BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050D18

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798152.1|  PREDICTED: probable glycerophosphoryl dieste...    362   5e-121   Nicotiana sylvestris
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    367   2e-118   Nicotiana sylvestris
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    366   3e-118   Nicotiana tomentosiformis
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    366   3e-118   Solanum tuberosum [potatoes]
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    363   4e-117   
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    363   4e-117   Solanum lycopersicum
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    362   2e-116   Solanum tuberosum [potatoes]
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    357   9e-115   Solanum lycopersicum
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             339   1e-107   Citrus clementina [clementine]
emb|CDP13760.1|  unnamed protein product                                330   1e-104   Coffea canephora [robusta coffee]
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    328   1e-103   Glycine max [soybeans]
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                   321   1e-103   Citrus sinensis [apfelsine]
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    319   5e-103   
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    326   7e-103   
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   323   1e-102   Citrus sinensis [apfelsine]
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    326   1e-102   Sesamum indicum [beniseed]
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    325   2e-102   Glycine soja [wild soybean]
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   323   5e-102   Citrus sinensis [apfelsine]
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    323   1e-101   Nelumbo nucifera [Indian lotus]
gb|KJB62955.1|  hypothetical protein B456_009G445400                    323   1e-101   Gossypium raimondii
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    323   2e-101   Vitis vinifera
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    323   2e-101   Citrus sinensis [apfelsine]
emb|CAN61355.1|  hypothetical protein VITISV_027762                     319   3e-101   Vitis vinifera
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   323   4e-101   Citrus sinensis [apfelsine]
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    316   6e-101   
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    321   6e-101   Pyrus x bretschneideri [bai li]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    322   7e-101   Ricinus communis
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    320   1e-100   Pyrus x bretschneideri [bai li]
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...    310   4e-100   Pyrus x bretschneideri [bai li]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    318   9e-100   Populus euphratica
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    317   2e-99    
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    316   7e-99    Populus euphratica
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    316   9e-99    Cucumis melo [Oriental melon]
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    316   1e-98    Gossypium arboreum [tree cotton]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             314   3e-98    Prunus persica
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    309   4e-98    
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    307   4e-98    
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         312   2e-97    Jatropha curcas
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    312   2e-97    Populus euphratica
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    311   3e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             311   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    311   7e-97    Prunus mume [ume]
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    310   1e-96    Gossypium arboreum [tree cotton]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    310   1e-96    Glycine max [soybeans]
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    310   1e-96    Glycine soja [wild soybean]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                309   4e-96    Erythranthe guttata [common monkey flower]
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    308   5e-96    Glycine max [soybeans]
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    308   5e-96    
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    308   6e-96    Pyrus x bretschneideri [bai li]
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    308   6e-96    
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    308   7e-96    
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    307   1e-95    Glycine soja [wild soybean]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    306   4e-95    Tarenaya hassleriana [spider flower]
gb|KJB13801.1|  hypothetical protein B456_002G094900                    304   5e-95    Gossypium raimondii
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    306   5e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             305   6e-95    Phaseolus vulgaris [French bean]
gb|KJB13800.1|  hypothetical protein B456_002G094900                    304   7e-95    Gossypium raimondii
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    295   8e-95    
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             305   1e-94    Phaseolus vulgaris [French bean]
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    305   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    302   2e-94    Medicago truncatula
gb|KJB13799.1|  hypothetical protein B456_002G094900                    304   3e-94    Gossypium raimondii
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    303   6e-94    Nelumbo nucifera [Indian lotus]
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              302   1e-93    Medicago truncatula
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    293   2e-93    
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    301   4e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g            293   6e-93    Phaseolus vulgaris [French bean]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             300   1e-92    Eutrema salsugineum [saltwater cress]
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    297   1e-91    Cicer arietinum [garbanzo]
emb|CDX94294.1|  BnaC01g18900D                                          297   1e-91    
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    296   2e-91    Brachypodium distachyon [annual false brome]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    296   3e-91    Sesamum indicum [beniseed]
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    296   3e-91    Tarenaya hassleriana [spider flower]
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             296   3e-91    Phaseolus vulgaris [French bean]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    296   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAL07129.1|  unknown protein                                         296   4e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       296   5e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    295   6e-91    Camelina sativa [gold-of-pleasure]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    295   7e-91    
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    295   7e-91    Setaria italica
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          295   7e-91    Sorghum bicolor [broomcorn]
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    295   9e-91    Cicer arietinum [garbanzo]
emb|CDY71959.1|  BnaCnng75290D                                          281   2e-90    Brassica napus [oilseed rape]
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    290   7e-90    
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    291   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    291   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    291   3e-89    Brassica rapa
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    290   3e-89    Triticum urartu
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    292   3e-89    
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     290   7e-89    Zea mays [maize]
ref|XP_002867546.1|  MRH5/SHV3                                          290   7e-89    
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    290   9e-89    Elaeis guineensis
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    288   1e-88    
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    289   1e-88    Phoenix dactylifera
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    289   2e-88    Brassica rapa
emb|CDX89312.1|  BnaA01g15810D                                          288   2e-88    
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    288   2e-88    Glycine soja [wild soybean]
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    288   2e-88    Brassica rapa
dbj|BAJ87963.1|  predicted protein                                      288   2e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85772.1|  predicted protein                                      288   2e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    288   3e-88    Camelina sativa [gold-of-pleasure]
emb|CDY36746.1|  BnaA03g11400D                                          288   3e-88    Brassica napus [oilseed rape]
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    288   4e-88    Arabis alpina [alpine rockcress]
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    288   4e-88    Cucumis sativus [cucumbers]
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    285   7e-88    Glycine max [soybeans]
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    286   8e-88    Oryza brachyantha
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             285   1e-87    Phaseolus vulgaris [French bean]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             286   2e-87    Capsella rubella
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             285   2e-87    Phaseolus vulgaris [French bean]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             286   2e-87    Capsella rubella
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    286   2e-87    Camelina sativa [gold-of-pleasure]
ref|NP_001053060.1|  Os04g0472300                                       285   3e-87    
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    285   3e-87    Camelina sativa [gold-of-pleasure]
emb|CAH67272.1|  B0806H07.1                                             285   3e-87    Oryza sativa [red rice]
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    285   5e-87    Arabis alpina [alpine rockcress]
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    286   6e-87    Phoenix dactylifera
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    285   6e-87    Glycine max [soybeans]
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    285   7e-87    
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                284   7e-87    Erythranthe guttata [common monkey flower]
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             285   8e-87    Phaseolus vulgaris [French bean]
ref|NP_001047275.1|  Os02g0588500                                       284   8e-87    
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             284   1e-86    Eutrema salsugineum [saltwater cress]
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    281   2e-86    
emb|CDY11996.1|  BnaC03g14220D                                          283   4e-86    Brassica napus [oilseed rape]
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    282   5e-86    Brassica rapa
emb|CDY17323.1|  BnaA10g09570D                                          282   7e-86    Brassica napus [oilseed rape]
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    281   9e-86    Brassica rapa
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    281   1e-85    Elaeis guineensis
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    280   3e-85    Fragaria vesca subsp. vesca
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    280   3e-85    
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    280   5e-85    Fragaria vesca subsp. vesca
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    279   9e-85    Elaeis guineensis
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    279   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY14478.1|  BnaC03g21170D                                          284   1e-84    Brassica napus [oilseed rape]
emb|CDY61647.1|  BnaCnng38120D                                          277   3e-84    Brassica napus [oilseed rape]
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    277   4e-84    Brassica rapa
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    275   6e-84    Cicer arietinum [garbanzo]
emb|CDY46667.1|  BnaA03g48410D                                          282   1e-83    Brassica napus [oilseed rape]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    276   1e-83    Brassica rapa
emb|CDX92782.1|  BnaC07g40400D                                          281   1e-83    
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    275   2e-83    Triticum urartu
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    277   2e-83    
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    280   4e-83    Brassica rapa
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             275   5e-83    
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    273   6e-83    Glycine soja [wild soybean]
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    274   6e-83    Phoenix dactylifera
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             273   1e-82    Eutrema salsugineum [saltwater cress]
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    272   2e-82    Tarenaya hassleriana [spider flower]
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    273   2e-82    Camelina sativa [gold-of-pleasure]
gb|AAP40466.1|  unknown protein                                         273   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    273   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    272   3e-82    Glycine soja [wild soybean]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    271   4e-82    Glycine max [soybeans]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    272   5e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    271   5e-82    Nelumbo nucifera [Indian lotus]
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    270   1e-81    
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    270   1e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|AAF98210.1|AC007152_6  Unknown protein                               275   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   275   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    270   2e-81    Camelina sativa [gold-of-pleasure]
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    268   3e-81    Medicago truncatula
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   268   4e-81    Genlisea aurea
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    269   5e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    269   7e-81    
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              268   8e-81    
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    266   1e-80    Setaria italica
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    273   1e-80    
ref|NP_001169682.1|  hypothetical protein precursor                     268   1e-80    Zea mays [maize]
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    267   2e-80    Camelina sativa [gold-of-pleasure]
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    266   3e-80    
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    271   4e-80    
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    266   9e-80    Camelina sativa [gold-of-pleasure]
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    266   9e-80    Setaria italica
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750          265   2e-79    Amborella trichopoda
emb|CDY13237.1|  BnaC09g24190D                                          265   2e-79    Brassica napus [oilseed rape]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    269   2e-79    
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    263   1e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW72078.1|  hypothetical protein ZEAMMB73_869244                    252   1e-78    
ref|NP_001142429.1|  uncharacterized protein LOC100274608               252   1e-78    
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    262   2e-78    
tpg|DAA63616.1|  TPA: hypothetical protein ZEAMMB73_629479              251   3e-78    
gb|AAV64238.1|  unknown                                                 252   4e-78    Zea mays [maize]
gb|AAV64200.1|  unknown                                                 252   4e-78    Zea mays [maize]
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          261   5e-78    Sorghum bicolor [broomcorn]
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    260   8e-78    
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    259   9e-78    
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             258   2e-77    
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    258   5e-77    Brassica rapa
emb|CDY19634.1|  BnaA05g20420D                                          258   6e-77    Brassica napus [oilseed rape]
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    257   1e-76    Oryza brachyantha
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             256   1e-76    
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             256   1e-76    
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             257   1e-76    Capsella rubella
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             256   2e-76    
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    256   4e-76    
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    255   6e-76    Arabidopsis thaliana [mouse-ear cress]
gb|AAO42211.1|  unknown protein                                         254   7e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    254   2e-75    Zea mays [maize]
ref|XP_002888566.1|  kinase family protein                              258   2e-75    
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             251   1e-74    Capsella rubella
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    255   1e-74    Setaria italica
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    252   2e-74    
ref|NP_001062173.1|  Os08g0503200                                       251   4e-74    
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    250   7e-74    
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             246   1e-72    
emb|CDY36036.1|  BnaC03g41620D                                          247   2e-72    Brassica napus [oilseed rape]
dbj|BAJ93663.1|  predicted protein                                      243   3e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    242   5e-71    Nelumbo nucifera [Indian lotus]
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     241   1e-70    Eucalyptus grandis [rose gum]
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    241   2e-70    
ref|XP_010488033.1|  PREDICTED: glycerophosphodiester phosphodies...    228   3e-70    
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    240   4e-70    Vitis vinifera
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    240   4e-70    Phoenix dactylifera
emb|CBI18678.3|  unnamed protein product                                239   5e-70    Vitis vinifera
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    243   2e-69    Triticum urartu
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    238   2e-69    Populus euphratica
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    238   2e-69    Morus notabilis
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             238   3e-69    Populus trichocarpa [western balsam poplar]
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    236   5e-69    Arabis alpina [alpine rockcress]
emb|CDY46687.1|  BnaA03g48210D                                          236   7e-69    Brassica napus [oilseed rape]
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    233   7e-69    
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    236   1e-68    Populus euphratica
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420          235   2e-68    Amborella trichopoda
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    234   7e-68    Phoenix dactylifera
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    233   9e-68    Elaeis guineensis
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    233   1e-67    Elaeis guineensis
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             232   2e-67    
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    232   2e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    229   3e-66    Prunus mume [ume]
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...    229   5e-66    
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             228   9e-66    Prunus persica
tpg|DAA47913.1|  TPA: hypothetical protein ZEAMMB73_887943              225   1e-65    
emb|CDX92806.1|  BnaC07g40640D                                          226   2e-65    
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    226   5e-65    
ref|NP_001170117.1|  hypothetical protein                               225   7e-65    Zea mays [maize]
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...    221   9e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010485211.1|  PREDICTED: glycerophosphodiester phosphodies...    218   1e-64    Camelina sativa [gold-of-pleasure]
