GLQRLTW  463
             D   ++ TA+L  V+AEP+S+P   +  +PYGD++ + L  T             R+T 
Sbjct  642  PDMRSIVVTADLAAVSAEPISMPQFLHSVRPYGDVFSVNLRDTVDIAKNENIEEFHRITH  701

Query  464  NGYENGTPAW  493
            + YE  TPAW
Sbjct  702  SRYEYATPAW  711



>ref|XP_004960704.1| PREDICTED: uncharacterized protein LOC101777811 [Setaria italica]
Length=754

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 97/204 (48%), Gaps = 34/204 (17%)
 Frame = +2

Query  5    DGKHIVFRSGR----------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSP  151
            DG   VFR  R            H NLYI+ D+  GE   G + QLTDG W+DT  SWSP
Sbjct  508  DGSKFVFRCTRDRTHGQSVRKQNHTNLYIMEDAEEGEWGEGTVTQLTDGPWVDTHCSWSP  567

Query  152  DGKLIAFSSNRH-----NPGNADC--FSIYVVRP---DGTGLRRIHVAGAEGSEEVNRER  301
             G  I FSS+R       PG  D   FSIY+V     D T            S +     
Sbjct  568  SGDWIVFSSSRDKDPDAQPGTLDAGYFSIYIVNAAERDPTNKTMPPPVRVVHSADTFIGH  627

Query  302  LNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL----------DGT  442
            +NH  FS D   ++FT++L  V+ EP+S+P   +  +PYGD++ + L          + T
Sbjct  628  VNHPVFSHDMRSLIFTSDLAAVSVEPISMPIFIHSVRPYGDIFSVDLRDDKDIAKNENIT  687

Query  443  GLQRLTWNGYENGTPAWHPKAEVD  514
               RLT + YE  TPAW   A VD
Sbjct  688  EFHRLTHSRYEYSTPAWTKFATVD  711



>gb|EMS54560.1| hypothetical protein TRIUR3_19354 [Triticum urartu]
Length=136

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 68/93 (73%), Gaps = 7/93 (8%)
 Frame = +2

Query  221  VVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQF  400
            +V P+GTGLRR+ V  A+G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +
Sbjct  1    MVHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKSMVFTSDLAAVSAEPISNPHHY  53

Query  401  QPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            QPYG+++ + +DG+GLQRLT N +E+GTP+W P
Sbjct  54   QPYGEIFTINIDGSGLQRLTHNSFEDGTPSWTP  86



>ref|XP_010675829.1| PREDICTED: uncharacterized protein LOC104891772 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 102/193 (53%), Gaps = 22/193 (11%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIID-SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            DG  +V+RS + G KNLYI++ +L GE +G  + +LT+G W DT   WSP    I F+SN
Sbjct  493  DGTRLVYRSTKDGPKNLYIMENALLGEFEGAKVTRLTEGNWTDTHCQWSPKQDWIVFASN  552

Query  182  RHNPG--------NADCFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSE  334
            R NP         +   F +Y+V+  D T + ++  +G     ++    +NH  FS D E
Sbjct  553  RSNPTAKTPQDLPDPGFFGVYLVKANDKTVVVKVMDSGYTYLGDLFPGHVNHPFFSPDGE  612

Query  335  WVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLTWNGYEN  478
             ++  A+L  V+ +PVS+P   +  +PYGD++++ ++              R+T + YEN
Sbjct  613  SLVVAADLAAVSCDPVSMPLFVHSVRPYGDIFILDINRDDIYKNENLKKFTRVTHSKYEN  672

Query  479  GTPAWHPKAEVDL  517
             T  W   +  DL
Sbjct  673  STATWTMTSTKDL  685



>ref|XP_002519807.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42603.1| conserved hypothetical protein [Ricinus communis]
Length=711

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 100/191 (52%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G WIDT   WSP G  I
Sbjct  488  PDGTKLVFRSTRDGGDKKYKNLYIMEDARVGEYGDGKITRLTNGPWIDTHCQWSPRGNWI  547

Query  167  AFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVC  316
             FSS R  P +A           F++++V+  D + + R+  +G   +  V     NH  
Sbjct  548  VFSSTRDKPKDAPETDNGLDPGYFAVFLVKANDSSVVVRVIKSGDNIAGHV-----NHPF  602

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLT  460
            FS D   +  T++L  V+ +PVS+P   +  +PYGD++ + +D              R+T
Sbjct  603  FSPDGMSIAVTSDLAAVSVDPVSLPHFLHSVRPYGDVFTLDIDPDDINKNKDLKKFNRIT  662

Query  461  WNGYENGTPAW  493
             + YEN TP+W
Sbjct  663  HSRYENATPSW  673



>dbj|BAJ92843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=754

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 96/192 (50%), Gaps = 33/192 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKL  163
            P G   VFRS R G     HKNLYI+ D+  GE   G + +LTDG W DT  SWSP G  
Sbjct  517  PQGDKFVFRSTRDGGKEKFHKNLYIMEDAEVGEFSEGTVTRLTDGPWTDTHCSWSPRGDW  576

Query  164  IAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVNRERLNHVC  316
            + FSS R  P         +A  F++Y+V+  D T + R+  + A  +  V     NH  
Sbjct  577  VVFSSTREMPPSAPEMAFLDAGYFAVYLVKVSDPTAVVRVVQSSATLAGHV-----NHPI  631

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG----------LQRL  457
            FS D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T             R+
Sbjct  632  FSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDIAKNKDIQEFHRI  691

Query  458  TWNGYENGTPAW  493
            T + YE  TP W
Sbjct  692  THSRYEYSTPTW  703



>ref|NP_001049934.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|ABF95608.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11848.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|EAZ26709.1| hypothetical protein OsJ_10615 [Oryza sativa Japonica Group]
Length=730

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 100/193 (52%), Gaps = 34/193 (18%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDTMPSWSPDG  157
            PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT   WSP+G
Sbjct  494  PDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDTHCQWSPNG  553

Query  158  KLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  310
            K I FSSNR  P +A           F++Y++      + R+  +G + +  V     NH
Sbjct  554  KWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGHV-----NH  608

Query  311  VCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQR  454
              FS D   +  T++L  VTA+P+S+P   +  +PYGD++ + +D           G  R
Sbjct  609  PVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARNEDVEGFVR  668

Query  455  LTWNGYENGTPAW  493
            +T + YEN TPAW
Sbjct  669  VTHSRYENSTPAW  681



>gb|EAY89757.1| hypothetical protein OsI_11300 [Oryza sativa Indica Group]
Length=737

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 100/193 (52%), Gaps = 34/193 (18%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDTMPSWSPDG  157
            PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT   WSP+G
Sbjct  501  PDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDTHCQWSPNG  560

Query  158  KLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  310
            K I FSSNR  P +A           F++Y++      + R+  +G + +  V     NH
Sbjct  561  KWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGHV-----NH  615

Query  311  VCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQR  454
              FS D   +  T++L  VTA+P+S+P   +  +PYGD++ + +D           G  R
Sbjct  616  PVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARNEDVEGFVR  675

Query  455  LTWNGYENGTPAW  493
            +T + YEN TPAW
Sbjct  676  VTHSRYENSTPAW  688



>ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42598.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 102/191 (53%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   WSP G  I
Sbjct  491  PDGTKLVFRSTRDGGDKQYKNLYIMEDAKVGEFGDGKITRLTNGPWTDTHCQWSPRGDWI  550

Query  167  AFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVC  316
             FSS R  P +A           F++++V+  D + + R+  +G + +  V     NH  
Sbjct  551  VFSSTRDKPKDAPDSDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-----NHPF  605

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------QRLT  460
            FS D   +  T++L  V+ +P+S+P   +  +PYGDL+++ +D + +          R+T
Sbjct  606  FSPDGMSIAVTSDLAAVSVDPISLPLFLHSVRPYGDLFVVDIDPSDINKNKDVKKFNRIT  665

Query  461  WNGYENGTPAW  493
             + YEN TP W
Sbjct  666  HSRYENSTPTW  676



>ref|XP_008662981.1| PREDICTED: uncharacterized protein LOC103641407 [Zea mays]
 gb|AFW57694.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=730

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 98/191 (51%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG   VFRS R G    HKNLYI ++   GE   G + +LT+G W DT   WSP G  I
Sbjct  496  PDGNRFVFRSTRDGGDKKHKNLYIAENAEVGEYGDGTVTRLTNGEWTDTHCQWSPSGDWI  555

Query  167  AFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVC  316
             FSS R  P +A           F++++V+  D T + R+  +G +    V     NH  
Sbjct  556  VFSSTRDKPKDAPELDNGLDPGYFAVFMVKASDPTVVIRVIRSGDDLGGHV-----NHPV  610

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLT  460
            FS D   ++ T++L  V+A+P+S+P   +  +PYGD++++ +D              R+T
Sbjct  611  FSPDGRSIVVTSDLAAVSADPISLPLFIHSVRPYGDIFVVDIDPEDASKNKDVKKFHRVT  670

Query  461  WNGYENGTPAW  493
             + YE  TP W
Sbjct  671  HSRYEYSTPTW  681



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK +VFRSGR+GHKNLYI+D +NGE D G I QLTDG+WIDTMPSWSP+  LIAF  N
Sbjct  449  PDGKWLVFRSGRTGHKNLYIVDVVNGEFDSG-ICQLTDGSWIDTMPSWSPNDNLIAFFLN  507

Query  182  RHNP--GNADCFSIYVVR  229
             HNP  G  D    Y++R
Sbjct  508  WHNPHVGRYDADLEYILR  525



>ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38223.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 101/191 (53%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   WSP G  I
Sbjct  491  PDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKITRLTNGPWTDTHCQWSPRGDWI  550

Query  167  AFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVC  316
             FSS R  P +A           F++++V+  D + + R+  +G + +  V     NH  
Sbjct  551  VFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-----NHPF  605

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------QRLT  460
            FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   +          R+T
Sbjct  606  FSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKDVKKFNRIT  665

Query  461  WNGYENGTPAW  493
             + YEN TP W
Sbjct  666  HSRYENSTPTW  676



>gb|EAY90391.1| hypothetical protein OsI_11968 [Oryza sativa Indica Group]
Length=744

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 97/195 (50%), Gaps = 36/195 (18%)
 Frame = +2

Query  2    PDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPD--  154
            PDG  +VFRS R        HKNLY++ D+  GE   G + +LT GAW DT  SWSP   
Sbjct  503  PDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTGKVTRLTSGAWTDTHCSWSPREG  562

Query  155  GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERL  304
               I FSS R  P  A           F++++VR  D T + R+  +    +  V     
Sbjct  563  SDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVAGHV-----  617

Query  305  NHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGL  448
            NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D             
Sbjct  618  NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDISKNRDVRAF  677

Query  449  QRLTWNGYENGTPAW  493
             R+T + YEN TPAW
Sbjct  678  HRVTHSRYENSTPAW  692



>ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38217.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 100/191 (52%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG  +VFRS R G    +KNLYI+ D+  GE   G + +LT+G W DT   WSP G  I
Sbjct  491  PDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKVTRLTNGPWTDTHCQWSPRGDWI  550

Query  167  AFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVC  316
             FSS R  P +A           F++++V+  D + + R+   G + +  V     NH  
Sbjct  551  VFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKGGDDLAGHV-----NHPF  605

Query  317  FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------QRLT  460
            FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   +          R+T
Sbjct  606  FSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKDVKKFNRIT  665

Query  461  WNGYENGTPAW  493
             + YEN TP W
Sbjct  666  HSRYENSTPTW  676



>ref|XP_010097765.1| hypothetical protein L484_023906 [Morus notabilis]
 gb|EXB70720.1| hypothetical protein L484_023906 [Morus notabilis]
Length=744

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  169
            PDGK +VFRS R+G    +KNLYI D+  GE   G + +LT+G W DT   WSP+   I 
Sbjct  510  PDGKKLVFRSTRNGGDKKYKNLYITDAEAGEYGNGFLTRLTEGDWTDTHCQWSPNSDWIV  569

Query  170  FSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  322
            FSS R  P +A           F++++V  +    +   V    GS       LNH  FS
Sbjct  570  FSSTRDKPKDAPPLDNGLDPGFFAVFLVNVN----KPSVVVRVVGSGNRLAGHLNHPFFS  625