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...    225   1e-64    
emb|CDY11831.1|  BnaC03g12570D                                          221   2e-64    Brassica napus [oilseed rape]
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          225   3e-64    
gb|AFW70515.1|  hypothetical protein ZEAMMB73_076757                    215   3e-64    
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...    224   4e-64    
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                     220   5e-64    Eucalyptus grandis [rose gum]
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    223   7e-64    Camelina sativa [gold-of-pleasure]
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             223   7e-64    
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    223   1e-63    Pyrus x bretschneideri [bai li]
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                    222   1e-63    
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    222   2e-63    Pyrus x bretschneideri [bai li]
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    221   3e-63    Camelina sativa [gold-of-pleasure]
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     219   3e-63    Eucalyptus grandis [rose gum]
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    221   3e-63    Brassica rapa
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    222   9e-63    
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...    220   1e-62    
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    219   1e-62    Arabidopsis lyrata subsp. lyrata
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        219   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             219   1e-62    Capsella rubella
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    219   1e-62    Arabidopsis lyrata subsp. lyrata
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    222   1e-62    
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    222   1e-62    
emb|CDX88656.1|  BnaA03g09930D                                          219   3e-62    
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          218   4e-62    
emb|CDY43885.1|  BnaC09g33580D                                          218   4e-62    Brassica napus [oilseed rape]
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...    218   5e-62    
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    218   5e-62    Camelina sativa [gold-of-pleasure]
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    218   6e-62    
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...    218   7e-62    Brachypodium distachyon [annual false brome]
emb|CDY02788.1|  BnaC02g11010D                                          217   1e-61    
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    217   1e-61    Brassica rapa
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...    216   1e-61    Zea mays [maize]
ref|XP_007011972.1|  SHV3-like 5                                        216   1e-61    
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        216   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046128.1|  Os02g0187400                                       216   1e-61    
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    216   2e-61    
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...    215   4e-61    Triticum urartu
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    215   5e-61    
dbj|BAK08209.1|  predicted protein                                      215   6e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...    214   9e-61    
emb|CDY12605.1|  BnaA02g12730D                                          213   1e-60    Brassica napus [oilseed rape]
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    212   3e-60    Oryza sativa Japonica Group [Japonica rice]
emb|CDY32730.1|  BnaA02g07920D                                          213   3e-60    
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    213   5e-60    
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    212   5e-60    
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    212   5e-60    
emb|CDY02800.1|  BnaC02g10890D                                          212   7e-60    
gb|EEC72640.1|  hypothetical protein OsI_06154                          213   8e-60    
gb|EEE56466.1|  hypothetical protein OsJ_05675                          212   1e-59    
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    210   2e-59    
emb|CDY32720.1|  BnaA02g07820D                                          210   3e-59    
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    210   3e-59    
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    209   7e-59    
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    209   8e-59    
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    207   1e-58    
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...    207   3e-58    
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...    207   4e-58    
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...    206   8e-58    
emb|CDY60415.1|  BnaC02g45340D                                          207   3e-57    
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             203   4e-57    
gb|EAY86479.1|  hypothetical protein OsI_07859                          204   5e-57    
emb|CDY12600.1|  BnaA02g12680D                                          204   5e-57    
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg                201   5e-56    
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...    200   1e-55    
emb|CDY58867.1|  BnaC09g52640D                                          200   1e-55    
gb|KDP38642.1|  hypothetical protein JCGZ_03995                         198   4e-55    
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...    197   7e-55    
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...    196   2e-54    
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...    196   9e-54    
ref|NP_001062919.2|  Os09g0339800                                       192   2e-53    
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...    193   3e-53    
gb|EPS68532.1|  hypothetical protein M569_06231                         191   9e-53    
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...    194   2e-52    
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    190   3e-52    
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                   189   5e-52    
gb|AFW66253.1|  hypothetical protein ZEAMMB73_246886                    181   4e-51    
gb|EEE53168.1|  hypothetical protein OsJ_36008                          189   7e-51    
emb|CDP10204.1|  unnamed protein product                                186   1e-50    
gb|KJB54927.1|  hypothetical protein B456_009G054700                    184   4e-50    
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...    175   6e-47    
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...    175   9e-47    
gb|KJB62956.1|  hypothetical protein B456_009G445400                    174   1e-46    
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...    173   4e-46    
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...    169   1e-44    
emb|CDY45656.1|  BnaC09g31980D                                          167   4e-44    
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...    167   7e-44    
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    165   1e-43    
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...    163   1e-42    
emb|CDY29432.1|  BnaC05g32380D                                          162   2e-42    
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                    161   5e-42    
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...    162   5e-42    
ref|XP_003610370.1|  GPI-anchored protein                               161   7e-42    
gb|AFW58563.1|  hypothetical protein ZEAMMB73_741781                    152   8e-42    
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g             160   2e-41    
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...    159   6e-41    
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548             158   8e-41    
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...    158   2e-40    
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...    156   5e-40    
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...    155   1e-39    
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702             154   2e-39    
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...    153   5e-39    
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...    147   4e-37    
gb|KHM99501.1|  Putative glycerophosphoryl diester phosphodiester...    140   4e-37    
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...    147   5e-37    
ref|XP_001756342.1|  predicted protein                                  144   9e-36    
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...    141   5e-35    
emb|CDX71386.1|  BnaC04g16210D                                          128   9e-33    
ref|XP_010231120.1|  PREDICTED: glycerophosphodiester phosphodies...    135   1e-32    
ref|XP_004506009.1|  PREDICTED: uncharacterized protein LOC101491157    127   2e-30    
emb|CDY72472.1|  BnaAnng41260D                                          123   2e-29    
ref|XP_010470590.1|  PREDICTED: glycerophosphodiester phosphodies...    113   2e-27    
emb|CDY60410.1|  BnaC02g45300D                                          112   3e-27    
ref|XP_001766682.1|  predicted protein                                  119   4e-27    
emb|CDY12601.1|  BnaA02g12690D                                          111   9e-27    
ref|XP_009127509.1|  PREDICTED: probable glycerophosphoryl dieste...    110   2e-26    
dbj|BAD17454.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    109   4e-26    
ref|XP_010474166.1|  PREDICTED: glycerophosphodiester phosphodies...    112   6e-26    
ref|XP_010422831.1|  PREDICTED: glycerophosphodiester phosphodies...    108   1e-25    
ref|XP_010474169.1|  PREDICTED: glycerophosphodiester phosphodies...    112   3e-25    
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350          110   6e-24    
emb|CDX82243.1|  BnaA03g35780D                                          100   1e-21    
dbj|BAJ92515.1|  predicted protein                                    94.4    1e-19    
gb|EEE69509.1|  hypothetical protein OsJ_28963                        95.1    4e-19    
gb|EEC69228.1|  hypothetical protein OsI_38235                        94.4    3e-18    
emb|CDX86766.1|  BnaA09g21560D                                        89.4    1e-16    
ref|XP_001756508.1|  predicted protein                                89.0    2e-16    
ref|WP_014854494.1|  glycerophosphoryl diester phosphodiesterase      82.0    9e-15    
emb|CDX86765.1|  BnaA09g21550D                                        78.6    2e-14    
ref|WP_044402318.1|  glycerophosphodiester phosphodiesterase          81.3    2e-14    
ref|WP_019341873.1|  glycerophosphoryl diester phosphodiesterase      79.3    6e-14    
ref|WP_044205264.1|  glycerophosphodiester phosphodiesterase          79.0    8e-14    
gb|EDX77851.1|  Glycerophosphoryl diester phosphodiesterase family    78.6    8e-14    
ref|WP_033957837.1|  glycerophosphodiester phosphodiesterase          78.6    1e-13    
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...  78.6    3e-13    
ref|WP_034054955.1|  glycerophosphodiester phosphodiesterase          77.4    4e-13    
ref|WP_022977963.1|  glycerophosphoryl diester phosphodiesterase      77.4    4e-13    
ref|WP_031766932.1|  glycerophosphodiester phosphodiesterase          76.3    6e-13    
ref|WP_003459225.1|  glycerophosphoryl diester phosphodiesterase,...  77.0    6e-13    
ref|WP_034010782.1|  glycerophosphodiester phosphodiesterase          77.0    6e-13    
ref|WP_016252877.1|  glycerophosphoryl diester phosphodiesterase,...  76.6    7e-13    
ref|WP_034012407.1|  glycerophosphodiester phosphodiesterase          76.6    7e-13    
ref|WP_033963224.1|  glycerophosphodiester phosphodiesterase          76.6    8e-13    
ref|WP_043245815.1|  glycerophosphodiester phosphodiesterase          76.6    8e-13    
ref|WP_012703278.1|  glycerophosphoryl diester phosphodiesterase      76.3    9e-13    
ref|WP_034030599.1|  glycerophosphodiester phosphodiesterase          76.3    1e-12    
ref|WP_043490868.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_003118786.1|  glycerophosphoryl diester phosphodiesterase      76.3    1e-12    
ref|WP_043088684.1|  glycerophosphodiester phosphodiesterase          76.3    1e-12    
ref|WP_034064371.1|  glycerophosphodiester phosphodiesterase          76.3    1e-12    
ref|WP_034044126.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_003162104.1|  Glycerophosphoryl diester phosphodiesterase      75.9    1e-12    
ref|WP_038404919.1|  glycerophosphodiester phosphodiesterase          75.5    1e-12    
ref|WP_043105186.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_038836050.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_003110415.1|  glycerophosphoryl diester phosphodiesterase      75.9    1e-12    
ref|WP_023910573.1|  glycerophosphoryl diester phosphodiesterase      75.9    1e-12    
ref|WP_023098349.1|  glycerophosphoryl diester phosphodiesterase,...  75.9    1e-12    
ref|WP_003102904.1|  MULTISPECIES: glycerophosphoryl diester phos...  75.9    1e-12    
ref|WP_033952314.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_033980185.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_031643147.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_043546476.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_033938280.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_034075165.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_033877017.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_031631683.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_025270826.1|  glycerophosphodiester phosphodiesterase          75.9    1e-12    
ref|WP_023436061.1|  glycerophosphoryl diester phosphodiesterase      75.9    1e-12    
ref|WP_034056300.1|  glycerophosphodiester phosphodiesterase          75.9    2e-12    
ref|WP_033939992.1|  glycerophosphodiester phosphodiesterase          75.9    2e-12    
ref|WP_023120153.1|  glycerophosphoryl diester phosphodiesterase,...  75.9    2e-12    
ref|WP_009157090.1|  glycerophosphoryl diester phosphodiesterase      75.5    2e-12    
ref|WP_034070136.1|  glycerophosphodiester phosphodiesterase          75.9    2e-12    
ref|WP_034039869.1|  glycerophosphodiester phosphodiesterase          75.9    2e-12    
ref|WP_033978774.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_015502208.1|  glycerophosphoryl diester phosphodiesterase,...  75.5    2e-12    
ref|WP_043509283.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_024916924.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_019681231.1|  glycerophosphoryl diester phosphodiesterase      75.5    2e-12    
ref|WP_043084709.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_038819922.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_034055661.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_033953535.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_033971799.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_030533632.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_023112648.1|  glycerophosphoryl diester phosphodiesterase,...  75.5    2e-12    
ref|WP_019371365.1|  glycerophosphoryl diester phosphodiesterase      75.5    2e-12    
ref|WP_023109563.1|  glycerophosphoryl diester phosphodiesterase,...  75.5    2e-12    
dbj|BAP77872.1|  glycerophosphoryl diester phosphodiesterase          75.5    2e-12    
ref|WP_003117884.1|  MULTISPECIES: glycerophosphoryl diester phos...  75.5    2e-12    
ref|WP_023114757.1|  glycerophosphoryl diester phosphodiesterase,...  75.5    2e-12    
ref|WP_021204832.1|  glycerophosphoryl diester phosphodiesterase      75.5    2e-12    
ref|WP_039027911.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_033985059.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_033995166.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_031633692.1|  glycerophosphodiester phosphodiesterase          75.5    2e-12    
ref|WP_039504376.1|  glycerophosphodiester phosphodiesterase          75.1    2e-12    
emb|CDM42565.1|  glycerophosphoryl diester phosphodiesterase          75.1    2e-12    
ref|WP_003128915.1|  glycerophosphoryl diester phosphodiesterase      75.1    2e-12    
ref|WP_033939727.1|  glycerophosphodiester phosphodiesterase          75.1    2e-12    
gb|KID29265.1|  glycerophosphoryl diester phosphodiesterase           75.1    2e-12    
ref|WP_003084425.1|  glycerophosphoryl diester phosphodiesterase      75.1    3e-12    
ref|WP_012073960.1|  glycerophosphoryl diester phosphodiesterase      75.1    3e-12    
ref|WP_043103754.1|  glycerophosphodiester phosphodiesterase          75.1    3e-12    
ref|WP_034079258.1|  glycerophosphodiester phosphodiesterase          75.1    3e-12    
ref|WP_029529429.1|  glycerophosphodiester phosphodiesterase          74.7    3e-12    
ref|WP_034046720.1|  glycerophosphodiester phosphodiesterase          75.1    3e-12    
ref|WP_033997966.1|  glycerophosphodiester phosphodiesterase          75.1    3e-12    
ref|WP_025243460.1|  glycerophosphodiester phosphodiesterase          74.7    3e-12    
ref|WP_021218313.1|  glycerophosphoryl diester phosphodiesterase      74.7    4e-12    
ref|WP_016852361.1|  glycerophosphoryl diester phosphodiesterase      74.3    4e-12    
ref|WP_004373908.1|  glycerophosphoryl diester phosphodiesterase      74.3    5e-12    
gb|ABP81641.1|  glycerophosphoryl diester phosphodiesterase, peri...  73.9    5e-12    
ref|WP_012020010.1|  glycerophosphoryl diester phosphodiesterase      73.9    6e-12    
ref|WP_023104689.1|  glycerophosphoryl diester phosphodiesterase,...  73.9    6e-12    
ref|WP_041755838.1|  glycerophosphodiester phosphodiesterase          73.9    7e-12    
ref|WP_024875672.1|  glycerophosphodiester phosphodiesterase          73.9    7e-12    
gb|KFJ92505.1|  glycerophosphodiester phosphodiesterase               73.9    7e-12    
ref|WP_034031580.1|  glycerophosphodiester phosphodiesterase          73.6    8e-12    
ref|WP_031693601.1|  glycerophosphodiester phosphodiesterase          73.6    8e-12    
ref|WP_039801360.1|  glycerophosphodiester phosphodiesterase          73.6    8e-12    
ref|WP_043307997.1|  glycerophosphodiester phosphodiesterase          73.6    8e-12    
ref|WP_042928230.1|  glycerophosphodiester phosphodiesterase          73.2    1e-11    
ref|XP_002978269.1|  hypothetical protein SELMODRAFT_108000           73.2    1e-11    
ref|WP_024309891.1|  glycerophosphodiester phosphodiesterase          73.2    1e-11    
ref|WP_028238381.1|  glycerophosphodiester phosphodiesterase          73.2    1e-11    
ref|WP_020305624.1|  glycerophosphoryl diester phosphodiesterase,...  72.4    2e-11    
ref|WP_043942285.1|  glycerophosphodiester phosphodiesterase          72.4    2e-11    
ref|WP_019406043.1|  glycerophosphoryl diester phosphodiesterase      72.4    2e-11    
ref|WP_037055198.1|  glycerophosphodiester phosphodiesterase          72.0    3e-11    
gb|AEA86024.1|  glycerophosphoryl diester phosphodiesterase, peri...  72.4    3e-11    
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg           72.4    3e-11    
ref|WP_013717585.1|  glycerophosphoryl diester phosphodiesterase      72.0    3e-11    
ref|WP_034264366.1|  glycerophosphodiester phosphodiesterase          71.6    3e-11    
ref|WP_033428338.1|  glycerophosphodiester phosphodiesterase          71.6    3e-11    
ref|WP_041015087.1|  glycerophosphodiester phosphodiesterase          71.6    4e-11    
ref|WP_003286770.1|  glycerophosphoryl diester phosphodiesterase      71.2    4e-11    
ref|WP_017244128.1|  glycerophosphoryl diester phosphodiesterase      71.2    5e-11    
ref|WP_003282807.1|  glycerophosphoryl diester phosphodiesterase      71.2    6e-11    
ref|WP_013984368.1|  glycerophosphoryl diester phosphodiesterase      71.2    6e-11    
gb|KFG07689.1|  glycerophosphodiester phosphodiesterase               71.2    6e-11    
ref|WP_037725639.1|  glycerophosphodiester phosphodiesterase          71.2    6e-11    
ref|WP_033436466.1|  glycerophosphodiester phosphodiesterase          70.9    7e-11    
ref|WP_005466927.1|  glycerophosphoryl diester phosphodiesterase      70.9    7e-11    
ref|WP_008569389.1|  glycerophosphoryl diester phosphodiesterase      70.5    9e-11    
ref|WP_005460366.1|  glycerophosphoryl diester phosphodiesterase      70.5    1e-10    
ref|NP_001036983.1|  glycerophosphoryl diester phosphodiesterase ...  70.5    1e-10    
ref|WP_003297135.1|  glycerophosphoryl diester phosphodiesterase,...  70.5    1e-10    
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...  70.9    1e-10    
ref|WP_003303221.1|  glycerophosphoryl diester phosphodiesterase,...  69.7    1e-10    
emb|CBG74419.1|  putative secreted glycerophosphoryl diester phos...  70.1    1e-10    
ref|XP_002966299.1|  hypothetical protein SELMODRAFT_85502            69.7    1e-10    
ref|WP_041670032.1|  glycerophosphodiester phosphodiesterase          70.1    1e-10    
ref|WP_017363155.1|  glycerophosphoryl diester phosphodiesterase      69.7    2e-10    
ref|WP_021206089.1|  glycerophosphoryl diester phosphodiesterase      69.3    2e-10    
ref|WP_041980281.1|  glycerophosphodiester phosphodiesterase          69.7    2e-10    
ref|WP_043295311.1|  glycerophosphodiester phosphodiesterase          69.3    2e-10    
ref|WP_038656067.1|  glycerophosphodiester phosphodiesterase          69.3    2e-10    
ref|WP_010045171.1|  glycerophosphoryl diester phosphodiesterase      69.7    2e-10    
ref|WP_031114738.1|  glycerophosphodiester phosphodiesterase          69.3    2e-10    
ref|WP_037760629.1|  glycerophosphodiester phosphodiesterase          69.3    2e-10    
ref|WP_015275240.1|  glycerophosphoryl diester phosphodiesterase      69.3    2e-10    
ref|XP_002466838.1|  hypothetical protein SORBIDRAFT_01g015000        68.9    3e-10    



>ref|XP_009798152.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=391

 Score =   362 bits (928),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 201/237 (85%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY  A  TSL NVI WCDVQLTKDGVGIC PD+KLDNAS++   FK+
Sbjct  59   GGFSGLFPDSSYDAYMVAMETSLANVIAWCDVQLTKDGVGICLPDLKLDNASDIDVYFKN  118

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K++ Y VNGVP   WF IDFNFK L  V L+QGV+SR+ +FDGT Q+ILTV DV NKV+P
Sbjct  119  KETKYSVNGVPMQGWFSIDFNFKDLAPVTLRQGVFSRTPKFDGTQQKILTVLDVVNKVKP  178

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F+SQHNLSMR+F++S+SR V++NYISSPEVNFLKSI SR NP VTKLVF
Sbjct  179  PGLWLNIQHDTFFSQHNLSMRSFIISLSRSVIVNYISSPEVNFLKSIVSRFNPLVTKLVF  238

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  + EPSTNQTYGSLL+NL  IKTFASGILVPK+YIWPVD +S YLQP TSLV
Sbjct  239  RFLGQGDIEPSTNQTYGSLLKNLTFIKTFASGILVPKTYIWPVD-NSLYLQPHTSLV  294



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 200/237 (84%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSSFNAY+ A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+
Sbjct  46   GGFSGLMPDSSFNAYTLASTISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVDVLFKN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            KQ+TYLVNGVP   WF +DFNFK L LV L+QGV+SRS RFDGTPQ ILTV+DV  +V+P
Sbjct  106  KQNTYLVNGVPQKGWFSVDFNFKDLALVTLKQGVFSRSPRFDGTPQSILTVQDVDTQVKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHDSFYSQHNLSMR+FV+S+SR V+INYISSPEVNFL+SIA R NPRVTK VF
Sbjct  166  PGLWLNIQHDSFYSQHNLSMRSFVVSLSRSVIINYISSPEVNFLRSIARRFNPRVTKFVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  DE EPSTNQTY SLL+NL  +KTFASGILVPK YIWPVD +S YLQP TS+V
Sbjct  226  RFLSEDEFEPSTNQTYSSLLKNLTFVKTFASGILVPKHYIWPVD-NSLYLQPHTSVV  281



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 202/237 (85%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSSFNAY  A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+
Sbjct  46   GGFSGLMPDSSFNAYILAKAISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVNVLFKN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            KQ+TYLVNGVP   WF +DFNFK L LV+L+QGV+SRS RFDGTPQQILTV+DV ++V+P
Sbjct  106  KQNTYLVNGVPQKGWFSVDFNFKDLALVSLKQGVFSRSPRFDGTPQQILTVQDVASQVKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHDSFYSQ NLS+R+FV+S+SR V++NYISSPEVNFL+SIA R NPRVTK VF
Sbjct  166  PGLWLNIQHDSFYSQRNLSIRSFVVSLSRSVIVNYISSPEVNFLRSIARRFNPRVTKFVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D  EPSTNQTYGSLL+NL  +KTFASGILVPK YIWPVD +S YLQP TS+V
Sbjct  226  RFLGEDGIEPSTNQTYGSLLKNLTFVKTFASGILVPKHYIWPVD-NSLYLQPHTSVV  281



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 206/237 (87%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS++AY  A  TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+
Sbjct  45   GGFSGLLPDSSYDAYIMALETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKN  104

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+S YLVNGVPT  WF ID+NFK L  V L+QGVYSR+SRFDGT Q ILTV+DV N+V+P
Sbjct  105  KKSKYLVNGVPTQGWFSIDYNFKDLAPVTLKQGVYSRTSRFDGTQQSILTVQDVVNQVKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F+SQHNLSMR++++S+SR V+INYISSPEVNFL+SI +R+N RVTKLVF
Sbjct  165  PGLWLNIQHDNFFSQHNLSMRSYIISLSRSVLINYISSPEVNFLRSILARLNSRVTKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG ++ EPSTNQTYGSLL+NL  IKTF+SGILVPKSYIWPVD +S YLQP TSLV
Sbjct  225  RFLGQNDVEPSTNQTYGSLLKNLTFIKTFSSGILVPKSYIWPVD-NSFYLQPYTSLV  280



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/237 (73%), Positives = 201/237 (85%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY  A  TSL NVI WCDVQLTKDGVGIC PD+KLDNAS++   FK+
Sbjct  34   GGFSGLFPDSSYDAYMVAMETSLANVIAWCDVQLTKDGVGICLPDLKLDNASDIDVYFKN  93

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+S Y VNGVP   WF IDFNFK L  V L+QGV SR+ +FDGT Q+ILTV DV NKV+P
Sbjct  94   KKSKYSVNGVPMQGWFSIDFNFKDLAPVTLRQGVLSRTPKFDGTQQKILTVLDVINKVKP  153

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F+SQHNLSMR+F++++SR V+INYISSPEVNFL+SI +R +P+VTKLVF
Sbjct  154  PGLWLNIQHDTFFSQHNLSMRSFIITLSRSVIINYISSPEVNFLRSIVARFDPQVTKLVF  213

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D+ EPSTNQTYGSLL+NL  I TFASGILVPKSYIWPVD +S YLQP TSLV
Sbjct  214  RFLGQDDVEPSTNQTYGSLLKNLTFINTFASGILVPKSYIWPVD-NSLYLQPHTSLV  269



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/237 (73%), Positives = 203/237 (86%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS++AY     TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+
Sbjct  43   GGFSGLLPDSSYDAYIMGLETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+S YLVNGVPT  WF ID+N K L  V L+QGVYSR+ RFDG+ Q ILTV+DV N+V+P
Sbjct  103  KKSKYLVNGVPTQGWFSIDYNLKDLVHVTLKQGVYSRTQRFDGSQQSILTVQDVVNQVKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG WLN+QHD+F+SQHNLSM+++++S++R V+INYISSPEVNFL+SI SR+NPRVTKLVF
Sbjct  163  PGFWLNIQHDNFFSQHNLSMKSYIISLTRGVLINYISSPEVNFLRSILSRLNPRVTKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D+ EPSTNQTYGSLL+NL  IKTFASGILVPKSYIWPVD +S YLQP TSLV
Sbjct  223  RFLGQDDVEPSTNQTYGSLLKNLTFIKTFASGILVPKSYIWPVD-NSLYLQPYTSLV  278



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 201/237 (85%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS+NAY  A   SL + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ +
Sbjct  46   GGFSGLLPDSSYNAYLLAQAISLADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYLN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + + Y VNG+P T WF IDFN K L  V+L+QGVYSRS RFDGTPQQILTV+DV  +V+P
Sbjct  106  RNNNYSVNGIPQTGWFSIDFNIKDLAPVSLKQGVYSRSPRFDGTPQQILTVQDVATQVKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHDSFYSQHNLSMR+FV+S+SR V+ NYISSPEVNFL+SIASR+NPRVTK VF
Sbjct  166  PGLWLNIQHDSFYSQHNLSMRSFVISLSRSVIANYISSPEVNFLRSIASRLNPRVTKRVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ EPST+QTYGSL++NL  IKTFA+GILVPK YIWP+D SS YLQP TS+V
Sbjct  226  RFLNEDDIEPSTSQTYGSLVKNLTFIKTFAAGILVPKHYIWPMD-SSLYLQPHTSVV  281