Query  323  SDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ---------RLTWN  466
             D   ++ T +L  V++EP+S+P   +  +PYGD++ + +D   ++         R+T +
Sbjct  626  PDGNSIVVTGDLAAVSSEPISLPLFLHSVRPYGDIFTVDIDPKNIEKNEDVEKFKRITHS  685

Query  467  GYENGTPAW  493
             YE  T +W
Sbjct  686  RYEYSTASW  694



>gb|EMT14934.1| hypothetical protein F775_30553 [Aegilops tauschii]
Length=723

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 95/190 (50%), Gaps = 33/190 (17%)
 Frame = +2

Query  8    GKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  169
            G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  SWSP G  + 
Sbjct  488  GDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHCSWSPKGDWVV  547

Query  170  FSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  322
            FSS R  P         +A  F++Y+V+  D T + R+  + A  +  V     NH  FS
Sbjct  548  FSSTREMPASAPEMAFLDAGYFAVYLVKVSDPTVVVRVVQSSATLAGHV-----NHPIFS  602

Query  323  SDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG----------LQRLTW  463
             D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T             R+T 
Sbjct  603  PDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNKDIQEFHRITH  662

Query  464  NGYENGTPAW  493
            + YE  TP W
Sbjct  663  SRYEYSTPTW  672



>gb|EAZ27259.1| hypothetical protein OsJ_11196 [Oryza sativa Japonica Group]
Length=744

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 96/195 (49%), Gaps = 36/195 (18%)
 Frame = +2

Query  2    PDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPD--  154
            PDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT  SWSP   
Sbjct  503  PDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTHCSWSPREG  562

Query  155  GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERL  304
               I FSS R  P  A           F++++VR  D T + R+  +    +  V     
Sbjct  563  SDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVAGHV-----  617

Query  305  NHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGL  448
            NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D             
Sbjct  618  NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDISKNRDVRAF  677

Query  449  QRLTWNGYENGTPAW  493
             R+T + YEN TPAW
Sbjct  678  HRVTHSRYENSTPAW  692



>ref|XP_010676033.1| PREDICTED: uncharacterized protein LOC104891943 [Beta vulgaris 
subsp. vulgaris]
Length=751

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 103/199 (52%), Gaps = 34/199 (17%)
 Frame = +2

Query  5    DGKHIVFRSGRSGH------KNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPDGKL  163
            +G  +VFRS R  H      KNLYI+ S + GE   G IR+LT G  IDT   WSP    
Sbjct  494  EGTQLVFRSTRDHHENGGIFKNLYIMKSADEGEFGRGEIRRLTTGNCIDTHCKWSPRNDW  553

Query  164  IAFSSNRHNPGNA-DC--------FSIYVVRPDGTG-LRRIHVAGAEGSEEVNRERLNHV  313
            I FSSNR  P +A  C        FS+Y+V+ D    L R+  +G++ +  V     NH 
Sbjct  554  IVFSSNRDMPEDARKCDEDLDSGYFSVYLVKADNPDVLVRVMYSGSDLAGHV-----NHP  608

Query  314  CFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------QRL  457
             FS D + ++ T+++  V+A+P+S+P   +  +PYGD++ + +D   +          R+
Sbjct  609  FFSPDGKSIVVTSDVAAVSADPMSLPLFLHSARPYGDIFTIDIDSDDINKNEDLKMFNRI  668

Query  458  TWNGYENGTPAWHPKAEVD  514
            T + YEN T  W   +  D
Sbjct  669  THSRYENATGTWTKSSTRD  687



>ref|NP_001050324.1| Os03g0403400 [Oryza sativa Japonica Group]
 gb|AAP03369.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96486.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12238.1| Os03g0403400 [Oryza sativa Japonica Group]
Length=744

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 96/195 (49%), Gaps = 36/195 (18%)
 Frame = +2

Query  2    PDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPD--  154
            PDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT  SWSP   
Sbjct  503  PDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTHCSWSPREG  562

Query  155  GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERL  304
               I FSS R  P  A           F++++VR  D T + R+  +    +  V     
Sbjct  563  SDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVAGHV-----  617

Query  305  NHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGL  448
            NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D             
Sbjct  618  NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDISKNRDVRAF  677

Query  449  QRLTWNGYENGTPAW  493
             R+T + YEN TPAW
Sbjct  678  HRVTHSRYENSTPAW  692



>gb|EMT19136.1| hypothetical protein F775_12749 [Aegilops tauschii]
Length=669

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 97/205 (47%), Gaps = 44/205 (21%)
 Frame = +2

Query  2    PDGKHIVFRS-------GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGK  160
            P+G  +VFRS       G+   KNL+IID+  GE    G+ QLT+G W DT  SWSP   
Sbjct  425  PEGTKLVFRSSRDRVQGGKREDKNLFIIDAEKGEY--AGVDQLTNGPWTDTHCSWSPREG  482

Query  161  L--IAFSSNRHNPGNADC---------FSIYVVRPDGTG-----LRRIHVAGAEGSEEVN  292
               I FSS+R  PG A           FS+Y+V           +R IH A         
Sbjct  483  CDWIVFSSSRGKPGGAPASDHGLDSGYFSVYLVNAKDMAEGVVPVRVIHSAPTIAGH---  539

Query  293  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL----------  433
               +NH  FS D   ++FTA+L  V+ +P+S+P   +  +PYGD++ + L          
Sbjct  540  ---VNHPVFSPDMMSIVFTADLAAVSVDPISMPHFMHSVRPYGDIFSVELLDREDMAKNK  596

Query  434  DGTGLQRLTWNGYENGTPAWHPKAE  508
            D     R+T + YE  TP W P  +
Sbjct  597  DIHKYHRITHSRYEYSTPTWSPHTD  621



>ref|XP_002437598.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
 gb|EER88965.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
Length=769

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 93/199 (47%), Gaps = 37/199 (19%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG---------HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSP  151
            P G  IVFRS +            KNLYI+ D++ GE    G+ +LTDG W DT   WSP
Sbjct  520  PAGTKIVFRSTKDAPPPPPGGFRQKNLYIMEDAMEGE--SAGVTRLTDGDWTDTHCQWSP  577

Query  152  DGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG-TGLRRIHVAGAEGSEEVNRER  301
             G  I FSS+RH P  A           F +Y+V P     + R+  +        N   
Sbjct  578  SGDWIVFSSSRHKPDGAPKTDNFLDPGYFGVYLVNPASPKAVVRVMTSALPPPVPTNVAG  637

Query  302  L---NHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  448
            L   NH  FS D   ++ TA+L  V+ EP+S+P   +  +PYGD++   +D   +     
Sbjct  638  LGHVNHPMFSPDGRSIVVTADLAAVSVEPISMPMFLHSVRPYGDIFSFDIDPVDMDKNKD  697

Query  449  ----QRLTWNGYENGTPAW  493
                 R+T + YE  TP W
Sbjct  698  IQKFHRVTHSRYEYATPVW  716



>gb|EMS49561.1| hypothetical protein TRIUR3_11240 [Triticum urartu]
Length=568

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 95/190 (50%), Gaps = 33/190 (17%)
 Frame = +2

Query  8    GKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  169
            G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  SWSP G  + 
Sbjct  333  GDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHCSWSPKGDWVV  392

Query  170  FSSNRHNPGNAD--------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  322
            FSS R  P +A          F++Y+V+  + T + R+  + A  +  V     NH  FS
Sbjct  393  FSSTREMPASAPEMAFLDAGYFAVYLVKVSNPTVVVRVVQSSATLAGHV-----NHPIFS  447

Query  323  SDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG----------LQRLTW  463
             D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T             R+T 
Sbjct  448  PDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNKDIQEFHRITH  507

Query  464  NGYENGTPAW  493
            + YE  TP W
Sbjct  508  SRYEYSTPTW  517



>ref|WP_041858684.1| hypothetical protein [Candidatus Solibacter usitatus]
Length=611

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 88/170 (52%), Gaps = 26/170 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWIDTMPSWSPDGKLIAFS  175
            PDGK  V+R+       L I   +N E   G I  RQ       D  P WSP G LI FS
Sbjct  459  PDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------DNFPLWSPRGDLITFS  509

Query  176  SNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTAN  355
                       + IY ++PDG+ L+R+       +         H+ +S D E+++FT++
Sbjct  510  RQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------HMAWSPDGEYIVFTSS  555

Query  356  LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  505
              G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPAW P A
Sbjct  556  RMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPAWQPMA  604


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 51/97 (53%), Gaps = 14/97 (14%)
 Frame = +2

Query  5    DGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            D K + F S R G   NL+ +D + G       R LT G   D  PSWSPDGK IAFSS 
Sbjct  110  DSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGDFRPSWSPDGKWIAFSSG  164

Query  182  RHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  268
            R NP               IYV+RPDG+GL++I  +G
Sbjct  165  RDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  201


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 80/164 (49%), Gaps = 19/164 (12%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +AF S 
Sbjct  65   PDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLAFVST  119

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   G A+ +++ +V    TG  R   +G  G             +S D +W+ F++   
Sbjct  120  RGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFSSGRD  166

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
                       + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  167  NPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  209



>gb|ABJ88479.1| WD40 domain protein beta Propeller [Candidatus Solibacter usitatus 
Ellin6076]
Length=638

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 88/170 (52%), Gaps = 26/170 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWIDTMPSWSPDGKLIAFS  175
            PDGK  V+R+       L I   +N E   G I  RQ       D  P WSP G LI FS
Sbjct  486  PDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------DNFPLWSPRGDLITFS  536

Query  176  SNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTAN  355
                       + IY ++PDG+ L+R+       +         H+ +S D E+++FT++
Sbjct  537  RQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------HMAWSPDGEYIVFTSS  582

Query  356  LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  505
              G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPAW P A
Sbjct  583  RMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPAWQPMA  631


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 51/97 (53%), Gaps = 14/97 (14%)
 Frame = +2

Query  5    DGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            D K + F S R G   NL+ +D + G       R LT G   D  PSWSPDGK IAFSS 
Sbjct  137  DSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGDFRPSWSPDGKWIAFSSG  191

Query  182  RHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  268
            R NP               IYV+RPDG+GL++I  +G
Sbjct  192  RDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  228


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 80/164 (49%), Gaps = 19/164 (12%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +AF S 
Sbjct  92   PDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLAFVST  146

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   G A+ +++ +V    TG  R   +G  G             +S D +W+ F++   
Sbjct  147  RGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFSSGRD  193

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
                       + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  194  NPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  236



>ref|XP_010675830.1| PREDICTED: uncharacterized protein LOC104891773 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 99/194 (51%), Gaps = 22/194 (11%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDG  +V+RS + G KNLYI+++   GE +   + +LT G W DT   WSP    I FSS
Sbjct  666  PDGTRLVYRSTKHGPKNLYIMENAELGEFEEAKVTRLTKGNWTDTHCQWSPTQDWIVFSS  725

Query  179  NRHNPG--------NADCFSIYVVRPDGTGLR-RIHVAGAEGSEEVNRERLNHVCFSSDS  331
            NR  P         +A  F +Y+V  +   +  ++  +G      +    +NH  FS D 
Sbjct  726  NRSYPTAKTFEDLPDAGYFGVYLVNANNEDVVIKVIDSGYTYLGGLFPGHVNHPFFSPDG  785

Query  332  EWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLTWNGYE  475
            + ++ TA+L  V+ +PVS+P   +  +PYGD++++ +DG             R+T + YE
Sbjct  786  KSLVVTADLAAVSCDPVSMPLFLHSVRPYGDIFVVDIDGDDIYKNENLKKFTRVTHSRYE  845

Query  476  NGTPAWHPKAEVDL  517
            N T  W   +  DL
Sbjct  846  NSTGTWTEASTKDL  859



>ref|XP_004980674.1| PREDICTED: uncharacterized protein LOC101756594 [Setaria italica]
Length=1083

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 98/194 (51%), Gaps = 30/194 (15%)
 Frame = +2

Query  2     PDGKHIVFRSGRS----GHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
             P+G  +VF+S R      +KNLYI+ D+  GE   G + +LT+G WIDT   WSP G  I
Sbjct  871   PEGTKVVFQSTRDHGDYEYKNLYIMEDAQIGEFGEGSVTRLTNGPWIDTQCQWSPRGNWI  930