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   357 bits (916),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 199/237 (84%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSSFNAY  A   S  + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ +
Sbjct  46   GGFSGLLPDSSFNAYMLAQAISSADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYPN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + + Y VNG+P T WF IDF+ K L  V+L+QGVYSRS RFDGTPQQILTV+DV  +V+P
Sbjct  106  RNNNYSVNGIPQTGWFSIDFSIKDLAPVSLKQGVYSRSPRFDGTPQQILTVQDVATQVKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHDSFYSQHNLSMR+FV+S+SR V+ NYISSPEVNFL+SIASR+NPRVTK VF
Sbjct  166  PGLWLNIQHDSFYSQHNLSMRSFVVSLSRSVIANYISSPEVNFLRSIASRLNPRVTKRVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ EPST+QTYGSL++NL  +KTFA+GILVPK YIWP D SS YLQP TS+V
Sbjct  226  RFLNEDDIEPSTSQTYGSLVKNLTFVKTFAAGILVPKHYIWPTD-SSLYLQPHTSVV  281



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 192/237 (81%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS   +TS  +VI+WCDVQLTKD  GICFPD+KLDNASN+A +FK 
Sbjct  51   GGFSGIFPDSSSIAYSLTLITSAPSVILWCDVQLTKDEAGICFPDLKLDNASNIAQIFKT  110

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q  YLVNGVPT  WF ID+    L+ + L QGVYSR+ +FDG   QILTV+ +  +++P
Sbjct  111  QQKNYLVNGVPTPGWFSIDYTLNDLSNIILNQGVYSRTDKFDGNVLQILTVQGMARQIKP  170

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+FY+QHNLSMR+FVLSV R VV+NYISSPEVNFL+SIA+R  P +TKLVF
Sbjct  171  PGLWLNIQHDAFYAQHNLSMRSFVLSVYRSVVVNYISSPEVNFLRSIAARFRPSMTKLVF  230

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  E EP+TNQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++V
Sbjct  231  RFLGKSEIEPTTNQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIV  286



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/237 (71%), Positives = 198/237 (84%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS+NAY  A  TSL+++++WCDVQLTKD  GICFPD+KLDNAS+V  +F +
Sbjct  44   GGFSGLFPDSSYNAYVLAVGTSLSDLVLWCDVQLTKDAAGICFPDLKLDNASDVNVVFNN  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + STY+V+GV T  WF ID+N K L LV+L+Q +YSR++RFDGT QQILTV+DV  +VQP
Sbjct  104  RASTYIVSGVSTRGWFSIDYNLKDLRLVSLKQRIYSRTNRFDGT-QQILTVDDVATQVQP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              LWLNVQHD+FYSQHNLSMR++V+SVSR VV+NYISSPEVNFLKSIA+R  P VTKLVF
Sbjct  163  SALWLNVQHDAFYSQHNLSMRSYVISVSRSVVVNYISSPEVNFLKSIAARFRPSVTKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  + EPSTNQTY SL +NL  IKTFASGILVPK YIWPVD SS YL P TS+V
Sbjct  223  RFLGPADIEPSTNQTYSSLQKNLTFIKTFASGILVPKYYIWPVDSSSQYLLPHTSIV  279



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 192/238 (81%), Gaps = 1/238 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F++
Sbjct  49   GGFSGIFPDSSEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            +  TY VNGV T+A+F +DF F++L + V L QG ++RS +FD    QILTV D+     
Sbjct  109  RSKTYSVNGVQTSAYFAVDFTFEELYSKVFLVQGDFTRSDKFDNNLFQILTVNDLVKNEA  168

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPGLWLN+QHD+FY QHNLSM+ FVLSVSR V +NYISSPE  FL++I +RINPR+TKLV
Sbjct  169  PPGLWLNIQHDAFYEQHNLSMKNFVLSVSRTVNVNYISSPEAGFLRTIRARINPRITKLV  228

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  DE +PSTNQTYGSLL+NLASIKTFASGILVPK YIWP+D SS YL P TSLV
Sbjct  229  FRFLEKDEVDPSTNQTYGSLLKNLASIKTFASGILVPKGYIWPIDPSSLYLLPHTSLV  286



>gb|KDO62177.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
 gb|KDO62178.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=504

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 194/237 (82%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS   +TS  +VI+WCDVQLTKD  GICFPD+KLDNASN+A +FK 
Sbjct  98   GGFSGIFPDSSSIAYSLTLITSAPSVILWCDVQLTKDEAGICFPDLKLDNASNIAQIFKT  157

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q  YLVNGVPT  WF ID+    L+ + L QGVYSR+ +FDG   QILTV+D+  +++P
Sbjct  158  QQKNYLVNGVPTPGWFSIDYTLNDLSNIILNQGVYSRTDKFDGNGFQILTVQDMARQIKP  217

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+FY+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVF
Sbjct  218  PGLWLNIQHDAFYAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVF  277

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  E EP+TNQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++V
Sbjct  278  RFLGKSEIEPTTNQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIV  333



>ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
 gb|EEE85158.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
Length=495

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 192/237 (81%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ FA LTSL +V++WCDVQLTKDGVGIC PD++LDN++++A + K+
Sbjct  47   GGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLTKDGVGICAPDLRLDNSTSIAQVMKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNG+PT  WF +DF   +L+LV L QG+YSRS RFD T   I TVEDV N ++P
Sbjct  107  KDKLYLVNGIPTRGWFTVDFTLNELSLVFLAQGIYSRSERFDNT-YPIQTVEDVAN-LKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F++QHNLSMR +VLS+SRRVVIN++SSPE  FL+SI  R N  +TKLVF
Sbjct  165  PGLWLNIQHDAFFTQHNLSMRIYVLSLSRRVVINHLSSPEAGFLRSIVKRFNLNITKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +  EPSTN+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YLQP TS+V
Sbjct  225  RFLEPNVIEPSTNETYGSLSKNFTFIKTFASGILIPKSYIWPLD-ASNYLQPQTSIV  280



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   326 bits (836),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 190/237 (80%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS+ AYSFA +TSL  V++WCDVQLTKD  GIC PDIKLDN++++A +F +
Sbjct  45   GGFSGLFPDSSYAAYSFAIMTSLPEVVLWCDVQLTKDSKGICLPDIKLDNSTDIADVFNN  104

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +   Y++NGV T  WF +DF   +L+ V + QG+YSRS++FDG    ILT EDV  +++P
Sbjct  105  RDKEYVINGVATKGWFSLDFTSSELSNVIVSQGIYSRSNKFDGNLFPILTAEDVSKQLKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQHD+F++QH L+MR++VL++S+ +++NYISSPEV FL  I SR N + TKLVF
Sbjct  165  AGLWLNVQHDAFFTQHKLNMRSYVLNISKHIIVNYISSPEVAFLNGIKSRFNQKTTKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DET+PSTNQTYGSLL+NL  IKTFASGILVPK YIWPVD   SYLQP TSLV
Sbjct  225  RFLGKDETDPSTNQTYGSLLKNLTYIKTFASGILVPKIYIWPVDP-KSYLQPHTSLV  280



>gb|KDO62176.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=667

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 194/237 (82%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS   +TS  +VI+WCDVQLTKD  GICFPD+KLDNASN+A +FK 
Sbjct  98   GGFSGIFPDSSSIAYSLTLITSAPSVILWCDVQLTKDEAGICFPDLKLDNASNIAQIFKT  157

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q  YLVNGVPT  WF ID+    L+ + L QGVYSR+ +FDG   QILTV+D+  +++P
Sbjct  158  QQKNYLVNGVPTPGWFSIDYTLNDLSNIILNQGVYSRTDKFDGNGFQILTVQDMARQIKP  217

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+FY+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVF
Sbjct  218  PGLWLNIQHDAFYAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVF  277

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  E EP+TNQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++V
Sbjct  278  RFLGKSEIEPTTNQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIV  333



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 192/237 (81%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSSF AYS A  TSLTNV +WCDVQLTKDG GICFPDI+L+N+S++  ++K+
Sbjct  49   GGFSGIFPDSSFYAYSLAVQTSLTNVHVWCDVQLTKDGAGICFPDIRLENSSDIDNVYKN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             ++TY+VNGV T  WF +DF    L  VNL+Q +++R+  FDGTP QILTV+DV ++V+P
Sbjct  109  GRNTYVVNGVSTQGWFSVDFTLNDLAPVNLKQRIFTRAPNFDGTPMQILTVDDVVSQVKP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+ HD+F+SQHNLSMR+F+LSVSRRV++NY+SSPEV FL+SI SR     TKLVF
Sbjct  169  PALWLNIPHDAFFSQHNLSMRSFILSVSRRVIVNYVSSPEVGFLRSIVSRFRTGPTKLVF  228

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG D+ EP+TN TYG+LL NL  IKTFASGILVPK YIWPVD +S YL   TSLV
Sbjct  229  QFLGPDDVEPTTNSTYGTLLNNLTFIKTFASGILVPKYYIWPVD-NSQYLLNYTSLV  284



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 191/238 (80%), Gaps = 1/238 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F++
Sbjct  49   GGFSGIFPDSSEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            +  TY VNGV T+A+F +DF F++L + V L QG ++RS +FD    QILTV D+     
Sbjct  109  RSKTYSVNGVQTSAYFAVDFTFEELYSKVFLVQGDFTRSDKFDNNLFQILTVNDLVKNES  168

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPGLWLN+QHD+FY QHNLSM+ FVLSVSR V +NYISSPE  FL++I + INPR+TKLV
Sbjct  169  PPGLWLNIQHDAFYEQHNLSMKNFVLSVSRTVNVNYISSPEAGFLRTIRAHINPRITKLV  228

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  DE +PSTNQTYGSLL+NLASIKTF+SGILVPK YIWP+D SS YL P TSLV
Sbjct  229  FRFLKKDEVDPSTNQTYGSLLKNLASIKTFSSGILVPKGYIWPIDPSSLYLLPHTSLV  286



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 194/237 (82%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS   +TS  +VI+WCDVQLTKD  GICFPD+KLDNASN+A +FK 
Sbjct  98   GGFSGIFPDSSSIAYSLTLITSAPSVILWCDVQLTKDEAGICFPDLKLDNASNIAQIFKT  157

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q  YLVNGVPT  WF ID+    L+ + L QGVYSR+ +FDG   QILTV+D+  +++P
Sbjct  158  QQKNYLVNGVPTPGWFSIDYTLNDLSNIILNQGVYSRTDKFDGNGFQILTVQDMARQIKP  217

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+FY+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVF
Sbjct  218  PGLWLNIQHDAFYAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVF  277

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  E EP+TNQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++V
Sbjct  278  RFLGKSEIEPTTNQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIV  333



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   323 bits (828),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 190/237 (80%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS+ AYS A +TSL+NVI+WCDVQLTKD VGICFPD+KLDN+S++A +FK+
Sbjct  47   GGFSGLFPDSSYAAYSLANMTSLSNVILWCDVQLTKDAVGICFPDLKLDNSSDIANVFKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
              + YLVNG     +FP+D+    L  V L QG+YSR+ +FDG    IL VE++   ++P
Sbjct  107  -STVYLVNGQLMKGYFPVDYTLNDLANVYLTQGIYSRTDKFDGNLFSILRVEEL-ASLRP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+FY+QHNLSMR+FVLSVSRRV++NYISSPEV FL SIA+R     TKLVF
Sbjct  165  PGLWLNIQHDAFYTQHNLSMRSFVLSVSRRVIVNYISSPEVAFLSSIAARFRRSTTKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D+ EPSTNQTYGSLLQNL  +K FASGILVPK+ IWPV  SS YLQP TS+V
Sbjct  225  RFLGADDIEPSTNQTYGSLLQNLTFVKAFASGILVPKTSIWPV-TSSLYLQPPTSVV  280



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   323 bits (828),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 190/239 (79%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSSF AYS A LTSL +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++KD
Sbjct  49   GGFSGIFADSSFGAYSLALLTSLPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAVVYKD  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q TYLVNGV T  WF IDF  ++L  V L QGVYSR+++FDG    I+TV++ + ++ P
Sbjct  109  RQKTYLVNGVSTKGWFSIDFTLRELGNVILNQGVYSRTNKFDGNSYPIMTVQETYAQLNP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVS--RRVVINYISSPEVNFLKSIASRINPRVTKL  535
            P  WLN+QHD+FY+QHNLSMR+FVLSV+  R V I+YISSPEV FL++IA       T L
Sbjct  169  PRFWLNIQHDAFYTQHNLSMRSFVLSVTRNRNVTIDYISSPEVAFLQNIAPSFQRSATNL  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFLG ++ EPSTNQTYGSLL+N+  IKTFASGI+VPKSYIWPVDK   YL P+TSLV
Sbjct  229  VFRFLGQNDVEPSTNQTYGSLLKNITFIKTFASGIIVPKSYIWPVDK-DLYLLPSTSLV  286



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 189/237 (80%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AYS A +TSL+NV++WCDVQLTKDG GICFPD+KL+NAS+++ +FK+
Sbjct  45   GGFSGLFPDSSSAAYSLALMTSLSNVVLWCDVQLTKDGAGICFPDMKLENASDISIVFKN  104

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + + YLVNGV T  WF +DF    L  V L QGVYSRS RFDG    ILTV+++   ++P
Sbjct  105  RNNVYLVNGVSTPGWFSVDFTLTDLETVALNQGVYSRSGRFDGNLFPILTVQEMVKLIRP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD FY++HNLSMR FVLSVS+ V+++YISSPEV FL+ ++ R     TKL+F
Sbjct  165  PGLWLNLQHDVFYTKHNLSMRNFVLSVSKSVIVDYISSPEVAFLRGVSQRFKATKTKLIF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +ET+PSTNQTYGSLL NL  IKTFASGILVPK YIWPV+K +SYL+ +T +V
Sbjct  225  RFLEKEETDPSTNQTYGSLLNNLTFIKTFASGILVPKGYIWPVNK-NSYLESSTLVV  280



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 194/237 (82%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS   +TS  +VI+WCDVQLTKD  GICFPD+KLDNASN+A +FK 
Sbjct  51   GGFSGIFPDSSSIAYSLTLITSAPSVILWCDVQLTKDEAGICFPDLKLDNASNIAQIFKT  110

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q  YLVNGVPT  WF ID+    L+ + L QGVYSR+ +FDG   QILTV+D+  +++P
Sbjct  111  QQKNYLVNGVPTPGWFSIDYTLNDLSNIILNQGVYSRTDKFDGNVFQILTVQDMARQIKP  170

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+FY+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVF
Sbjct  171  PGLWLNIQHDAFYAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVF  230

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  E EP+TNQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++V
Sbjct  231  RFLGKSEIEPTTNQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIV  286



>emb|CAN61355.1| hypothetical protein VITISV_027762 [Vitis vinifera]
Length=642

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 188/237 (79%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AYS A +TSL+NV++WCDVQL+KDG GICFPD+KL+NAS+++ +FK+
Sbjct  45   GGFSGLFPDSSSAAYSLALMTSLSNVVLWCDVQLSKDGAGICFPDMKLENASDISIVFKN  104

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + + YLVNGV T  WF +DF    L  V L QGVYSRS +FDG    ILTV+++    +P
Sbjct  105  RNNVYLVNGVSTPGWFSVDFTLTDLETVALNQGVYSRSGKFDGNLFPILTVQEMVKLTRP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD FY++HNLSMR FVLSVS+ V+++YISSPEV FL+ ++ R     TKL+F
Sbjct  165  PGLWLNLQHDVFYTKHNLSMRNFVLSVSKSVIVDYISSPEVAFLRGVSQRFKATKTKLIF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +ET+PSTNQTYGSLL NL  IKTFASGILVPK YIWPV+K +SYL+ +T +V
Sbjct  225  RFLEKEETDPSTNQTYGSLLNNLTFIKTFASGILVPKGYIWPVNK-NSYLESSTLVV  280



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   323 bits (828),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 194/237 (82%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS   +TS  +VI+WCDVQLTKD  GICFPD+KLDNASN+A +FK 
Sbjct  98   GGFSGIFPDSSSIAYSLTLITSAPSVILWCDVQLTKDEAGICFPDLKLDNASNIAQIFKT  157

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q  YLVNGVPT  WF ID+    L+ + L QGVYSR+ +FDG   QILTV+D+  +++P
Sbjct  158  QQKNYLVNGVPTPGWFSIDYTLNDLSNIILNQGVYSRTDKFDGNGFQILTVQDMARQIKP  217

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+FY+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVF
Sbjct  218  PGLWLNIQHDAFYAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVF  277

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG  E EP+TNQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++V
Sbjct  278  RFLGKSEIEPTTNQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIV  333



>ref|XP_008364336.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=549

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 185/237 (78%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A+S A +TS+ + ++WCDVQLTKD  GICFPD+ L+N SN+  +   
Sbjct  43   GGFSGLFPGYSSAAFSLALITSVQDAVLWCDVQLTKDXAGICFPDLLLNNNSNIDMVLPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K  +YLVNGVPT  WF +D+    L  + + QG+YSR++RFDG    IL +EDV  +++P
Sbjct  103  KDKSYLVNGVPTKGWFTVDYTLDDLASIYVTQGIYSRTNRFDGNLYPILLIEDVATQIKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+QHD F+SQHNLSMR +VLSVS++VVINYISSPEV FL SI +R++P  TKLVF
Sbjct  163  PSLWLNIQHDIFFSQHNLSMRNYVLSVSKQVVINYISSPEVAFLNSIKARVSPSATKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DETEPSTNQTYGSLL+NL  IKTFASGIL+PK+YIWPV K  +YL+P TS+V
Sbjct  223  RFLGQDETEPSTNQTYGSLLKNLTFIKTFASGILIPKTYIWPVTK-DNYLEPHTSVV  278



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   321 bits (823),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 184/237 (78%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A+S A LTSL + ++WCDVQLTKDG GICFPD+ L+N SN+  +   
Sbjct  43   GGFSGLFPGYSSAAFSLALLTSLQDAVLWCDVQLTKDGAGICFPDLLLNNNSNIDMVLPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +  +YLVNGVPT  WF +DF    L  V++ QG+YSR++RFDG    IL +EDV  + +P
Sbjct  103  RDKSYLVNGVPTKGWFTVDFTLDDLASVSVTQGIYSRTNRFDGNQYPILLIEDVATQFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD F+SQHNLSMR +VLSVS++VVINYISSPEV FL SI +R++P  TKLVF
Sbjct  163  PGLWLNIQHDIFFSQHNLSMRKYVLSVSKQVVINYISSPEVAFLNSIKARVSPSATKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DETEPSTNQTYGSLL+NL  IKTFASGIL+PK YIWP  K  +YL+P T +V
Sbjct  223  RFLGQDETEPSTNQTYGSLLKNLTFIKTFASGILIPKIYIWPFTK-DNYLEPHTPVV  278



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   322 bits (824),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 193/237 (81%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY  A +T + ++I+WCDVQLTKDGVGIC PD++LDN+++++ +FK+
Sbjct  57   GGFSGIFPDSSSAAYQLALITGVPDLILWCDVQLTKDGVGICAPDLRLDNSTDISLVFKN  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNG PT  WF +DF F  L+ V L QGVYSRS++FDG    I TVE+V   ++P
Sbjct  117  KDKNYLVNGAPTQGWFSVDFTFNDLSSVVLTQGVYSRSNKFDGNLFPIQTVENV-TGLKP  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLN+QHD+F++QHNLSMR++VLS+S++VVINYISSPE+ FL+ IASR NP+VTKLVF
Sbjct  176  PSIWLNIQHDAFFTQHNLSMRSYVLSLSKKVVINYISSPEMAFLRGIASRFNPKVTKLVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG +E EPSTNQTY +L +NL  IKTFASGIL+PK YIWPVD +S YLQP TS+V
Sbjct  236  RFLGPNEIEPSTNQTYSALSKNLTFIKTFASGILIPKGYIWPVD-ASLYLQPHTSVV  291



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 184/237 (78%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A++ A LTSL + ++WCDVQLTKDG GICFPD+ L+N SN+  +   
Sbjct  43   GGFSGLFPGYSSAAFNLALLTSLQDAVLWCDVQLTKDGAGICFPDLLLNNNSNIDMVLPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +  +YLVNGVPT  WF +DF    L  V++ QG+YSR++RFDG    IL +EDV  + +P
Sbjct  103  RDKSYLVNGVPTKGWFTVDFTLDDLASVSVTQGIYSRTNRFDGNQYPILLIEDVATQFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD F+SQHNLSMR +VLSVS++VVINYISSPEV FL SI +R++P  TKLVF
Sbjct  163  PGLWLNIQHDIFFSQHNLSMRKYVLSVSKQVVINYISSPEVAFLNSIKARVSPSATKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DETEPSTNQTYGSLL+NL  IKTFASGIL+PK YIWP  K  +YL+P T +V
Sbjct  223  RFLGQDETEPSTNQTYGSLLKNLTFIKTFASGILIPKIYIWPFTK-DNYLEPHTPVV  278



>ref|XP_009364631.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
 ref|XP_009364652.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
Length=447

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 188/237 (79%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A+  A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   
Sbjct  43   GGFSGLFPGFSSAAFDLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINDVLPQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+ TYLVNGV T  WF +D+ +  L  +++ QG+YSRS+RFDG P  IL VEDV  + +P
Sbjct  103  KEKTYLVNGVSTKGWFTVDYTWDGLVNISVTQGIYSRSNRFDGNPYPILLVEDVATQFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD F++QHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVF
Sbjct  163  PGLWLNIQHDIFFAQHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  DETEPSTNQTYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+V
Sbjct  223  RFLAQDETEPSTNQTYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVV  278



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   318 bits (815),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 192/237 (81%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ FA LTSL +V++WCDVQLTKDGVGIC PD++LDN++++A + K+
Sbjct  47   GGFSGLFPDSSSAAFQFAPLTSLPDVVLWCDVQLTKDGVGICAPDLRLDNSTSIAQVMKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNGVPT  WF +DF   +L+LV+L QG+YSRS RFD +   I TVEDV N ++P
Sbjct  107  KDKLYLVNGVPTRGWFTVDFTLNELSLVSLTQGIYSRSERFDNS-YPIQTVEDVAN-LKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F+ QHNLSMR+++LS+SRRVVIN++SSPE  FL+SI  R N  +TKLVF
Sbjct  165  PGLWLNIQHDAFFKQHNLSMRSYILSLSRRVVINHLSSPEAGFLRSIVKRFNLNITKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +  EPSTN+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YL P TS+V
Sbjct  225  RFLEPNVIEPSTNETYGSLSRNFTFIKTFASGILIPKSYIWPLD-ASNYLLPHTSIV  280



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 189/237 (80%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS+ AYS A +TS+ +V+ WCDVQLTKDG GIC P +KLDN+++++ +FKD
Sbjct  38   GGFSGIFPDSSYAAYSLALITSVPDVVSWCDVQLTKDGAGICAPSVKLDNSTDISNIFKD  97

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +  TY VNG+ T  WF IDF    L  V L QG+YSR+++FDG    ILTV+D+ ++V+P
Sbjct  98   QSRTYSVNGMDTQGWFSIDFTLNDLANVVLTQGIYSRTNKFDGNLFPILTVQDMVSQVKP  157

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+QHD F++QHNLSMR+FV++ S+ V+I+YISSPEV+FL+SIA R++P  TKL+F
Sbjct  158  PALWLNIQHDMFFTQHNLSMRSFVIATSKSVIIDYISSPEVDFLRSIAGRVSPTKTKLIF  217

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RF+G D  EPS NQTYGSL +NL  +KTFASGILVPK YIWPVD  S+YLQ  TSLV
Sbjct  218  RFMGKDVLEPSINQTYGSLSKNLTFVKTFASGILVPKVYIWPVD-GSNYLQAHTSLV  273



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   316 bits (809),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 191/237 (81%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ FA LTSL +V++WCDVQLTKDGVGIC PD++LDN++++A + K+
Sbjct  47   GGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLTKDGVGICAPDLRLDNSTSIAQVMKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNGVPT  WF +DF   +L+LV L QG+YSRS RFD +   I TVEDV N ++P
Sbjct  107  KDKLYLVNGVPTRGWFTVDFTLNELSLVFLTQGIYSRSERFDNS-YPIQTVEDVAN-LKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F+ QHNLSMR+++LS+SRRVVIN++SSPE  FL+SI  R N  +TKLVF
Sbjct  165  PGLWLNIQHDAFFKQHNLSMRSYILSLSRRVVINHLSSPEAGFLRSIVKRFNLNITKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +  EPSTN+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YL P TS+V
Sbjct  225  RFLEPNVIEPSTNETYGSLSRNFTFIKTFASGILIPKSYIWPLD-ASNYLLPHTSIV  280