Query  167   AFSSNRHNPGNAD---------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVNRE-RLNHV  313
              FSS R  P  A           F+IY+V   D T + R+  +G  G    +    +NH 
Sbjct  931   VFSSTRDKPAAAPENYNELDPGHFAIYLVNAADPTVVVRVVTSGDPGPGASSIAGHVNHP  990

Query  314   CFSSDSEWVLFTANLGGVTAEPVSIP-----NQFQPYGDLYMMRLDGTGL---------Q  451
              FS D   + FT+++  V+AEP+S+P        +PYGD++ + +D   +          
Sbjct  991   VFSPDGRSIAFTSDIAAVSAEPISMPMASVMASVRPYGDIFSVDIDPDDICRNKDIDRVH  1050

Query  452   RLTWNGYENGTPAW  493
             R+T + YE  T AW
Sbjct  1051  RVTHSRYEYSTNAW  1064



>ref|XP_010675837.1| PREDICTED: uncharacterized protein LOC104891780 [Beta vulgaris 
subsp. vulgaris]
Length=722

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 100/189 (53%), Gaps = 29/189 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQLTDGAWIDTMPSWSPDGKLI  166
            PDG  +VFRS R G    +KNLYII+ L    +G G I +LT+G W+DT   WSP G+ I
Sbjct  489  PDGTKLVFRSTRDGGEKKYKNLYIIEDLQSMENGEGEITRLTNGPWVDTHCDWSPSGEWI  548

Query  167  AFSSNRHNPG-------NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  325
             F+SNR+          +   F++Y+V+ D   +  + V G+   +      +NH  FS 
Sbjct  549  VFASNRNRTTEGMDHGLDTGYFAVYLVKADDPDV-WVKVIGSRSGDLAG--HVNHPFFSP  605

Query  326  DSEWVLFTANLGGVTAEPVSIPNQF----QPYGDLYMMRLDGTGL---------QRLTWN  466
            D   +   ++L  V+ +P+S+P QF    +PYG+L+++ +D   +         +R+T  
Sbjct  606  DGRSLSVVSDLAAVSCDPISLP-QFIHSARPYGELFILDIDHDDIYANEDVEDYRRITHT  664

Query  467  GYENGTPAW  493
             YEN T  W
Sbjct  665  RYENSTAVW  673



>dbj|BAK07068.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 95/191 (50%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG   VFRS R G    HKNLYI+ D+  GE   G +R+LT+G W DT  SWSP    I
Sbjct  518  PDGTKFVFRSTRDGGAELHKNLYIMEDAEVGEFSEGTVRRLTNGPWTDTHCSWSPKNDWI  577

Query  167  AFSSNRHNPGNAD--------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVCF  319
             FSS+R     A          F++++V   D T + R+     + S+ V    + H  F
Sbjct  578  VFSSSRDKAAGAPKRDILDPGSFAVFMVMASDPTVVVRV----MKSSDSVA-GHVTHPMF  632

Query  320  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG----------LQRLT  460
            S D   ++  A+L  V+ EP+S+P   +  +PYGD++ + L  T             R+T
Sbjct  633  SPDMRSIVVAADLAAVSTEPISMPQFLHSVRPYGDIFSVDLRDTDDMSKNKDIKEFHRIT  692

Query  461  WNGYENGTPAW  493
             + YE  TP W
Sbjct  693  HSRYEYATPEW  703



>ref|XP_010087211.1| hypothetical protein L484_006140 [Morus notabilis]
 gb|EXB28518.1| hypothetical protein L484_006140 [Morus notabilis]
Length=726

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 103/188 (55%), Gaps = 30/188 (16%)
 Frame = +2

Query  5    DGKHIVFRSGR--SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  175
            +G  +V+RS R    +KNLYI+ D+  GE   G I +LT+G+W DT   WSP G  I FS
Sbjct  496  EGTKLVYRSTRGDKRYKNLYIMEDAQVGEYGHGKITRLTNGSWTDTHCQWSPTGDWIVFS  555

Query  176  SNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  325
            S R  P +A           F+IY+V+  D + + R+  +G++ +  V     NH  FS 
Sbjct  556  STRDKPEDAPKSDNGLDPGYFAIYLVKVNDPSVVVRVTGSGSDLTGHV-----NHPFFSP  610

Query  326  DSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------QRLTWNG  469
            D + ++ T++L GV+ +P+S+P   +  +PYGD++ + +D   +          R+T + 
Sbjct  611  DRKSIVVTSDLAGVSVDPISLPLFLHSVRPYGDIFTIDIDPDDINKNWDVKEFNRITHSR  670

Query  470  YENGTPAW  493
            YEN T +W
Sbjct  671  YENATGSW  678



>ref|XP_010105408.1| hypothetical protein L484_008562 [Morus notabilis]
 gb|EXC04631.1| hypothetical protein L484_008562 [Morus notabilis]
Length=424

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 103/197 (52%), Gaps = 30/197 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT   WSP G  I
Sbjct  191  PAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTHCQWSPRGDWI  250

Query  167  AFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  319
             FSS R  P +A           F++++V+ +   +    V    GS+      +NH  F
Sbjct  251  VFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSDLAGHVNHPFF  306

Query  320  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------DGTGLQRLTW  463
            S D + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         D     R+T 
Sbjct  307  SPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNKDVEKFNRITH  366

Query  464  NGYENGTPAWHPKAEVD  514
            + YEN T +W P +  D
Sbjct  367  SRYENSTASWTPFSTQD  383



>ref|XP_010097467.1| hypothetical protein L484_024672 [Morus notabilis]
 gb|EXB68658.1| hypothetical protein L484_024672 [Morus notabilis]
Length=743

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 103/194 (53%), Gaps = 38/194 (20%)
 Frame = +2

Query  5    DGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  172
            +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G W DT   WSP+G  I F
Sbjct  505  EGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEGKWTDTHCQWSPNGDWIVF  562

Query  173  SSNRHNPGNAD--------------CFSIYVVRPDG-TGLRRIHVAGAEGSEEVNRERLN  307
            SS+R NP  AD               F++Y+V     + + R+  +G + +  V     N
Sbjct  563  SSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVRVAGSGYDLAGHV-----N  617

Query  308  HVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------Q  451
            H  FS D + ++ T++L  V+ +P+S+P   +  +PYGD+++  +D   +         +
Sbjct  618  HPFFSPDGKSIVVTSDLAAVSVDPISLPLFVHSVRPYGDIFIFDIDTKDIHKNKDLKTFK  677

Query  452  RLTWNGYENGTPAW  493
            R T + +E  T +W
Sbjct  678  RATHSRFEYSTVSW  691



>gb|EMT29283.1| hypothetical protein F775_17496 [Aegilops tauschii]
Length=869

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 89/171 (52%), Gaps = 25/171 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYI-IDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDG   VFRS R G    +KNL+I +++ NG+   G   +LT G W DT   WSP G  +
Sbjct  532  PDGSKFVFRSTRDGGVKKYKNLHIMLEAENGQSGIGWETRLTKGPWTDTHCQWSPTGDWV  591

Query  167  AFSSNRHNPGNAD---------CFSIYVVRPDG--TGLRRIHVAGAEGSEEVNRERLNHV  313
             FSS R  P +AD          FS+Y+V+P      +R +   G  G        +NH 
Sbjct  592  VFSSTRGKPRDADELDNGLDPGYFSVYLVKPSDPMVVIRVMDSMGDLGGH------INHP  645

Query  314  CFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQRL  457
             FS D   +  TA+L  V+ +P+S+P   +  +PYGD++M+ LD   L+ +
Sbjct  646  VFSPDGRSIAVTADLAAVSVDPISLPMFMHAVRPYGDIFMIDLDTDNLKNI  696



>gb|AEW08691.1| hypothetical protein CL1213Contig1_01, partial [Pinus lambertiana]
Length=97

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGRSGHKNLYI+D+  GE   GGIR LT+G WIDTMPSWSPDG+ I
Sbjct  45   PDGKQLVFRSGRSGHKNLYIMDAEQGE--EGGIRALTEGPWIDTMPSWSPDGEWI  97



>ref|XP_003575792.1| PREDICTED: uncharacterized protein LOC100821131 [Brachypodium 
distachyon]
Length=730

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 98/196 (50%), Gaps = 42/196 (21%)
 Frame = +2

Query  5    DGKHIVFRSG--RSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKL  163
            +G  +VFRS   RSG     KNLYI+ D+  G+   G + QLT G W DT   WSP    
Sbjct  511  EGDKLVFRSSCDRSGGDNKFKNLYIMEDATEGDSSAGKVTQLTKGDWTDTHCCWSPTDDW  570

Query  164  IAFSSNRHN--PG------NADCFSIYVV--RPDGTGLRRIHVAGAEGSEEVNRERLNHV  313
            I FSS+R    PG      +A CFSI++V  +     +R +H          +     HV
Sbjct  571  IVFSSSRDRAPPGTDPAILDAGCFSIFMVNYKDPSVVVRVMH---------SDMSLAGHV  621

Query  314  C---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL----------DGTG  445
            C   FS D + ++ T+++  V+A+P S+P   +  +PYGD++ ++L          D   
Sbjct  622  CHPVFSPDRKSIVVTSDVAAVSADPASLPIFIHSVRPYGDIFTIKLRDPDCLEKNGDIVE  681

Query  446  LQRLTWNGYENGTPAW  493
              R+T + YEN TP W
Sbjct  682  FDRITHSRYENSTPTW  697



>ref|XP_010097483.1| hypothetical protein L484_024689 [Morus notabilis]
 gb|EXB68674.1| hypothetical protein L484_024689 [Morus notabilis]
Length=740

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 101/193 (52%), Gaps = 37/193 (19%)
 Frame = +2

Query  5    DGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  172
            +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G W DT   WSP+G  I F
Sbjct  504  EGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEGKWTDTHCQWSPNGDWIVF  561

Query  173  SSNRHNPGNAD--------------CFSIYVVRPDG-TGLRRIHVAGAEGSEEVNRERLN  307
            SS+R NP  AD               F++Y+V     + + R+  +G + +  V     N
Sbjct  562  SSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVRVAGSGYDLAGHV-----N  616

Query  308  HVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL--------QR  454
            H  FS D + ++ T++L  V+ +P S+P   +  +PYGD+++   D   +        +R
Sbjct  617  HPFFSPDGKSIVVTSDLAAVSVDPTSLPLFVHSVRPYGDVFIFDFDCNDMNQEDLKTFKR  676

Query  455  LTWNGYENGTPAW  493
             T + +E  T +W
Sbjct  677  ATHSRFEYSTVSW  689



>ref|XP_010235117.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium 
distachyon]
Length=751

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 93/202 (46%), Gaps = 42/202 (21%)
 Frame = +2

Query  2    PDGKHIVFRSGRS------GHKNLYII-DSLNGEL-DGGGIRQLTDGAWIDTMPSWSPDG  157
            PDG   VFRS R        HKNLYI+ D   GE  +GG + +LTDG W DT   WSP G
Sbjct  504  PDGTRFVFRSTRDHAKSERKHKNLYIMEDQEVGEYGEGGKVTRLTDGEWTDTHCQWSPSG  563

Query  158  KLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  310
              I FSS R  P  A           F++++V+     +    V    GS +     +NH
Sbjct  564  DWIVFSSTRDKPPTAAPLDHGLDPGYFAVFMVKASDPAV----VIRVVGSGDDLSGHVNH  619

Query  311  VCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGT-------------  442
              FS +   +  T++L  V+A+P+S+P   +  +PYGD++ + +D               
Sbjct  620  PVFSPNGRSIAVTSDLAAVSADPISLPLFLHSVRPYGDIFAVDIDDILRLGDDAEKLKKI  679

Query  443  -----GLQRLTWNGYENGTPAW  493
                    R+T + YE  TP W
Sbjct  680  KDLRRKFHRITHSRYEYSTPEW  701



>ref|WP_035092853.1| hypothetical protein [Caulobacter henricii]
Length=625

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 84/165 (51%), Gaps = 21/165 (13%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DGK IVFR      K L +I+     LD   IR LT G   D +P WSPDGK I F+   
Sbjct  480  DGKEIVFRVWGEAEKGLRVIN-----LDTRQIRVLTTG--YDNLPFWSPDGKRIVFTRKV  532

Query  185  HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGG  364
                +A  F IY +RPDG+ L+R+           NR    H  +S+D + +LF+  + G
Sbjct  533  ----DAVNFDIYTIRPDGSDLQRL---------TTNRGNDGHAVWSADGK-ILFSTGMYG  578

Query  365  VTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
               E     N FQPYG + +M  DGTG + +T + +E+  P + P
Sbjct  579  FREEAALYDNTFQPYGQIMVMSADGTGKRLVTDSLWEDSMPLYLP  623


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 55/103 (53%), Gaps = 21/103 (20%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHK-NLYIIDSLNGELD----GGGIR---QLTDGAWIDTMPSWSPDG  157
            PDG  + F S R G++ N+++ D   G L     G G++    L DG +    P+WSPDG
Sbjct  124  PDGARLAFVSTRDGYRTNIWLKDLKTGRLTNLTGGEGVQGDPSLPDGFF---RPAWSPDG  180

Query  158  KLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  256
            K +AFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  181  KWLAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  223



>ref|XP_010102640.1| hypothetical protein L484_010932 [Morus notabilis]
 gb|EXB93790.1| hypothetical protein L484_010932 [Morus notabilis]
Length=717

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 100/190 (53%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    PDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT   WSP G  I
Sbjct  484  PAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTHCQWSPRGDWI  543

Query  167  AFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  319
             FSS R  P +A           F++++V+ +   +    V    GS+      +NH  F
Sbjct  544  VFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSDLAGHVNHPFF  599

Query  320  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------DGTGLQRLTW  463
            S D + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         D     R+T 
Sbjct  600  SPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNKDVEKFNRITH  659

Query  464  NGYENGTPAW  493
            + YEN T +W
Sbjct  660  SRYENSTASW  669



>ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium 
distachyon]
Length=752

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 94/206 (46%), Gaps = 47/206 (23%)
 Frame = +2

Query  2    PDGKHIVFRSGR------SGHKNLYII-DSLNGELDGG----GIRQLTDGAWIDTMPSWS  148
            PDG   VFRS R        HKNLYI+ D   GE         + +LTDG W DT   WS
Sbjct  502  PDGTRFVFRSTRDHAKSEKKHKNLYIMEDQEFGEYGYDTVVPKVTRLTDGEWTDTHCQWS  561

Query  149  PDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRE  298
            P G  I FSS R  P  A           F++++V+  D T + R+  +G + S  V   
Sbjct  562  PSGDWIVFSSTRDKPATAAPTDHGLDPGYFAVFMVKASDPTVVIRVVGSGDDLSGHV---  618

Query  299  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD-----------  436
              NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D           
Sbjct  619  --NHPVFSPDGRTIAVTADLAAVSADPISLPLFLHSVRPYGDIFAVDIDDILRLGDDVEK  676

Query  437  -------GTGLQRLTWNGYENGTPAW  493
                        R+T + YE  TP W
Sbjct  677  LKKIKDLKKKFHRITHSRYEYSTPEW  702



>gb|AEW08692.1| hypothetical protein CL1213Contig1_01, partial [Pinus radiata]
 gb|AFB33859.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFB33860.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFG48604.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGRSGHKNLYI+D+  GE   GGI  LT+G WIDTMPSWSPDG+ I
Sbjct  45   PDGKQLVFRSGRSGHKNLYIMDAEKGE--EGGIHALTEGPWIDTMPSWSPDGEWI  97



>gb|AFG48602.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48603.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48605.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGRSGHKNLYI+D+  GE   GGI  LT+G WIDTMPSWSPDG+ I
Sbjct  45   PDGKQLVFRSGRSGHKNLYIMDAEEGE--EGGIHALTEGPWIDTMPSWSPDGEWI  97



>gb|EJL34752.1| periplasmic component of the Tol biopolymer transport system 
[Caulobacter sp. AP07]
Length=602

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 85/166 (51%), Gaps = 22/166 (13%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            DG+HIV+R  ++G  N L ++D     LD G    L  G      P+WSP   +IAF+++
Sbjct  450  DGRHIVYR--QAGAANALDVVD-----LDSGESHVLLAGPAHYNFPAWSPTADVIAFTAD  502

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
                     + IY +R DG+GL+R+  +    +         H  +S D +W+ F +  G
Sbjct  503  IDG-----DYEIYSIRADGSGLKRLTRSPGNDA---------HNAWSPDGKWIAFASARG  548

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            G   E +  P   QPYG++Y+MR DG+    LT   +E GTPAW P
Sbjct  549  GFKDEALLHPANPQPYGEIYVMRADGSEAHALTDEPFEKGTPAWAP  594


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 14/94 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG+ + F S R G  +++I+D     L    +R LT     D  PSWSPDG+ +AFSS+
Sbjct  116  PDGRSLAFVSSRGGQADIWILD-----LASKALRNLTHDPAGDFRPSWSPDGRWLAFSSD  170

Query  182  R--HNPGNAD-------CFSIYVVRPDGTGLRRI  256
            R   +P   +          IY+V+ DGT LRR+
Sbjct  171  RVSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRV  204


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 80/168 (48%), Gaps = 25/168 (15%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DG+ ++F S R+G  ++Y        LDG G+ +L      D   + SPDG+ +AF S+R
Sbjct  73   DGQWVLFTSRRAGTSDIY-----RAHLDGSGLERLVASPAYDDQAALSPDGRSLAFVSSR  127

Query  185  HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGG  364
               G AD   I+++      LR +    A               +S D  W+ F+++   
Sbjct  128  G--GQAD---IWILDLASKALRNLTHDPAGDFRP---------SWSPDGRWLAFSSDR--  171

Query  365  VTAEPVSIPN---QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
              +E   IP      +   ++Y++++DGT L+R+T +G   G+P W P
Sbjct  172  -VSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDGQFAGSPTWSP  218



>gb|EMT06488.1| hypothetical protein F775_06751 [Aegilops tauschii]
Length=739

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 98/198 (49%), Gaps = 44/198 (22%)
 Frame = +2

Query  5    DGKHIVFRSGRS--------GHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  157
            DG  +VFRS R+         +KNLYI+ D+  GE   G + QLTDG W D+  +WSP  
Sbjct  524  DGTKLVFRSTRNRMGKPEDVKYKNLYIMEDADEGEWGSGTVTQLTDGPWTDSHCTWSPTD  583

Query  158  KLIAFSSNRHN-PGNAD-------CFSIY-VVRPDGTGLRRI-HVAGAEGSEEVNRERLN  307
              I FSS+R   PG  D        FSI+ V+  D + L R+ H A +            
Sbjct  584  DWIVFSSSRDRAPGAPDRDILDAGFFSIFLVLATDPSVLVRVMHSADSLA---------G  634

Query  308  HVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL----------DG  439
            HVC   FS   + ++ T+++ GV+A+PVS+P   +  +PYGD++ + L          D 
Sbjct  635  HVCHPVFSPFKDSIVVTSDIAGVSADPVSLPIFIHSVRPYGDIFTINLRDKNDIMKNKDI  694

Query  440  TGLQRLTWNGYENGTPAW  493
                R+T   YE  TP W
Sbjct  695  MEFDRITHTRYEYSTPTW  712



>gb|AFG48601.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGRSGHKNLYI+D+  GE    GI  LT+G WIDTMPSWSPDG+ I
Sbjct  45   PDGKQLVFRSGRSGHKNLYIMDAEKGE--ESGIHALTEGPWIDTMPSWSPDGEWI  97



>emb|CDM86908.1| unnamed protein product [Triticum aestivum]
Length=731

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 93/191 (49%), Gaps = 38/191 (20%)
 Frame = +2

Query  2    PDGKHIVFRSGR--------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPD  154
            P G   VFRS R        + + NLYI+ D+  GE   G + QLTDG W D+  SWSP 
Sbjct  502  PAGTKFVFRSTRNRSGRPEDAKYNNLYIMEDAEEGEWGEGTVTQLTDGPWTDSHCSWSPR  561

Query  155  GKLIAFSSNRHNP--GNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC---F  319
            G  I FSS+R      +A CFSI++V      +  + V    G          HVC   F
Sbjct  562  GDWIVFSSSRDRDILDSAGCFSIFLVLATDRKV-LVRVMSLPG----------HVCHPIF  610

Query  320  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG----------LQRLT  460
            S D + ++ T+++  V+A+PVS+P      +PYGD++ ++L  T             R+T
Sbjct  611  SPDMDNLVVTSDVAVVSADPVSLPIFIASGRPYGDMFSIKLRDTTDINKNKDIMEFHRIT  670

Query  461  WNGYENGTPAW  493
               YE   P+W
Sbjct  671  HTRYEYSKPSW  681



>ref|WP_020604165.1| hypothetical protein [Spirosoma spitsbergense]
Length=612

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 91/168 (54%), Gaps = 20/168 (12%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG+ IV+R        L I++ LN +L    ++ LT     D +P WSPDG LI+F+  
Sbjct  462  PDGQRIVYRVWGEKDSGLRILN-LNDKL----VQVLTTE--YDNLPFWSPDGSLISFT-R  513

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            +H+  N   F I+ +RPDGT LR++    A  +         H  +++DS+ +++++ + 
Sbjct  514  KHDDNN---FDIFTIRPDGTNLRQLTTTPANDA---------HAYWTADSKHLMWSSGIY  561

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  505
            G   E     N FQPYG ++ M  DG+  ++LT + +E+  P   PKA
Sbjct  562  GFKDEAALYDNTFQPYGAIFSMNADGSDKRQLTDSAWEDSMPVVVPKA  609


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 53/109 (49%), Gaps = 25/109 (23%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLTDGAWID---------TMPSWSP  151
            PDG  + F S R  H  N++++D     +    + +LT    I            PSWSP
Sbjct  120  PDGSKVTFVSTREMHTANIWLLD-----IKSKKVTKLTALPAIQGDSTKPNGFFRPSWSP  174

Query  152  DGKLIAFSSNRHNP----GN------ADCFSIYVVRPDGTGLRRIHVAG  268
            DGK IAF+S+R+      GN           IYVV PDGTGLR++  AG
Sbjct  175  DGKWIAFASDRNTQWLGHGNGAGWEHVQELGIYVVHPDGTGLRKLSQAG  223



>gb|AFK45973.1| unknown [Medicago truncatula]
Length=97

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +2

Query  338  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  517
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +  
Sbjct  1    MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  59

Query  518  ARLSLGKSGEKLRGKFDEPLWINS  589
              + + K G      F++  W+N+
Sbjct  60   VNVEMPKGGPYC--SFEDCHWLNN  81



>ref|WP_029915040.1| hypothetical protein [Caulobacter sp. UNC358MFTsu5.1]
Length=618

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 84/165 (51%), Gaps = 21/165 (13%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DGK IVFR     +  L +I+     LD   +R LT G  +D +P WSPDGK I F+   
Sbjct  473  DGKEIVFRVWGENNMGLRVIN-----LDTREVRTLTTG--LDNLPFWSPDGKRIVFTRKV  525

Query  185  HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGG  364
                +A  F ++ +RPDG+ L+R+           NR    H  +++D   +L++  + G
Sbjct  526  ----DAVNFDVFTIRPDGSDLQRL---------TTNRGNDGHAVWTADGR-ILWSTGMYG  571

Query  365  VTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
               E     N FQPYG + +M  DGTG + LT + +E+  P + P
Sbjct  572  FREEAALYDNTFQPYGQIMVMNADGTGKRLLTDSLWEDSMPLYLP  616


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 54/103 (52%), Gaps = 21/103 (20%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHK-NLYIID-------SLNGELDGGGIRQLTDGAWIDTMPSWSPDG  157
            PDG  + F S R G++ N++I D       +L G  D  G   L DG +    P+WSPDG
Sbjct  117  PDGTRLAFVSTREGYRTNIWIKDLKSGRLTNLTGAADVQGDPSLPDGFF---RPAWSPDG  173

Query  158  KLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  256
            K IAFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  174  KQIAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  216



>gb|KFY81759.1| hypothetical protein V500_11119 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=665