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   316 bits (809),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 193/238 (81%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV-ATLFK  178
            GGFSGLFPDSS  AY+FA + S+ +VI+WCDVQLTKDGVGIC PD++LDNA++   TL K
Sbjct  48   GGFSGLFPDSSGVAYNFAVMVSVPDVILWCDVQLTKDGVGICLPDLRLDNATDAPTTLGK  107

Query  179  DKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++ S+YLVNGV T+  F +DF+FK+L  V+L QG+YSRS++FDG    ILT EDV N+ +
Sbjct  108  NRTSSYLVNGVRTSGLFTVDFDFKELENVSLVQGIYSRSTKFDGNQFVILTAEDVANQFK  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPG WLN+QHD F++QHN SMR FVLSV+RR+V+NYISSPEV FL+SIA+R+ PR TKL+
Sbjct  168  PPGFWLNIQHDVFFTQHNASMRNFVLSVTRRIVVNYISSPEVGFLRSIAARV-PRTTKLI  226

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             RFLG  +TE +TNQTYGSLL+NL  IKTFASGILVPK+YIWP+  +  Y+Q  T LV
Sbjct  227  LRFLGPTDTEITTNQTYGSLLRNLTFIKTFASGILVPKTYIWPM-GTDGYVQAQTPLV  283



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 188/239 (79%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSSF AYS A LTS  +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++K+
Sbjct  49   GGFSGIFADSSFGAYSLALLTSPPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAIVYKN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q TYLVNGV T  WF IDF  ++L  V L QGVYSR+++FDG    I+TV+D + ++ P
Sbjct  109  RQKTYLVNGVSTKGWFSIDFTLRELGNVILSQGVYSRTNKFDGNNYPIMTVQDTYAQLNP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVS--RRVVINYISSPEVNFLKSIASRINPRVTKL  535
            P  WLN+QHD+FY+QHNLSMR+FVLS++  R V I+YISSPEV FL++IA       T L
Sbjct  169  PRFWLNIQHDAFYTQHNLSMRSFVLSITRNRNVTIDYISSPEVAFLQNIAPSFRRSATNL  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFLG ++ EPSTNQTYGSLL+N+  IKTFA GI+VPKSYIWPVDK   YL P+TSLV
Sbjct  229  VFRFLGQNDVEPSTNQTYGSLLKNITFIKTFAFGIIVPKSYIWPVDK-DLYLLPSTSLV  286



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 184/237 (78%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A+S A +TS+ +V++WCDVQLTKD  GICFPDI L+N S+V  +F  
Sbjct  46   GGFSGLFPGFSSAAFSLALITSVPDVVLWCDVQLTKDEAGICFPDILLNNNSDVQDVFAK  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K  TYLVNG  T  WF +D+    L  V + QG+YSR+++FDG    ILTVEDV  +++P
Sbjct  106  KDKTYLVNGASTHGWFSVDYTLNDLANVFVTQGIYSRTNKFDGNLYPILTVEDVATQLKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLNVQHD F+SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI +R++P  TKLVF
Sbjct  166  PGLWLNVQHDIFFSQHNLSMRNYVLSVSRKVVVNYISSPEVAFLNSIKARVSPSATKLVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D+TEPST Q YGSLL+NL  IKTFASGIL+PK+YIWPV  +  YL+P TS+V
Sbjct  226  RFLGQDDTEPSTKQNYGSLLKNLTYIKTFASGILIPKTYIWPV-TTDLYLEPHTSIV  281



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 185/239 (77%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSS  AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +
Sbjct  17   GGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPN  76

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            KQ TYLVNGV T  WF +D+  K +  V L QGV+SRS++FDG    I+TV D +  ++P
Sbjct  77   KQKTYLVNGVATKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGNNYPIMTVADTYTLLKP  136

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKL  535
            PG WLN+QH++FY+QHNLSMR FV+S++R   V ++YISSPEV FL+SIA+R     TKL
Sbjct  137  PGFWLNIQHNAFYAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKL  196

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  D  EPSTN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+V
Sbjct  197  VFRFLELDTVEPSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVV  254



>ref|XP_007020654.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
 gb|EOY12179.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
Length=514

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 185/239 (77%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSS  AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +
Sbjct  49   GGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            KQ TYLVNGV T  WF +D+  K +  V L QGV+SRS++FDG    I+TV D +  ++P
Sbjct  109  KQKTYLVNGVATKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGNNYPIMTVADTYTLLKP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKL  535
            PG WLN+QH++FY+QHNLSMR FV+S++R   V ++YISSPEV FL+SIA+R     TKL
Sbjct  169  PGFWLNIQHNAFYAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKL  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  D  EPSTN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+V
Sbjct  229  VFRFLELDTVEPSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVV  286



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 193/240 (80%), Gaps = 5/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY  A  TS+ +V++WCDVQLTKDGVGIC PD++L+N+++++  FK+
Sbjct  46   GGFSGIFPDSSSYAYQLALATSVPDVVLWCDVQLTKDGVGICAPDVRLENSTDISLFFKN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++STY+VNGV T  WF +DF F +L + + L QGVYSRS+ FD     I TVE+V   ++
Sbjct  106  RESTYIVNGVSTKGWFSVDFTFSELISNIGLTQGVYSRSNMFDSNLFPIQTVENV-TALK  164

Query  359  PPGL--WLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTK  532
            PPG   WLNVQHD+F++QHNLSMR +VL++SR+ VINYISSPEV FL+SIA RINP +TK
Sbjct  165  PPGTGTWLNVQHDAFFTQHNLSMRNYVLAISRKAVINYISSPEVGFLRSIAPRINPNITK  224

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            LVFRFLG  + EPSTNQTY + L+NL SIKTFASGIL+PK+YIWPVD ++ YLQP TS+V
Sbjct  225  LVFRFLGPSDIEPSTNQTYSAFLKNLTSIKTFASGILIPKNYIWPVD-ATLYLQPHTSVV  283



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 189/237 (80%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ FA LTSL +V++WCDVQLTKDGVGIC PD++LDN++++A + K+
Sbjct  47   GGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLTKDGVGICAPDLRLDNSTSIAQVMKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNGVPT  WF +DF   +L+LV L QG+YSRS RFD +   I TVEDV N ++P
Sbjct  107  KDKLYLVNGVPTRGWFTVDFTLNELSLVFLTQGIYSRSERFDNS-YPIQTVEDVAN-LKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F+ QHNLSMR+++LS+S+RVVIN++SSPE  FL+ I  R N  VTKLVF
Sbjct  165  PGLWLNIQHDAFFKQHNLSMRSYILSLSKRVVINHLSSPEAGFLRGIVKRFNLNVTKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +  EPSTN+TYGSL  N   IKTFASGIL+ KSYIWP+D +S+YLQP TS+V
Sbjct  225  RFLEPNVIEPSTNETYGSLSTNFTFIKTFASGILIQKSYIWPLD-ASNYLQPHTSIV  280



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   311 bits (797),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 187/237 (79%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGF G+FPDSSF +Y  A  TSL+NVI+WCDVQLTKDG GICFP+IKL+N+S+++++F++
Sbjct  42   GGFPGIFPDSSFASYQLALNTSLSNVILWCDVQLTKDGAGICFPNIKLENSSDISSVFRN  101

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  YLVNG  T  WF +D+    L  V L QG+Y R+++FDG    ILTVEDV  K++P
Sbjct  102  SR-IYLVNGQSTRGWFSVDYTLDDLKSVYLMQGIYYRTNKFDGNRYNILTVEDVAIKLKP  160

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+Q+D+FY QH LSMR+++LS SRR VINYISSPEV FL +IA R     TKL+F
Sbjct  161  PGLWLNIQYDAFYRQHKLSMRSYILSASRRFVINYISSPEVAFLSTIAERFKGSKTKLIF  220

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG+DE EPSTNQTYGSLL+NL  IK FASGILVPK+YIWPV+ ++ YLQ  TS+V
Sbjct  221  RFLGSDEIEPSTNQTYGSLLKNLKFIKKFASGILVPKNYIWPVN-TALYLQHHTSIV  276



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   311 bits (798),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 191/237 (81%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +A+ FA LTSL  V++WCDVQLTKD VGIC PD++LDN++++A + ++
Sbjct  47   GGFSGLFPDSSSDAFQFATLTSLPGVVLWCDVQLTKDSVGICAPDLRLDNSTSIAQVMQN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNG+PT  WF +DF   +L+LV+L QG++SRS RFD     I TVEDV   ++P
Sbjct  107  KDKLYLVNGIPTRGWFTVDFTLNELSLVSLNQGIFSRSERFDYI-YPIQTVEDV-ATLKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F++QHNLSMR++VLS+ RRVVIN++SSPE  FL+SI  R N  +TKLVF
Sbjct  165  PGLWLNIQHDAFFTQHNLSMRSYVLSLYRRVVINHLSSPEAGFLRSIVKRFNLNITKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL ++  EPSTN+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YLQP TS+V
Sbjct  225  RFLESNVIEPSTNETYGSLSKNFTFIKTFASGILIPKSYIWPLD-ASNYLQPHTSIV  280



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   311 bits (796),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 185/237 (78%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A++ A +TS+ +V++WCDVQLT+DG GICFPD+ L+N S++  +F  
Sbjct  46   GGFSGLFPGFSTAAFNLALVTSVPDVVLWCDVQLTRDGAGICFPDLLLNNNSDIEAVFPK  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K  TYLVNGV T  WF +D+ F  L  V + QGVYSR+++FDG    I TVEDV   ++P
Sbjct  106  KDKTYLVNGVSTRGWFTVDYTFNDLASVFVTQGVYSRTNKFDGNSYPISTVEDV-AMLKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLNVQHD F+SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI +R++P  TKLVF
Sbjct  165  PGLWLNVQHDIFFSQHNLSMRNYVLSVSRKVVVNYISSPEVAFLNSIKARVSPSTTKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG D+TEPST QTYGSLL+NL  IKTFASGIL+PK YIWPV K   YL+P TS+V
Sbjct  225  QFLGQDDTEPSTKQTYGSLLKNLTYIKTFASGILIPKIYIWPVTK-DLYLEPHTSIV  280



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 185/239 (77%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSSF AYS A  T  ++VI+WCDVQLTKDG GICFPD+KLDN SN+AT+F D
Sbjct  49   GGFSGIFSDSSFGAYSLALETGPSDVILWCDVQLTKDGAGICFPDLKLDNNSNIATIFSD  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K  TYLVNGV T   F ID+  K L  V L QG+YSR+++FDG   QI+TV+D + +++P
Sbjct  109  KPVTYLVNGVSTKGLFSIDYTLKDLGSVYLSQGIYSRTNKFDGNNYQIMTVQDTYTQLKP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKL  535
             G WLN+QHD+FY+ HNLSMR+FVLSV+R  +V ++YISSPEV FL++IA       TK+
Sbjct  169  LGFWLNIQHDAFYAAHNLSMRSFVLSVTRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKV  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFLG  + EPSTNQTY SLL NL  IKTFA+GI+VPK YIWPVD  + YLQP+TS+V
Sbjct  229  VFRFLGRKDVEPSTNQTYDSLLTNLTFIKTFAAGIIVPKCYIWPVD-GALYLQPSTSIV  286



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+ PDSS  +Y+ A +TS  +V +WCDVQLTKDG+GIC PDI L N++ +A+ + +
Sbjct  44   GGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQLTKDGLGICQPDINLANSTYIASAYPN  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFN-KVQ  358
            K ++YLVNGVPT  +FP+D+  K L+ V L QGVYSRS+ FDG    ILTVED+   + +
Sbjct  104  KTTSYLVNGVPTRGYFPLDYTLKDLSSVVLTQGVYSRSNLFDGNNFGILTVEDLAKLRQK  163

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P G WLN+QHD+FY+QHNLSMR+FVLSVSR+VV +YISSPEV FL+SIASR NP+ TKLV
Sbjct  164  PKGKWLNIQHDAFYAQHNLSMRSFVLSVSRKVVFSYISSPEVGFLRSIASRFNPKTTKLV  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF+G  + +PSTN+TYGSLLQNL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV
Sbjct  224  FRFMGLSDVDPSTNRTYGSLLQNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLV  280



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+ PDSS  +Y+ A +TS  +V +WCDVQLTKDG+GIC PDI L N++ +A+ + +
Sbjct  44   GGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQLTKDGLGICQPDINLANSTYIASAYPN  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFN-KVQ  358
            K ++YLVNGVPT  +FP+D+  K L+ V L QGVYSRS+ FDG    ILTVED+   + +
Sbjct  104  KTTSYLVNGVPTRGYFPLDYTLKDLSSVVLTQGVYSRSNLFDGNNFGILTVEDLAKLRQK  163