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 84/167 (50%), Gaps = 22/167 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDG  +V+R  G  G   L I++     L       LTD  W D  P WSPDG+LI F+ 
Sbjct  508  PDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-DNNPGWSPDGELIVFTR  560

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  561  RNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA---------HAAWSADGR-IMY  610

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  487
            T+ + G   E V+  N FQPYG + +M  DG+    LT + +E+  P
Sbjct  611  TSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWEDSMP  657



>gb|KFZ03462.1| hypothetical protein V502_10931 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=666

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 84/167 (50%), Gaps = 22/167 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDG  +V+R  G  G   L I++     L       LTD  W D  P WSPDG+LI F+ 
Sbjct  508  PDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-DNNPGWSPDGELIVFTR  560

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  561  RNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA---------HAAWSADGR-IMY  610

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  487
            T+ + G   E V+  N FQPYG + +M  DG+    LT + +E+  P
Sbjct  611  TSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWEDSMP  657



>gb|EJE50504.1| periplasmic component of the Tol biopolymer transport system 
[Acidovorax sp. CF316]
Length=637

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 81/166 (49%), Gaps = 12/166 (7%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DGK +VFR       +  +       L+   IR +T G   D MP WSPDG  I F+   
Sbjct  479  DGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--YDNMPIWSPDGSRILFNRGV  536

Query  185  HNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             NP +    F +Y VRPDG+ LRR+    A            H  +++D + +L+ +   
Sbjct  537  RNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------GHPVWTADGKQILYNSGQA  587

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            G   E       FQPYG +++M  DG+G +++T + +E+ TP + P
Sbjct  588  GYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDSTPQYAP  633


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 72/149 (48%), Gaps = 20/149 (13%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PD   + F S R G   N++++D    +L       GI+   D       PSWSPDG+ +
Sbjct  120  PDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQGRADSPNGFFRPSWSPDGQWL  179

Query  167  AFSSNR------HNPG----NADCFSIYVVRPDGTGLRRIHVAG--AEGSEEVNRERLNH  310
            AFSS+R      H+ G    +    SIYV+R DGTG R+I       +GS + + +    
Sbjct  180  AFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKISSRKDYCQGSPKWSADGKRI  239

Query  311  VCFSSDSE---WVLFTANLGGVTAEPVSI  388
            V + + +E   WVL    L  + ++ VS+
Sbjct  240  VFYETQAEYTYWVLRPDLLLKIDSQIVSV  268



>ref|WP_035205184.1| hypothetical protein [Acidovorax sp. CF316]
Length=622

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 81/166 (49%), Gaps = 12/166 (7%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DGK +VFR       +  +       L+   IR +T G   D MP WSPDG  I F+   
Sbjct  464  DGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--YDNMPIWSPDGSRILFNRGV  521

Query  185  HNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             NP +    F +Y VRPDG+ LRR+    A            H  +++D + +L+ +   
Sbjct  522  RNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------GHPVWTADGKQILYNSGQA  572

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            G   E       FQPYG +++M  DG+G +++T + +E+ TP + P
Sbjct  573  GYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDSTPQYAP  618


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 72/149 (48%), Gaps = 20/149 (13%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PD   + F S R G   N++++D    +L       GI+   D       PSWSPDG+ +
Sbjct  105  PDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQGRADSPNGFFRPSWSPDGQWL  164

Query  167  AFSSNR------HNPG----NADCFSIYVVRPDGTGLRRIHVAG--AEGSEEVNRERLNH  310
            AFSS+R      H+ G    +    SIYV+R DGTG R+I       +GS + + +    
Sbjct  165  AFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKISSRKDYCQGSPKWSADGKRI  224

Query  311  VCFSSDSE---WVLFTANLGGVTAEPVSI  388
            V + + +E   WVL    L  + ++ VS+
Sbjct  225  VFYETQAEYTYWVLRPDLLLKIDSQIVSV  253



>ref|NP_001066679.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|ABA97669.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29698.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|EAY82937.1| hypothetical protein OsI_38155 [Oryza sativa Indica Group]
 gb|EAZ20324.1| hypothetical protein OsJ_35933 [Oryza sativa Japonica Group]
Length=777

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 93/207 (45%), Gaps = 52/207 (25%)
 Frame = +2

Query  5    DGKHIVFRSGRS-------GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKL  163
            +G  +VFRS R+        HKNLYIID+  GE    G+  LTDG W DT  SWSP    
Sbjct  526  EGTKLVFRSSRNRVAGGERQHKNLYIIDAEKGE--AAGVVPLTDGPWTDTHCSWSPREGC  583

Query  164  --IAFSSN----------RHNPG-----NADCFSIYVVRPDGTG-------LRRIHVAGA  271
              I FSS           +  P      +   F++Y+V             +R IH A  
Sbjct  584  DWIVFSSTGRPEKDIVKGKDEPEKDHGLDPGYFAVYLVNAKDIKKGEVPVPVRVIHSAPT  643

Query  272  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGT  442
                      +NH  FS D + ++F A+L  V+A+P+S+P   +  +PYGD++ + L  T
Sbjct  644  IAGH------INHPVFSPDMKSIVFAADLAAVSADPISMPHFTHSVRPYGDIFSVNLRDT  697

Query  443  G----------LQRLTWNGYENGTPAW  493
                         R+T + YE  TP W
Sbjct  698  TDMAKNRDIQEFHRITHSRYEYSTPTW  724



>ref|WP_006298539.1| hypothetical protein [Hylemonella gracilis]
 gb|EGI76207.1| hypothetical protein HGR_12282 [Hylemonella gracilis ATCC 19624]
Length=638

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 81/166 (49%), Gaps = 12/166 (7%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DGK +VFR      K+  +       L+   IR++T G   D MP WSPDG  I F+   
Sbjct  480  DGKEVVFRIANEDPKSASLGGLAVLNLETRQIRRITAG--YDNMPIWSPDGSRILFNRGV  537

Query  185  HNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
             NP +    F +Y VRPDG+ L+R+    A            H  ++ D + +L+ + + 
Sbjct  538  RNPNSIWSNFDLYTVRPDGSDLQRLTSHPASD---------GHPVWTPDGKQILYNSGMA  588

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            G   E       FQPYG L++M  DG   +++T + +E+ TP + P
Sbjct  589  GYRDEACHYDQTFQPYGQLFVMDADGRNKRQITDSIWEDSTPQYVP  634


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 73/156 (47%), Gaps = 32/156 (21%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGH-KNLYIIDSLNGELDGGGIRQLT--DGAWIDTM---------PSW  145
            PDG  + F S R G   N++++D     L    +R LT   G   D +         PSW
Sbjct  119  PDGSKVAFVSTRDGFLANIWVLD-----LQTRKLRNLTGIKGVQADDLQNSPSGFFRPSW  173

Query  146  SPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI-----HVAGAEGS  280
            SPDG+ +AFSS+R      H+ G    +    SIYV+R DGTGLRR+     H  G+   
Sbjct  174  SPDGQWLAFSSDRNTEWKGHHDGAGWEHTQELSIYVIRVDGTGLRRVASRKDHCLGSPRW  233

Query  281  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  388
                +  + +   +  + WVL    L  + ++ VS+
Sbjct  234  SGDGKRIVFYETLAEYTYWVLRPDLLLKIDSQIVSV  269



>emb|CAE05101.3| OSJNBa0009K15.21 [Oryza sativa Japonica Group]
 gb|EAZ30049.1| hypothetical protein OsJ_14105 [Oryza sativa Japonica Group]
Length=139

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 10/98 (10%)
 Frame = +2

Query  305  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  484
            NH  FSSDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GT
Sbjct  33   NHPWFSSDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSNIRRLTHNSFEDGT  92

Query  485  PAWHPKAEVDLARLSLGKSGEKL----RGKFDEPLWIN  586
            P+W P        L     GE L    R  F +  W+N
Sbjct  93   PSWTPY------FLDPRDVGETLQASGRCAFQDCHWLN  124



>gb|KFY12538.1| hypothetical protein V491_06750 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=665

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 84/167 (50%), Gaps = 22/167 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDG  +V+R  G  G   L I++     L       LT   W D  PSWSPDGK I F+ 
Sbjct  508  PDGTQLVYREFGPDGPLGLRIMN-----LADKTTTNLT-ADW-DNNPSWSPDGKRIVFTR  560

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  561  RNHINWDDIGATDSFDIYTIAPDGTGLAQLTTSGANDA---------HAAWSADGR-IMY  610

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  487
            T+ + G   E V+  N FQPYG + +M  DG+  + LT + +E+  P
Sbjct  611  TSGMYGFREESVNYDNTFQPYGQIVIMDADGSNKRMLTDSMWEDSMP  657



>gb|AFB33555.1| hypothetical protein 2_7121_02, partial [Pinus mugo]
Length=152

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM SWSPDG+ I
Sbjct  100  PDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGPWTDTMCSWSPDGEWI  152



>gb|AFG49274.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  100  PDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGPWTDTMCTWSPDGEWI  152



>gb|AEW08359.1| hypothetical protein 2_7121_02, partial [Pinus radiata]
 gb|AFG49263.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49264.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49265.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49266.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49267.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49268.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49269.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49270.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49271.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49272.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49273.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49275.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49276.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49277.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49278.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49279.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49280.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  100  PDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGPWTDTMCTWSPDGEWI  152



>ref|XP_010091904.1| hypothetical protein L484_001053 [Morus notabilis]
 gb|EXB47193.1| hypothetical protein L484_001053 [Morus notabilis]
Length=210

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 85/167 (51%), Gaps = 25/167 (15%)
 Frame = +2

Query  77   GELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR  229
            GE   G I +LT+GA  DT   WSP G  I FSS R  P +A           F++++V+
Sbjct  7    GEYRDGIITRLTNGASTDTHCQWSPRGDWIVFSSTRDKPEDAPELDNGLDPGYFAVFLVK  66

Query  230  PDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  400
             +   +  + V G++         +NH  FS D + ++ TA+L  V+ +P+S+P   +  
Sbjct  67   ANNPSV-EVRVLGSDSDLA---GHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSV  122

Query  401  QPYGDLYMMRLDGTGL---------QRLTWNGYENGTPAWHPKAEVD  514
            +PYGD++++ +D   +          R+T + YEN T +W P +  D
Sbjct  123  RPYGDIFIVDIDPDDINKNKDVEKFNRITHSRYENSTASWTPFSTQD  169



>gb|EKD68537.1| Periplasmic component of the Tol biopolymer transport system, 
partial [uncultured bacterium]
Length=653

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 63/117 (54%), Gaps = 19/117 (16%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IVF S R G+  +YI++S     DG G+  LT+ A  DT P++SPDGK I FSS+
Sbjct  519  PDGSKIVFVSDRDGNNEIYIMNS-----DGSGLANLTNNAKNDTDPNFSPDGKKIVFSSD  573

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTA  352
            R  PG      IY +  DGTGL RI   G    E          C+S D   ++F+A
Sbjct  574  RDGPGQ-----IYTMNADGTGLARITSGGLNCFEP---------CYSPDGRKIVFSA  616


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 65/149 (44%), Gaps = 33/149 (22%)
 Frame = +2

Query  53   LYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRP  232
            +Y+ D       GG +  LT+    D    +SPDG  I F S+R   GN +   IY++  
Sbjct  492  IYVFDKT-----GGSLVNLTNNPAADVTSKFSPDGSKIVFVSDRD--GNNE---IYIMNS  541

Query  233  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYG  412
            DG+GL  +    A+   + N        FS D + ++F+++  G               G
Sbjct  542  DGSGLANL-TNNAKNDTDPN--------FSPDGKKIVFSSDRDGP--------------G  578

Query  413  DLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
             +Y M  DGTGL R+T  G     P + P
Sbjct  579  QIYTMNADGTGLARITSGGLNCFEPCYSP  607


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IVF S R G   +Y +++     DG G+ ++T G      P +SPDG+ I FS+ 
Sbjct  563  PDGKKIVFSSDRDGPGQIYTMNA-----DGTGLARITSGGLNCFEPCYSPDGRKIVFSAY  617

Query  182  RHNPGNADCFSIYVVRPDGTGLRRI  256
              +  +   F+   V PDGT  + I
Sbjct  618  TSSLSDGGVFT---VNPDGTDPKVI  639



>ref|WP_043399319.1| tolB protein precursor protein, partial [Cystobacter violaceus]
Length=349

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 92/190 (48%), Gaps = 38/190 (20%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  + F S R+G   +Y++ +     DG  +R+LT     D  P WSPDGK I+F S+
Sbjct  168  PDGTQVAFVSSRTGDPEIYVMKA-----DGTDVRRLTSFHKEDMAPKWSPDGKWISFLSD  222

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE-----VNRERLNHVCFSSDSEWVLF  346
            R          ++VV+PDGTGLR +  +   G E       + ++L  V  + D +  ++
Sbjct  223  REG-----RVRVFVVKPDGTGLRAVSGSQQTGEEREPVWSPDGKKLAFVGRAKDQKSRIW  277

Query  347  TANLGGVTAEPVSIPN--------QFQPYG-------------DLYMMRLDGTGLQRLTW  463
             A++GG   EPV++ +        ++ P G             +L++MR +G+G  +LT 
Sbjct  278  VADMGG--GEPVALTDGKSTDDQPEWSPDGKYLAFASERTGDVELFLMRANGSGQTQLTS  335

Query  464  NGYENGTPAW  493
                +  P W
Sbjct  336  TKGADWLPRW  345



>gb|AFB33550.1| hypothetical protein 2_7121_02, partial [Larix decidua]
Length=152

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  100  PDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGPWTDTMCNWSPDGEWI  152



>ref|WP_034400879.1| translocation protein TolB [Candidatus Pelagibacter ubique]
Length=441

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 90/195 (46%), Gaps = 40/195 (21%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IV    + G+ ++Y +D     LD   + ++TD + IDT PS+SPDGK IAF+S+
Sbjct  256  PDGKKIVMSFAKDGNSDIYTMD-----LDTRVVERITDHSSIDTSPSFSPDGKFIAFNSD  310

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R     +    IYV+R DG+G++RI          V   R + + F+   +         
Sbjct  311  R-----SGLQQIYVMRSDGSGVKRITFGNGIYGTPVWSPRGDLIAFTKMRK---------  356

Query  362  GVTAEPVSIPNQFQPYGDLYM--MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG  535
                            G  Y+  MR DGTG + LT N Y+   P+W P   V L      
Sbjct  357  ----------------GRFYIGVMRTDGTGERLLTENYYQEA-PSWSPNGRV-LVFYRET  398

Query  536  KSGEKLRGKFDEPLW  580
            K+G K  G F   LW
Sbjct  399  KAGSKGEG-FSAKLW  412



>gb|AFB33549.1| hypothetical protein 2_7121_02, partial [Abies alba]
Length=150

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  98   PDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGPWTDTMCNWSPDGEWI  150



>gb|AEW08360.1| hypothetical protein 2_7121_02, partial [Pinus lambertiana]
 gb|AFB33551.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33552.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  100  PDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGPWTDTMCNWSPDGEWI  152



>gb|KFY42678.1| hypothetical protein V495_04387 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY59861.1| hypothetical protein V497_04044 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=665

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 84/169 (50%), Gaps = 22/169 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            P G  +V+R  G  G   L I++     +       LTDG W D  P WSPDGK I F+ 
Sbjct  508  PVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-DNNPGWSPDGKRIVFTR  560

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  561  RNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWSADGR-IVY  610

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            T+ + G   E V+  + FQPYG + +M  DGT    LT + +E+  P +
Sbjct  611  TSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWEDSMPVY  659



>gb|AFB33553.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33554.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  166
            PDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  100  PDGKFVVFRSGRNGHKNLYIMDAEEGEE--GGLWQLTEGPWTDTMCNWSPDGEWI  152



>ref|XP_001545913.1| hypothetical protein BC1G_15641 [Botrytis cinerea B05.10]
 gb|EMR86797.1| putative tat pathway signal sequence domain-containing protein 
[Botrytis cinerea BcDW1]
 emb|CCD52696.2| similar to prolyl oligopeptidase [Botrytis cinerea T4]
Length=674

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 81/168 (48%), Gaps = 18/168 (11%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IV+R    G   LY I      L  G +  LTD  W D  P WSPDG+ I F+  
Sbjct  515  PDGTKIVYR--ECGPAPLYCIGLRILNLADGTVTNLTD-TW-DNTPGWSPDGERIVFTRR  570

Query  182  RH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  349
             H    +  + D + +Y + P+GTGL ++  +GA  +         H  +S+D   +L++
Sbjct  571  NHLNFDDLSSTDSYDVYTIFPNGTGLTQVTTSGANDA---------HAVWSADGR-ILYS  620

Query  350  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            + + G   E     N FQPYG +  M  DG+    LT + +E+  P +
Sbjct  621  SGMYGFREESPLYDNAFQPYGQIISMNFDGSNKTMLTDSMWEDSMPLY  668



>gb|KFX90155.1| hypothetical protein V490_06619 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=665

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 84/169 (50%), Gaps = 22/169 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            P G  +V+R  G  G   L I++     +       LTDG W D  P WSPDGK I F+ 
Sbjct  508  PVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-DNNPGWSPDGKRIVFTR  560

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +++D   +++
Sbjct  561  RNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWTADGR-IVY  610

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            T+ + G   E V+  + FQPYG + +M  DGT    LT + +E+  P +
Sbjct  611  TSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWEDSMPVY  659



>gb|KFY02373.1| hypothetical protein O988_02191 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=665

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 84/169 (50%), Gaps = 22/169 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            P G  +V+R  G  G   L I++     +       LTDG W D  P WSPDGK I F+ 
Sbjct  508  PFGDQLVYRDFGPDGGLGLRILN-----ITDKTTINLTDG-W-DNNPGWSPDGKRIVFTR  560

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  561  RNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWSADGR-IVY  610

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            T+ + G   E V+  + FQPYG + +M  DGT    LT + +E+  P +
Sbjct  611  TSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWEDSMPVY  659



>ref|WP_033378529.1| MULTISPECIES: hypothetical protein, partial [Marinimicrobia]
Length=304

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 87/187 (47%), Gaps = 32/187 (17%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK I F    +G+ ++Y+ D+      G  +R+LT    IDT P+WSP+GK +AF+S+
Sbjct  125  PDGKKIAFSLTTNGNTDIYVSDT-----HGNNLRRLTQNPGIDTSPAWSPNGKSLAFTSD  179

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS------------  325
            R     +    IY++  DG  +RR+       +      R + + + S            
Sbjct  180  R-----SGSPQIYLMDADGANIRRLTYNNDYNASPAWSPRGDVIAYESQESNGFQIYLIT  234

Query  326  -DSEWVLFTANLGGVTAEPVSIPNQFQPYG--------DLYMMRLDGTGLQRLTWNGYEN  478
             D E V    +     A+PV  PN              ++Y M LDG+ L+RLT++G  N
Sbjct  235  PDGEEVQCITDRTASYADPVWAPNGLHLACASNRTGKWEIYSMYLDGSRLKRLTFSG-NN  293

Query  479  GTPAWHP  499
              PAW P
Sbjct  294  TQPAWSP  300


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 77/174 (44%), Gaps = 38/174 (22%)
 Frame = +2

Query  2    PDGKHIVFRS---GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  172
            PDGK ++F S    +     L I +  + +     I +LT      T P +SPDGK IAF
Sbjct  78   PDGKQLIFSSLIPAQHLASQLVIFNFASNQ-----ISRLTQIVGPATSPVFSPDGKKIAF  132

Query  173  SSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  349
            S   +  GN D   IYV    G  LRR+    G + S            +S + + + FT
Sbjct  133  SLTTN--GNTD---IYVSDTHGNNLRRLTQNPGIDTSP----------AWSPNGKSLAFT  177

Query  350  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV  511
            ++  G                 +Y+M  DG  ++RLT+N   N +PAW P+ +V
Sbjct  178  SDRSGSP--------------QIYLMDADGANIRRLTYNNDYNASPAWSPRGDV  217



>gb|KFY15902.1| hypothetical protein V492_01680 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=652

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 83/167 (50%), Gaps = 22/167 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDG  +V+R  G  G   L I++     +       LT+  W D  P WSPDGK I F+ 
Sbjct  495  PDGTQLVYRDFGPDGGLGLRILN-----IADNTTTTLTED-W-DNNPGWSPDGKSIVFTR  547

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  548  RNHINWEDLGATDSFDIYTIAPDGTGLMQLTTSGANDA---------HAAWSADGR-IMY  597

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  487
            T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  598  TSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>ref|WP_040479380.1| translocation protein TolB [Mariniradius saccharolyticus]
Length=313

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 89/161 (55%), Gaps = 25/161 (16%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK+I+F S R G+  +Y +D+     DG     L++    D +P+WSPDGK IAF+SN
Sbjct  80   PDGKYILFYSNRDGNNEIYRMDA-----DGSNPTNLSNHPANDYLPAWSPDGKTIAFTSN  134

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R    ++D   IY++  DG+ +RR+     +  EEV         +S + + ++FT  L 
Sbjct  135  R----DSDNREIYIMAIDGSNVRRL--THNDLFEEV-------PTWSPNGKQIVFTRQLE  181

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW-NGYENG  481
             +  + V   N     G+L++M +DG   +RLT+  GY++G
Sbjct  182  EM-VDTVKTTN-----GELFVMDIDGKNEKRLTFREGYDSG  216


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 71/164 (43%), Gaps = 32/164 (20%)
 Frame = +2

Query  17   IVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG  196
            + F + R G+  +Y +++     DG  +  LT    +D   SWSPDGK I F SNR   G
Sbjct  41   LAFLTTRDGNFEVYTMNA-----DGREVNNLTQNKALDFWSSWSPDGKYILFYSNRD--G  93

Query  197  NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAE  376
            N + +     R D  G    +++    ++ +         +S D + + FT+N      E
Sbjct  94   NNEIY-----RMDADGSNPTNLSNHPANDYL-------PAWSPDGKTIAFTSNRDSDNRE  141

Query  377  PVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
                         +Y+M +DG+ ++RLT N      P W P  +
Sbjct  142  -------------IYIMAIDGSNVRRLTHNDLFEEVPTWSPNGK  172



>gb|EMS34061.1| tolB protein precursor, periplasmic protein involved in the tonb-independent 
uptake of group A colicins [Mariniradius saccharolyticus 
AK6]
Length=331

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 89/161 (55%), Gaps = 25/161 (16%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK+I+F S R G+  +Y +D+     DG     L++    D +P+WSPDGK IAF+SN
Sbjct  98   PDGKYILFYSNRDGNNEIYRMDA-----DGSNPTNLSNHPANDYLPAWSPDGKTIAFTSN  152

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R    ++D   IY++  DG+ +RR+     +  EEV         +S + + ++FT  L 
Sbjct  153  R----DSDNREIYIMAIDGSNVRRL--THNDLFEEV-------PTWSPNGKQIVFTRQLE  199

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW-NGYENG  481
             +  + V   N     G+L++M +DG   +RLT+  GY++G
Sbjct  200  EM-VDTVKTTN-----GELFVMDIDGKNEKRLTFREGYDSG  234


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 71/164 (43%), Gaps = 32/164 (20%)
 Frame = +2

Query  17   IVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG  196
            + F + R G+  +Y +++     DG  +  LT    +D   SWSPDGK I F SNR   G
Sbjct  59   LAFLTTRDGNFEVYTMNA-----DGREVNNLTQNKALDFWSSWSPDGKYILFYSNRD--G  111

Query  197  NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAE  376
            N + +     R D  G    +++    ++ +         +S D + + FT+N      E
Sbjct  112  NNEIY-----RMDADGSNPTNLSNHPANDYL-------PAWSPDGKTIAFTSNRDSDNRE  159

Query  377  PVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
                         +Y+M +DG+ ++RLT N      P W P  +
Sbjct  160  -------------IYIMAIDGSNVRRLTHNDLFEEVPTWSPNGK  190



>gb|KFY74302.1| hypothetical protein V499_05663 [Pseudogymnoascus pannorum VKM 
F-103]
Length=667