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P G WLN+QHD+FY+QHNLSMR+FVLSVSR+VV +YISSPEV FL+SIASR NP+ TKLV
Sbjct  164  PKGKWLNIQHDAFYAQHNLSMRSFVLSVSRKVVFSYISSPEVGFLRSIASRFNPKTTKLV  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF+G  + +PSTN+TYGSLLQNL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV
Sbjct  224  FRFMGLSDVDPSTNRTYGSLLQNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLV  280



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   309 bits (791),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 186/237 (78%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS A  T L N+  WCDVQLTKDG GICFPD++L+NAS++  ++K+
Sbjct  49   GGFSGIFPDSSLYAYSLAVQTGLPNLHAWCDVQLTKDGAGICFPDLRLENASDIDNIYKN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q TY VNGV T  WF +DF  ++L  VN++Q ++SR+  FDGT  QILTV+DV ++ +P
Sbjct  109  RQKTYDVNGVSTQGWFSVDFTLEELAPVNMKQRIFSRAPNFDGTLMQILTVDDVVSQTKP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLN+ HD+F+ QHNLSMR FVL+VSRRV+++YISSPEV FL+SIA+R     TKLVF
Sbjct  169  FGLWLNIPHDAFFGQHNLSMRGFVLAVSRRVIVDYISSPEVGFLRSIAARFRTGRTKLVF  228

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +F+  D+ EP+TNQTYGSLL NL  I+TFASGI+VPKSYI PV K   YLQ +TSLV
Sbjct  229  QFMQPDDVEPTTNQTYGSLLNNLTLIRTFASGIIVPKSYILPVGK-DQYLQNSTSLV  284



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 189/238 (79%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC PDI L N++ +AT++ +
Sbjct  44   GGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQPDINLANSTYIATIYPN  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K ++Y VNGVPT+ +FP+D+  K L+ V L QGVYSRS+ FDG    ILTV+D+    Q 
Sbjct  104  KTTSYSVNGVPTSGYFPLDYTLKDLSSVILTQGVYSRSTLFDGNGFGILTVDDLVKLDQK  163

Query  362  P-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P G+WLN+QHD+FY+QHNLSMR+FVLSVSR VV +YISSPEV FL+SIASR NP+ TKLV
Sbjct  164  PKGIWLNIQHDAFYAQHNLSMRSFVLSVSRSVVFSYISSPEVGFLRSIASRFNPKTTKLV  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF+   + +PSTNQTYGSLL+NL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV
Sbjct  224  FRFMRQSDVDPSTNQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLV  280



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   308 bits (789),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 188/237 (79%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   
Sbjct  43   GGFSGLFPGFSSAAFNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+ TYLVNGV T  WF +D+ +  L  +++ QG+YSR++RFDG    IL VEDV  + +P
Sbjct  103  KEKTYLVNGVSTKGWFTVDYTWDGLVNISVTQGIYSRTNRFDGNLYPILLVEDVVTQFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD F+SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVF
Sbjct  163  PGLWLNIQHDIFFSQHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D TEPSTNQTYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+V
Sbjct  223  RFLGQDXTEPSTNQTYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVV  278



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   308 bits (789),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 190/237 (80%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  +  A++FA +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   
Sbjct  43   GGFSGLFPGFTSAAFNFALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+ TYLVNGV T  WF +D+ +  L  +++ QG+YSR++RFDG    IL VEDV  + +P
Sbjct  103  KEKTYLVNGVSTKGWFTVDYTWDGLVNISVTQGIYSRANRFDGNMYPILLVEDVATQFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD F+SQHNLSMR++VLSVSR+VV++YISSPEV FL SI SR++P VTKLVF
Sbjct  163  PGLWLNIQHDIFFSQHNLSMRSYVLSVSRQVVVSYISSPEVAFLNSIKSRVSPSVTKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  DETEPSTNQTYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+V
Sbjct  223  RFLAQDETEPSTNQTYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVV  278



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   308 bits (790),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 185/239 (77%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSS  AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +
Sbjct  49   GGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            KQ TYLVNGV T  WF +D+  K +  V L QGV+SRS++FDG    I+TV D +  ++P
Sbjct  109  KQKTYLVNGVATKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGNNYPIMTVADTYTLLKP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKL  535
            PG WLN+QH++FY+QHNLSMR FV+S++R   V ++YISSPEV FL+SIA+R     TKL
Sbjct  169  PGFWLNIQHNAFYAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKL  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  D  EPSTN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+V
Sbjct  229  VFRFLELDTVEPSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVV  286



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   308 bits (789),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 185/239 (77%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSS  AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +
Sbjct  49   GGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            KQ TYLVNGV T  WF +D+  K +  V L QGV+SRS++FDG    I+TV D +  ++P
Sbjct  109  KQKTYLVNGVATKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGNNYPIMTVADTYTLLKP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKL  535
            PG WLN+QH++FY+QHNLSMR FV+S++R   V ++YISSPEV FL+SIA+R     TKL
Sbjct  169  PGFWLNIQHNAFYAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKL  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  D  EPSTN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+V
Sbjct  229  VFRFLELDTVEPSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVV  286



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 189/238 (79%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC PDI L N++ +AT++ +
Sbjct  44   GGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQPDINLANSTYIATIYPN  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFN-KVQ  358
            K ++Y VNGVPT+ +FP+D+  K L+ V L QGVYSRS+ FDG    ILTV+D+     +
Sbjct  104  KTTSYSVNGVPTSGYFPLDYTLKDLSSVILTQGVYSRSTLFDGNNFGILTVDDLVKLDKK  163

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P G+WLN+QHD+FY+QHNLSMR+FVLSVSR VV +YISSPEV FL+SIASR NP+ TKLV
Sbjct  164  PKGIWLNIQHDAFYAQHNLSMRSFVLSVSRSVVFSYISSPEVGFLRSIASRFNPKTTKLV  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF+   + +PSTNQTYGSLL+NL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV
Sbjct  224  FRFMRQSDVDPSTNQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLV  280



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 182/237 (77%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY  A  TS+++V++WCDVQLTKDGVGICFPD+ L NASN+  ++  
Sbjct  57   GGFSGLLPDSSIDAYGLALQTSVSDVVLWCDVQLTKDGVGICFPDVNLRNASNIDVVYPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             QS+Y+VNGVPT  WF IDF  K L  V L +G+ SR + FD +   + TVEDV   V+P
Sbjct  117  GQSSYIVNGVPTQGWFSIDFTLKDLGDVALIRGILSRPNAFD-SKYSVQTVEDVAKTVKP  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG WLN+QH +FY+QHNLSMR+FVLS+S+ VVI++ISSPEVNFL+SIA R   +  + VF
Sbjct  176  PGFWLNIQHGAFYAQHNLSMRSFVLSISKSVVIDFISSPEVNFLRSIAGRFGRKGPRFVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG ++ EPSTNQTYGSLL NL  IKTFASGI+VPK YIWPV  SS YL P TSLV
Sbjct  236  QFLGQEDVEPSTNQTYGSLLHNLTFIKTFASGIIVPKIYIWPV--SSLYLLPPTSLV  290



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 182/239 (76%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSSF AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F D
Sbjct  49   GGFSGIFSDSSFGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTD  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K +TYLVNGV T   F ID+    L  V L QG+YSR+++ DG    I+TV+D + ++QP
Sbjct  109  KPTTYLVNGVSTKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDGNNYPIMTVQDTYTQLQP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKL  535
             G WLN+QHD+FY+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+
Sbjct  169  RGFWLNIQHDAFYAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKV  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFLG  + EPSTNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+V
Sbjct  229  VFRFLGPKDVEPSTNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIV  286



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   306 bits (783),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 188/237 (79%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS NAY FA + S+ +V++WCDVQLT+DGVGICFP++KLDN+S +  +F +
Sbjct  59   GGFSGLFPDSSANAYQFATMVSVPDVVLWCDVQLTRDGVGICFPNLKLDNSSGIEHVFPN  118

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
              ++Y VNGVPT  +FPIDF F++L+ V L QG+++R+  FDG    I +VEDVF + +P
Sbjct  119  GSNSYDVNGVPTDGFFPIDFTFEELSTVPLIQGIFTRNPFFDGM-FPIQSVEDVFMQNEP  177

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQH+SFYSQHNLSMR+F+L+ +  + I++ISSPEVNFL+ +A+      TKLVF
Sbjct  178  AGFWLNVQHNSFYSQHNLSMRSFILNAAESMNISHISSPEVNFLRGLATPFASTSTKLVF  237

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  DETEPSTNQ+YGSLL NL  I TFASGILVPK+YIWPVD ++SYL P TSLV
Sbjct  238  RFLDQDETEPSTNQSYGSLLTNLTMISTFASGILVPKNYIWPVD-ATSYLLPHTSLV  293



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   305 bits (782),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 188/238 (79%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AYS A +T+  +V + CDVQLTKD VGIC PDI L N++ +AT + +
Sbjct  46   GGFSGIFPDSSDSAYSLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIATTYPN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
              ++YLVNGVP   +F +D+  KQL+ V L QGVYSR++RFDG    ILTV+D+    Q 
Sbjct  106  DTTSYLVNGVPIRGYFSLDYTMKQLSDVLLTQGVYSRTNRFDGIGFLILTVDDLVTLNQK  165

Query  362  P-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P G+WLN+QHD+FY+QHNLSMR+FV+S S+R+V +YISSPEVNFL+ I+SR+N + TKLV
Sbjct  166  PKGIWLNIQHDTFYAQHNLSMRSFVISASKRIVFSYISSPEVNFLRGISSRLNLKTTKLV  225

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF+  DE EPS NQTYGSLL+NL  IKTFASGILVPK YIWPVD +S YLQP TSLV
Sbjct  226  FRFMDKDELEPSINQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-ASLYLQPHTSLV  282



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   304 bits (778),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 182/239 (76%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSSF AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F D
Sbjct  49   GGFSGIFSDSSFGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTD  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K +TYLVNGV T   F ID+    L  V L QG+YSR+++ DG    I+TV+D + ++QP
Sbjct  109  KPTTYLVNGVSTKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDGNNYPIMTVQDTYTQLQP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKL  535
             G WLN+QHD+FY+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+
Sbjct  169  RGFWLNIQHDAFYAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKV  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFLG  + EPSTNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+V
Sbjct  229  VFRFLGPKDVEPSTNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIV  286



>ref|XP_006344951.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2-like, partial [Solanum tuberosum]
Length=397

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 180/238 (76%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGL-TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  178
            GGFSGLF DSS+ AY  A L TSL NVI+WCDVQLTK+ V +CFPD+KLDN S++   +K
Sbjct  15   GGFSGLFLDSSYEAYIMAILETSLPNVIIWCDVQLTKNEVDMCFPDLKLDNTSDIDAYYK  74

Query  179  DKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            + +S YL+N V T  WF IDF+F  L  V  +QGVY R  +FD   Q ILTV DV N+V+
Sbjct  75   NNKSKYLMNIVLTQGWFSIDFDFNDLMHVTSKQGVYFRIEKFD-XKQNILTVXDVANQVK  133

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
              GLWLN+QH +F++QHNLSMR +++ +SR V+INYISSPEV FL +I +R NPR TKLV
Sbjct  134  HLGLWLNIQHVNFFTQHNLSMRNYIIFISRNVLINYISSPEVTFLTNIVARFNPRFTKLV  193

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FLG D+ E S NQTYGSLL N+  IKTFASGILVPKS IWPVD +S YLQP TSLV
Sbjct  194  FLFLGQDDVESSINQTYGSLLNNVTFIKTFASGILVPKSCIWPVD-NSHYLQPYTSLV  250



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 187/238 (79%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AYS A +T+  +V + CDVQLTKD VGIC PDI L N++ +A+ + +
Sbjct  41   GGFSGIFPDSSDSAYSLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIASRYPN  100

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + ++YLVNGVP   +F +D+  KQL  V L QGVYSR++RFDG   QILTV+ +    Q 
Sbjct  101  ETTSYLVNGVPIRGYFSLDYTMKQLNSVFLTQGVYSRTNRFDGVGFQILTVDGLVTLNQK  160

Query  362  P-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P G+WLN+QHD+FY+QHNLSMR+FV+S S+R++ +YISSPEVNFL+ I+SR+N + TKLV
Sbjct  161  PKGIWLNIQHDTFYAQHNLSMRSFVISASKRIIFSYISSPEVNFLRGISSRLNLKTTKLV  220

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF+  DE EPS NQTYGSLL+NL  IKTFASGILVPK YIWPVD  S YLQP TSLV
Sbjct  221  FRFMDKDELEPSINQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-GSLYLQPHTSLV  277



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/237 (62%), Positives = 182/237 (77%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AYSFA + S  + I+WCDV+LTKDG+GIC PDIKLDN ++++ ++ +
Sbjct  50   GGFSGLFPDSSHDAYSFALIASSPDTILWCDVRLTKDGLGICLPDIKLDNCTDISNIYPN  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q+ YLVNGV TT WF +D++ ++L+ V + Q +YSR+ RFD     IL VEDV    +P
Sbjct  110  GQNVYLVNGVNTTGWFSVDYSIQELSTVAVTQSIYSRTFRFDFNNYAILAVEDVVTNFEP  169