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 84/169 (50%), Gaps = 22/169 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDG  +V+R  G  G   L I++     L       LT+  W D  P WSPDG+ I F+ 
Sbjct  510  PDGTQLVYRDFGPGGGLGLRILN-----LADKTTTNLTED-W-DNNPGWSPDGERIVFTR  562

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  563  RNHIKWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWSADGR-IMY  612

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P +
Sbjct  613  TSGMYGFREECVNYDNTFQPYGQIVVMNADGSNKTLVTDSMWEDSMPVY  661



>gb|KFZ05841.1| hypothetical protein V501_07970 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=665

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 83/169 (49%), Gaps = 22/169 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            PDG  +V+R  G  G   L I++     L       LT+  W D  P WSPDG+ I F+ 
Sbjct  508  PDGTQLVYRDFGPEGGLGLRILN-----LADRTTTNLTED-W-DNNPGWSPDGERIVFTR  560

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  561  RNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWSADGR-IMY  610

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            T+ + G   E V+  N FQPYG +  M  DG+    +T + +E+  P +
Sbjct  611  TSGMYGFREECVNYDNTFQPYGQIVAMNADGSNKTLVTDSMWEDSMPVY  659



>emb|CAI78611.1| tolB protein [uncultured delta proteobacterium]
Length=437

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 82/170 (48%), Gaps = 32/170 (19%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK I F S R G+ N+Y ++S     +G  +R+LT     +T P WSP G  I F+  
Sbjct  300  PDGKKIAFVSDRGGNPNIYTMNS-----NGQNVRRLTFEGTYNTSPDWSPKGDNIVFTG-  353

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R N G    F IY +RPDG+GL +I    A+  E           +S D  ++++++ + 
Sbjct  354  RDNLG---YFQIYTIRPDGSGLCQITFNSADNEEP---------SWSPDGRFIVYSSTIE  401

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV  511
            G +               +Y+M  +GTG ++L     E   P W P+ ++
Sbjct  402  GKSG--------------IYIMLFNGTGRRKLINLNGEQTYPVWSPRLDM  437


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 83/171 (49%), Gaps = 33/171 (19%)
 Frame = +2

Query  35   RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  214
            + G+ ++Y++++     +G  I +LT    ID  P+WSPDGK IAF S+R   GN +   
Sbjct  267  KDGYPDIYLMNT-----NGNIISRLTRSNSIDISPTWSPDGKKIAFVSDRG--GNPN---  316

Query  215  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPN  394
            IY +  +G  +RR+   G   +      + +++ F+          NLG           
Sbjct  317  IYTMNSNGQNVRRLTFEGTYNTSPDWSPKGDNIVFTGRD-------NLG-----------  358

Query  395  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSG  544
                Y  +Y +R DG+GL ++T+N  +N  P+W P     +   ++ GKSG
Sbjct  359  ----YFQIYTIRPDGSGLCQITFNSADNEEPSWSPDGRFIVYSSTIEGKSG  405



>gb|ENH85242.1| WD40 domain protein beta propeller [Colletotrichum orbiculare 
MAFF 240422]
Length=655

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 82/166 (49%), Gaps = 22/166 (13%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IVFR     +  L ++D     L    +R LTD    D +PSWSPDG  I F+  
Sbjct  507  PDGGSIVFREWGVRY-GLRVVD-----LATRAVRNLTDA--TDNLPSWSPDGTRIVFTRK  558

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
                 +A  F +  +RPDG+GLR +  +GA  +         H  +++D   +L+++ + 
Sbjct  559  V----DAANFDVCTIRPDGSGLRVLTSSGANDA---------HAVWTADGR-ILYSSGMY  604

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            G   E  +    FQPYG + +M  DG   + LT + +E+  P + P
Sbjct  605  GFRDEAAAYDQTFQPYGQIVVMDADGANKRMLTDSLWEDSMPLYVP  650


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 25/105 (24%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLTDGAWI--DTM-------PSWSP  151
            PDG  + + S  +G++ N++++D   GE      R LTD   +  D +       PSWSP
Sbjct  141  PDGTKLAYVSTENGYRANIWVLDLATGER-----RNLTDTPEVAGDPLLPDGHFRPSWSP  195

Query  152  DGKLIAFSSNRHNP----GN------ADCFSIYVVRPDGTGLRRI  256
            DG  IAF+S+R+ P    GN          S+Y +RPDGTG R+I
Sbjct  196  DGGWIAFASDRNTPWRGHGNGTGWEHTQELSVYAIRPDGTGFRQI  240



>gb|KFY39698.1| hypothetical protein V494_03875 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=652

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 22/167 (13%)
 Frame = +2

Query  2    PDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  178
            P+G  +V+R  G  G   L I++     +       LT+  W D  P WSPDGK I F+ 
Sbjct  495  PNGTQLVYRDFGPDGGLGLRILN-----IADNTTTTLTED-W-DNNPGWSPDGKSIVFTR  547

Query  179  NRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLF  346
              H    + G  D F IY + PDGTGL ++  +GA  +         H  +S+D   +++
Sbjct  548  RNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWSADGR-IMY  597

Query  347  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  487
            T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  598  TSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>ref|WP_020383615.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=342

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 88/192 (46%), Gaps = 44/192 (23%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGH--------KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  157
            PDGKHIVF S R GH          +Y++D+     DGG  ++LT+    D  PSWSPDG
Sbjct  176  PDGKHIVFSSRRDGHFRGNFGITHEIYVMDT-----DGGNQQRLTENRTNDWHPSWSPDG  230

Query  158  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  337
            K IAFSS+R   G+ + F IYV+  DG   +++           NR       +S D++ 
Sbjct  231  KRIAFSSDRK--GDFENFEIYVMDADGGNQQKL---------TENRVYDWRPSWSPDAKR  279

Query  338  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  517
            + F +   G                ++Y+M  DG   Q LT N   +  PAW   A    
Sbjct  280  ITFASERDGNY--------------EIYVMDADGGNPQNLTNNPNYDALPAWFGSA----  321

Query  518  ARLSLGKSGEKL  553
               S+  +G+K 
Sbjct  322  --FSVSPAGKKF  331


 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 86/178 (48%), Gaps = 34/178 (19%)
 Frame = +2

Query  2    PDGKHIVFRSGRS----GHKNL--YIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKL  163
            PDGK IVF S R     GH NL  Y++D+     DGG  + LT+    D  PSWSPDGK 
Sbjct  126  PDGKRIVFTSRRKKDADGHFNLEIYVMDA-----DGGNQQNLTNNPGEDRFPSWSPDGKH  180

Query  164  IAFSSNR--HNPGN-ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSE  334
            I FSS R  H  GN      IYV+  DG   +R+           NR    H  +S D +
Sbjct  181  IVFSSRRDGHFRGNFGITHEIYVMDTDGGNQQRL---------TENRTNDWHPSWSPDGK  231

Query  335  WVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
             + F+++  G           F+ + ++Y+M  DG   Q+LT N   +  P+W P A+
Sbjct  232  RIAFSSDRKG----------DFENF-EIYVMDADGGNQQKLTENRVYDWRPSWSPDAK  278


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 78/188 (41%), Gaps = 35/188 (19%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGH----------KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  151
            P GK I F S R GH            +Y++D+     DGG  + LT+    D  PSWSP
Sbjct  72   PHGKRIAFVSDRDGHFRADMPDIPSYGIYVMDA-----DGGNQQNLTNDLSDDRSPSWSP  126

Query  152  DGKLIAFSSNRHNPGNADC-FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSD  328
            DGK I F+S R    +      IYV+  DG   + +     E           H+ FSS 
Sbjct  127  DGKRIVFTSRRKKDADGHFNLEIYVMDADGGNQQNLTNNPGEDRFPSWSPDGKHIVFSSR  186

Query  329  SEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
             +   F  N  G+T E             +Y+M  DG   QRLT    EN T  WHP   
Sbjct  187  RD-GHFRGNF-GITHE-------------IYVMDTDGGNQQRLT----ENRTNDWHPSWS  227

Query  509  VDLARLSL  532
             D  R++ 
Sbjct  228  PDGKRIAF  235


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 78/170 (46%), Gaps = 27/170 (16%)
 Frame = +2

Query  14   HIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP  193
             I F S R G   +Y++D     ++GG  + LT+    D  PSWSP GK IAF S+R   
Sbjct  32   QIAFVSRRDGDPEIYVMD-----INGGNPQNLTNHPDRDWDPSWSPHGKRIAFVSDRDGH  86

Query  194  GNAD-----CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
              AD      + IYV+  DG   + +       + +++ +R     +S D + ++FT+  
Sbjct  87   FRADMPDIPSYGIYVMDADGGNQQNL-------TNDLSDDR--SPSWSPDGKRIVFTSRR  137

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
                    ++        ++Y+M  DG   Q LT N  E+  P+W P  +
Sbjct  138  KKDADGHFNL--------EIYVMDADGGNQQNLTNNPGEDRFPSWSPDGK  179



>ref|WP_041305462.1| hypothetical protein, partial [Herpetosiphon aurantiacus]
Length=173

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 17/113 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG+ + F+S RSG+  LY+I+      DG  +RQLT+    D  PSWSPDG LIAF+S+
Sbjct  51   PDGQQLAFQSNRSGNDELYLINR-----DGSNLRQLTNDPARDWQPSWSPDGSLIAFTSD  105

Query  182  R--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSE  334
            R    P   +   +YV++PDG GL+ +       +E   R R  H  +S DS+
Sbjct  106  RGAQTPDGWND-QLYVIQPDGQGLKYL-------TEGFGRAR--HPAWSPDSQ  148


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 79/169 (47%), Gaps = 27/169 (16%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  + F    S   N+YI        DG  + Q+T+    D  PSWSPDG+ +AF SN
Sbjct  7    PDGNELAFVVQDSDGFNMYI-----SSADGSNLFQVTNQPGDDQSPSWSPDGQQLAFQSN  61

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   GN +   +Y++  DG+ LR++    A         R     +S D   + FT++ G
Sbjct  62   RS--GNDE---LYLINRDGSNLRQLTNDPA---------RDWQPSWSPDGSLIAFTSDRG  107

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
              T  P    +Q      LY+++ DG GL+ LT        PAW P ++
Sbjct  108  AQT--PDGWNDQ------LYVIQPDGQGLKYLTEGFGRARHPAWSPDSQ  148



>gb|ETI58852.1| hypothetical protein C100_22665 [Sphingobium sp. C100]
Length=611

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 79/163 (48%), Gaps = 21/163 (13%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DGK IVFR      K L +++     LD    R LT G  +D +P WSPDGK I F+  R
Sbjct  465  DGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDGKRIVFTRKR  517

Query  185  HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGG  364
             + GN   F IY ++PDG+GL R     +            H  +S D   ++++ +  G
Sbjct  518  ED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-IMWSGSQHG  563

Query  365  VTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
               E       FQ YG +Y+M  DG+  + LT + +E+  P +
Sbjct  564  FRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMPLY  606


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 25/105 (24%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT-------DGAWIDTM--PSWSP  151
            PDG+ + F S R G++ N+++ D   G       RQLT       +  + D    P+WSP
Sbjct  107  PDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVHGEDLYPDCYFRPAWSP  161

Query  152  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  256
            DGK +AFSS+R      H+ G    +    SIY++RPDGTG R++
Sbjct  162  DGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRKV  206



>ref|WP_041569562.1| hypothetical protein, partial [Candidatus Chloracidobacterium 
thermophilum]
Length=318

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 85/174 (49%), Gaps = 26/174 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKHIVF S RSG   LYI+D+     DG  +RQLT     D    +S DGK I + ++
Sbjct  135  PDGKHIVFTSDRSGDLELYIMDT-----DGKNLRQLTHTPGYDGGAFFSHDGKQIVWRAS  189

Query  182  RHNPGNADCFSI----YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHV-CFSSDSEWVLF  346
            R      + +      +++RP    +  ++V G+      N  + N    F+ D   V+F
Sbjct  190  RPEGAELEEYRALLREHLIRPSRLDIYVMNVDGSNVRRLTNNGKANFAPFFTPDDRKVIF  249

Query  347  TANLGGVTAEPVSIPNQFQPYG---DLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            ++N+               P G   +LY++ LDGTGL+R+T+    +G P + P
Sbjct  250  SSNMD-------------DPQGRNFELYLVNLDGTGLERVTYEETFDGFPMFSP  290


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 82/190 (43%), Gaps = 44/190 (23%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNL---------YI------IDSLNGELDGGGIRQLTDGAWIDTMP  139
            DG+HI++ S     +           Y+       D     LDG  + +LTD    D   
Sbjct  72   DGRHIIYSSTHLAQRECPPRPDFSRGYVWALYPGYDIFKASLDGKRLVRLTDAPGYDAEA  131

Query  140  SWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVC  316
            + SPDGK I F+S+R          +Y++  DG  LR++ H  G +G             
Sbjct  132  TVSPDGKHIVFTSDRSGD-----LELYIMDTDGKNLRQLTHTPGYDGG----------AF  176

Query  317  FSSDSEWVLFTAN---------LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  469
            FS D + +++ A+            +  E +  P++     D+Y+M +DG+ ++RLT NG
Sbjct  177  FSHDGKQIVWRASRPEGAELEEYRALLREHLIRPSRL----DIYVMNVDGSNVRRLTNNG  232

Query  470  YENGTPAWHP  499
              N  P + P
Sbjct  233  KANFAPFFTP  242



>ref|WP_031310342.1| hypothetical protein [Sphingobium sp. C100]
Length=621

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 79/163 (48%), Gaps = 21/163 (13%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR  184
            DGK IVFR      K L +++     LD    R LT G  +D +P WSPDGK I F+  R
Sbjct  475  DGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDGKRIVFTRKR  527

Query  185  HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGG  364
             + GN   F IY ++PDG+GL R     +            H  +S D   ++++ +  G
Sbjct  528  ED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-IMWSGSQHG  573

Query  365  VTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
               E       FQ YG +Y+M  DG+  + LT + +E+  P +
Sbjct  574  FRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMPLY  616


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 25/105 (24%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT-------DGAWIDTM--PSWSP  151
            PDG+ + F S R G++ N+++ D   G       RQLT       +  + D    P+WSP
Sbjct  117  PDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVHGEDLYPDCYFRPAWSP  171

Query  152  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  256
            DGK +AFSS+R      H+ G    +    SIY++RPDGTG R++
Sbjct  172  DGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRKV  216



>ref|WP_026842125.1| translocation protein TolB [Geobacter bremensis]
Length=407

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 75/164 (46%), Gaps = 34/164 (21%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IVF S R G   ++I+++     DGG + +LT     +  P WSP G  I ++  
Sbjct  274  PDGSRIVFVSDRLGKPQVFIMNA-----DGGNVHRLTTNGAYNVTPRWSPKGDRIVYA--  326

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   G    F IY + PDGT   ++  AG+            H  FS D  +++F++   
Sbjct  327  RQGGGG---FQIYAINPDGTQDTQLTSAGSN----------EHPRFSPDGRFIVFSSTRD  373

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            G  A              +Y+MR DG+G  R++ N  +N  P W
Sbjct  374  GAEA--------------IYLMRADGSGQTRVSPNKSQNSHPTW  403


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 35/170 (21%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            P GK I++ S + G+ +LY       EL  G   +++  + ++ M ++SPDG  IA   +
Sbjct  186  PSGKEIIYTSYKKGNPDLY-----RRELFTGLEARISSRSGLNAMGAYSPDGSKIAMVMS  240

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN-HVCFSSDSEWVLFTANL  358
            +   GN++   IY++  DG  L R+           N   ++    +S D   ++F ++ 
Sbjct  241  KD--GNSE---IYLISRDGKELARL----------TNNHAIDVSPAWSPDGSRIVFVSDR  285

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
             G            +P   +++M  DG  + RLT NG  N TP W PK +
Sbjct  286  LG------------KP--QVFIMNADGGNVHRLTTNGAYNVTPRWSPKGD  321



>gb|AHG92466.1| WD40-like beta Propeller containing protein [Gemmatimonadetes 
bacterium KBS708]
Length=643

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 77/166 (46%), Gaps = 33/166 (20%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  I+  S R G   +Y++       DG G  +LT     D  PSWSPDG  I  SS 
Sbjct  419  PDGTRILVTSQRDGDAEVYVV-----RADGSGAERLTRSPGDDRDPSWSPDGSRIVLSST  473

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   GNA+   IYV+  DG+G  R+    A+ +E           +S D  W+ F +N  
Sbjct  474  RD--GNAE---IYVMNADGSGGTRLTTNAAQDAEP---------TWSPDGAWIAFVSNRD  519

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            G         N+     +LY +R +G  L+RLT +  E+  P W P
Sbjct  520  G---------NR-----ELYRVRPNGRDLERLTNDAAEDDVPVWSP  551


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 75/169 (44%), Gaps = 33/169 (20%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  IV  S R G+  +Y++++     DG G  +LT  A  D  P+WSPDG  IAF SN
Sbjct  463  PDGSRIVLSSTRDGNAEIYVMNA-----DGSGGTRLTTNAAQDAEPTWSPDGAWIAFVSN  517

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   GN +   +Y VRP+G  L R+    AE    V         +S D   + F A  G
Sbjct  518  RD--GNRE---LYRVRPNGRDLERLTNDAAEDDVPV---------WSPDGTRLAFQATRG  563

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
                             D+ ++R+      RLT +   +G  AW P  E
Sbjct  564  T--------------NYDIEVVRVADHRRTRLTVDAAYDGQLAWSPDGE  598



>gb|AEP11793.1| Periplasmic component of the Tol biopolymer transport system 
[Candidatus Chloracidobacterium thermophilum B]
Length=355

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 85/174 (49%), Gaps = 26/174 (15%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKHIVF S RSG   LYI+D+     DG  +RQLT     D    +S DGK I + ++
Sbjct  172  PDGKHIVFTSDRSGDLELYIMDT-----DGKNLRQLTHTPGYDGGAFFSHDGKQIVWRAS  226

Query  182  RHNPGNADCFSI----YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHV-CFSSDSEWVLF  346
            R      + +      +++RP    +  ++V G+      N  + N    F+ D   V+F
Sbjct  227  RPEGAELEEYRALLREHLIRPSRLDIYVMNVDGSNVRRLTNNGKANFAPFFTPDDRKVIF  286

Query  347  TANLGGVTAEPVSIPNQFQPYG---DLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            ++N+               P G   +LY++ LDGTGL+R+T+    +G P + P
Sbjct  287  SSNMD-------------DPQGRNFELYLVNLDGTGLERVTYEETFDGFPMFSP  327


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 83/190 (44%), Gaps = 44/190 (23%)
 Frame = +2

Query  5    DGKHIVFRSGRSGHKNL---------YI------IDSLNGELDGGGIRQLTDGAWIDTMP  139
            DG+HI++ S     +           Y+       D     LDG  + +LTD    D   
Sbjct  109  DGRHIIYSSTHLAQRECPPRPDFSRGYVWALYPGYDIFKASLDGKRLVRLTDAPGYDAEA  168

Query  140  SWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVC  316
            + SPDGK I F+S+R     +    +Y++  DG  LR++ H  G +G             
Sbjct  169  TVSPDGKHIVFTSDR-----SGDLELYIMDTDGKNLRQLTHTPGYDGG----------AF  213

Query  317  FSSDSEWVLFTAN---------LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  469
            FS D + +++ A+            +  E +  P++     D+Y+M +DG+ ++RLT NG
Sbjct  214  FSHDGKQIVWRASRPEGAELEEYRALLREHLIRPSRL----DIYVMNVDGSNVRRLTNNG  269

Query  470  YENGTPAWHP  499
              N  P + P
Sbjct  270  KANFAPFFTP  279



>ref|WP_015838788.1| translocation protein TolB [Geobacter sp. M21]
 gb|ACT19603.1| Tol-Pal system beta propeller repeat protein TolB [Geobacter 
sp. M21]
Length=407

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 76/164 (46%), Gaps = 34/164 (21%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDG  I F S R G   ++++++     DGG +R+LT     +  P WSP G  IA++  
Sbjct  274  PDGSRIAFVSDRLGKPQVFVMNA-----DGGNLRRLTTNGAYNVTPRWSPKGDRIAYA--  326

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   G    F I+ + PDGT   ++  AG+            H  FS D  +++F++   
Sbjct  327  RQGGGG---FQIHAINPDGTQDTQLTSAGSN----------EHPRFSPDGRFIVFSSTRD  373

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  493
            G  A              +Y+MR DG+G  R++ N  +N  P W
Sbjct  374  GAEA--------------IYLMRADGSGQTRVSPNKAQNSHPTW  403



>ref|XP_007914327.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
 gb|EOO00969.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
Length=679

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = +2

Query  2    PDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  175
            PDG  +V+R     +G   LYI+D     L  G   +LTDG W D  P WSPDGKLI F+
Sbjct  520  PDGTKLVYRLWDWNNGPLGLYIMD-----LATGNTTRLTDG-W-DNTPGWSPDGKLIVFT  572

Query  176  SNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVL  343
               +    N    D F I  ++PDGT L+ +  + A  +         H  +S D   ++
Sbjct  573  RQTNWTWGNSWELDRFDICTIKPDGTDLKVLTESQANDA---------HAVWSLDGR-IM  622

Query  344  FTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  487
            +++ + G   E     N FQPYG + +M  DG+    LT + +E+  P
Sbjct  623  YSSGMYGFRDESSLYDNTFQPYGQIIVMNADGSNKTMLTDSMWEDSMP  670



>ref|WP_027978304.1| hypothetical protein [gamma proteobacterium L18]
Length=628

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 79/168 (47%), Gaps = 19/168 (11%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK IV+R      + L I+D     +D     +LT  A  D +P WSPDG  I F+  
Sbjct  476  PDGKKIVYRVWSPKVQGLRILD-----VDTRQTTELTSEA--DNLPGWSPDGSKIVFTRK  528

Query  182  RHNPGNADCF--SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTAN  355
              NP + + F   +Y ++PDGTG+ R+   GA            H  +  D   + +++ 
Sbjct  529  EINPADPNKFHYDVYTIKPDGTGVTRLTTPGAN---------QGHAVWLYDGR-IAYSSG  578

Query  356  LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  499
            + G   E     N FQP G  ++M  DG+G   +T   +E+  P + P
Sbjct  579  VYGFRDELALYDNTFQPDGQNWVMNADGSGQHAITDTLWEDSMPLYVP  626



>ref|WP_026159723.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=319

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 89/185 (48%), Gaps = 36/185 (19%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGKHI F S R G   +Y++D+     DG   R+LT+    DT PSWSPDG+ IAF S+
Sbjct  159  PDGKHIAFVSDRDGASEIYVMDA-----DGKNQRRLTENLSPDTGPSWSPDGERIAFVSD  213

Query  182  RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLG  361
            R   GN   F IYV+  DG   RR+    +  +            +S D + ++F +   
Sbjct  214  RD--GN---FDIYVMDADGKNQRRLTRNPSPDTGP---------SWSPDGKRIVFVSTRN  259

Query  362  GVTAEPVSIPNQFQPYGDLYMMRLDGT-GLQRLTWNGYENGTPAWHPKAEVDLARLSLGK  538
            G                ++Y+M  DG   ++R T +G ++  PAW   A V +   ++  
Sbjct  260  G--------------NKEIYVMNADGARQVRRRTKDGSDDTDPAWFDPAFVPV--FAVSP  303

Query  539  SGEKL  553
            +G+K 
Sbjct  304  AGKKF  308


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 78/170 (46%), Gaps = 36/170 (21%)
 Frame = +2

Query  2    PDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSN  181
            PDGK I F S R G+K +Y++D+     DG   R LT+    +  PSWSPD K IAF+ N
Sbjct  72   PDGKRIAFVSDRDGNKEIYVMDA-----DGKNPRNLTNSHVGEWEPSWSPDSKRIAFTLN  126

Query  182  -RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANL  358
             RH       + IYV+  DG   +  H+       +       +  +S D + + F ++ 
Sbjct  127  GRH-------WRIYVIDADG---KNQHILTNNDFHDW------YPSWSPDGKHIAFVSDR  170

Query  359  GGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  508
             G +              ++Y+M  DG   +RLT N   +  P+W P  E
Sbjct  171  DGAS--------------EIYVMDADGKNQRRLTENLSPDTGPSWSPDGE  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780