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD FY QHNLSM  +VLSVS+RV +NY+SSPE+ FL SIA+  +   TKLVF
Sbjct  170  PGLWLNIQHDIFYGQHNLSMTEYVLSVSKRVPVNYLSSPELAFLSSIAADFSNSDTKLVF  229

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D  EPST+QTYGSLL NL  IKTF SGILVPKSYIWPV  + +YL P TS+V
Sbjct  230  RFLGKDIAEPSTSQTYGSLLNNLTYIKTFVSGILVPKSYIWPV-TADNYLLPYTSIV  285



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 183/239 (77%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P++ L N++N+  +F +
Sbjct  43   GGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLPNLNLLNSTNIFGVFPN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K ++YLVNG  T  +F +D++F+ L+ V + QGV+SRS   DG    I TV++V   V P
Sbjct  103  KTTSYLVNGESTAGYFSVDYSFEDLSTVTVTQGVFSRSPLLDGNNFIINTVDEVLKLVAP  162

Query  362  --PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
              PGLWLN+QHD+FYSQHNLSMR+FVL+VSRR+ ++YISSPE  FL+SI  R NP+ TKL
Sbjct  163  QTPGLWLNIQHDAFYSQHNLSMRSFVLAVSRRLHVSYISSPEAGFLRSITKRFNPKTTKL  222

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  ++T+PSTNQTYGS L+NL  IKTFASGILVPK YIWPVD +S YLQP TSLV
Sbjct  223  VFRFLNQEDTDPSTNQTYGSFLKNLTFIKTFASGILVPKGYIWPVD-ASLYLQPHTSLV  280



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   304 bits (778),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 182/239 (76%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+F DSSF AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F D
Sbjct  49   GGFSGIFSDSSFGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTD  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K +TYLVNGV T   F ID+    L  V L QG+YSR+++ DG    I+TV+D + ++QP
Sbjct  109  KPTTYLVNGVSTKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDGNNYPIMTVQDTYTQLQP  168

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKL  535
             G WLN+QHD+FY+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+
Sbjct  169  RGFWLNIQHDAFYAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKV  228

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFLG  + EPSTNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+V
Sbjct  229  VFRFLGPKDVEPSTNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIV  286



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   303 bits (776),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 188/237 (79%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS++AY+ A +TSL NV++WCDVQLTKDG GICFP + L N+S+++ +F D
Sbjct  49   GGFSGIFPDSSYHAYALALITSLPNVVLWCDVQLTKDGDGICFPYLNLGNSSSISYVFND  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  Y VNG     +F +DF    LT V L QG+YSR+++FDG   +ILTVEDV  +++P
Sbjct  109  TK-MYRVNGQLMEGFFSVDFTLDDLTNVYLTQGIYSRANKFDGNMFKILTVEDVAKQLKP  167

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD+F++QHNLSMR+FVLSVSRRV+++YISSPEV FL+SI +R     TKLVF
Sbjct  168  PGLWLNIQHDAFFTQHNLSMRSFVLSVSRRVIVSYISSPEVAFLRSITARFKQSTTKLVF  227

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ EP+TNQTY S+L+NL  +KTFAS ILVPK+YIWPV+ +  YLQP TS+V
Sbjct  228  RFLRADDIEPTTNQTYDSILKNLTFVKTFASAILVPKNYIWPVN-TDLYLQPHTSVV  283



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   302 bits (773),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 183/239 (77%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P++ L N++N+  +F +
Sbjct  43   GGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLPNLNLLNSTNIFGVFPN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K ++YLVNG  T  +F +D++F+ L+ V + QGV+SRS   DG    I TV++V   V P
Sbjct  103  KTTSYLVNGESTAGYFSVDYSFEDLSTVTVTQGVFSRSPLLDGNNFIINTVDEVLKLVAP  162

Query  362  --PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
              PGLWLN+QHD+FYSQHNLSMR+FVL+VSRR+ ++YISSPE  FL+SI  R NP+ TKL
Sbjct  163  QTPGLWLNIQHDAFYSQHNLSMRSFVLAVSRRLHVSYISSPEAGFLRSITKRFNPKTTKL  222

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  ++T+PSTNQTYGS L+NL  IKTFASGILVPK YIWPVD +S YLQP TSLV
Sbjct  223  VFRFLNQEDTDPSTNQTYGSFLKNLTFIKTFASGILVPKGYIWPVD-ASLYLQPHTSLV  280



>ref|XP_008349893.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3 [Malus domestica]
Length=448

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 184/238 (77%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  A++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   
Sbjct  43   GGFSGLFPGFSSAAFNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+ TYLVNGV T  WF +D+ +  L  +++ QG+YSR++RFDG    IL VED F + +P
Sbjct  103  KEKTYLVNGVSTKGWFTVDYTWDGLVNISVTQGIYSRTNRFDGNLYPILLVEDXFTQFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+QHD F+SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVF
Sbjct  163  PGLWLNIQHDIFFSQHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVF  222

Query  542  RFLGNDETEPSTNQTY-GSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D TEPST     GSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+V
Sbjct  223  RFLGQDXTEPSTXXNXNGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVV  279



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   301 bits (771),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 180/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +G+CFPD+K+ NASN+  ++  
Sbjct  56   GGFSGLLPDSSLDAYSFVSQTSVPGAVLWCDVQLTKDAIGLCFPDVKMMNASNIQDVYPK  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YL+NGVPT  WF IDFNFK LT V L+QG+ SRS+ FDG    I TV+D+  +++P
Sbjct  116  RKTSYLLNGVPTQDWFTIDFNFKDLTKVILKQGILSRSAAFDGNSYGISTVKDISTQLKP  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM +F+LS+S+ V+I+Y+SSPEVNF ++I  R      K VF
Sbjct  176  EGFWLNVQHDAFYAQHNLSMSSFLLSISKTVIIDYLSSPEVNFFRNIGRRFGRNGPKFVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL  NL  +KTFASG+LVPKSYIWP++  S YL P TS V
Sbjct  236  RFLEKDDVEVSTNQTYGSLAGNLTFLKTFASGVLVPKSYIWPIE--SQYLLPRTSFV  290



>ref|XP_007146553.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
 gb|ESW18547.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
Length=503

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 180/238 (76%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY F    SL NVI+WCDVQLTKD  GIC P++KL+NA+++A   K 
Sbjct  52   GGFSGIFPDSSEKAYIFGVTASLKNVIVWCDVQLTKDSQGICVPNVKLENATDIAQNNKY  111

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            K  +Y VNGV T  +F +D+  K L + V L QG +SR++   G   +ILTV+DV N   
Sbjct  112  KSKSYQVNGVQTDGYFSVDYTLKDLRSNVFLVQGDHSRATTI-GKGFEILTVKDVVNTTS  170

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P GLWLN+QHD+FY+QHNLSM+ F+ SVS  V ++YISSPE +FL+SI + INP++TKLV
Sbjct  171  PQGLWLNIQHDAFYTQHNLSMKNFIRSVSTTVNVSYISSPEASFLRSIKTDINPKITKLV  230

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFLG +E +PS  QTYGSLLQNL SIKTFASGILVPK YIWPVD +S YLQP TSLV
Sbjct  231  FRFLGKEEVDPSIKQTYGSLLQNLTSIKTFASGILVPKDYIWPVDPTSHYLQPHTSLV  288



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 179/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYSF  +TS+ + ++WCDVQLTKDGVGICFPD+K+ NASN+   + D
Sbjct  56   GGFSGLLPDSSLDAYSFVSMTSVPDAVLWCDVQLTKDGVGICFPDVKMMNASNIQVAYPD  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YL+NGVPT  WF IDF FK L  V L +G+ SRS  FD     I TV+++  +++P
Sbjct  116  RKNSYLLNGVPTQDWFTIDFTFKDLKTVFLMRGILSRSDAFDNNQYAISTVQNIATRLKP  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM +F+L+VS+ V I+Y+SSPEVNF ++I  R      K VF
Sbjct  176  AGFWLNVQHDAFYAQHNLSMSSFLLTVSKTVFIDYLSSPEVNFFRNIGGRFGKNGPKFVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL+ NL  IKTFASG+LVPKSYIWP++  S YL+P TS V
Sbjct  236  RFLEKDDIEVSTNQTYGSLIGNLTFIKTFASGVLVPKSYIWPLE--SKYLRPHTSFV  290



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 183/239 (77%), Gaps = 4/239 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FP SS  AY+ A +TS   V +WCDVQLTKD VGIC P++ LDN++ ++ +F +
Sbjct  42   GGFSGVFPQSSEVAYNLAVMTSGPEVSIWCDVQLTKDEVGICLPNVILDNSTFISYIFPN  101

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K +TY VN VPT  +F +D+  K L+ V L+Q VYSRS  FDGT   ILTV+DV     P
Sbjct  102  KSTTYNVNNVPTNGYFSLDYTLKDLSNVPLKQVVYSRSPVFDGT-YMILTVDDVVKSGAP  160

Query  362  --PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
              PGLWLN+QHD+FY+QH LSM+ FVLSVSRRV +NYISSPE+ FL+SI  R+NP+ TK 
Sbjct  161  QTPGLWLNIQHDAFYAQHKLSMKRFVLSVSRRVRVNYISSPEIGFLRSIKPRLNPKKTKF  220

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FRFL  +ET+PSTNQTYGSLL+NL  IK+FASGILVPK YIWPVD  S YLQP TSLV
Sbjct  221  IFRFLDQNETDPSTNQTYGSLLKNLTFIKSFASGILVPKGYIWPVD-DSLYLQPHTSLV  278



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 181/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA LTS+ + ++WCD+QLTKDG GICFPD+ + NASNV T++  
Sbjct  47   GGFSGLFPDSSLDAYNFAMLTSVADAVLWCDLQLTKDGAGICFPDLTMSNASNVETVYPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             QSTY VNGVPT  WF IDF+ + LT V+L +G+ SRS +FDG    I TV+ +  +++P
Sbjct  107  GQSTYPVNGVPTPGWFTIDFSLRALTNVSLIRGILSRSDKFDGNGYTISTVQTINKEMKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQHD+FY+QHNLSM  F++SV++ V++++ISSPEVNF + IA R        VF
Sbjct  167  QGLWLNVQHDAFYAQHNLSMSNFLISVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  ++ EP+TN+TYGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV
Sbjct  227  RFLEKEQFEPTTNRTYGSILSNLTFVKTFASGILVPKSYVLPLDD-KQYLLPSTSLV  282



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 184/237 (78%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S  + I++CDV+LTKDG+G+C PDIKLDN +N+   + D
Sbjct  44   GGFSGLFPDSSEFAYQFALIASSPDTILYCDVRLTKDGLGVCLPDIKLDNCTNIPEFYAD  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +YLVNGV TT WF +D+N  +L+ V+L+Q +YSR+ RFD +   +L VEDV +K + 
Sbjct  104  GKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQSIYSRTPRFDPSFFPLLAVEDVASKFKS  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLN+QHDSFYSQ N+SMR ++LSV++RVV++YISSPE +FL SI+ R++ + TKLVF
Sbjct  164  PGIWLNIQHDSFYSQFNMSMRNYILSVTKRVVVDYISSPEASFLTSISGRVSNK-TKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST QTYGS+L+NL  +KTFASGILVPK YIWPV    +YLQP TS+V
Sbjct  223  RFLDEATLEPSTKQTYGSMLKNLTFVKTFASGILVPKKYIWPV-SPDNYLQPYTSIV  278



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 178/237 (75%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FP SS  AY  A LT L N+ +WCDVQLTKDG GICFPDI+L NAS++  ++ +
Sbjct  46   GGFSGVFPYSSGYAYELALLTGLPNLHIWCDVQLTKDGAGICFPDIRLQNASDIKYVYGN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K +TY ++G     WF +DF  K L LVN+ QG+++R   FDG    ILTV+DV    +P
Sbjct  106  KSNTYTIDGKQEQGWFSVDFTLKDLKLVNMNQGIHNRVPHFDGNNLPILTVDDVVRLTKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+ HD+F+SQHNLSMR+F++S SRR+++NYISSPEV FL+SI SR     TKLVF
Sbjct  166  PGLWLNIPHDAFFSQHNLSMRSFIISASRRMIVNYISSPEVGFLRSIVSRFRTGPTKLVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG D+ EP TNQTY  L++NL  IKTFA+GI+VPKSYIWPVD +S YL   TSLV
Sbjct  226  QFLGPDDVEPLTNQTYRLLMKNLTFIKTFATGIIVPKSYIWPVD-NSLYLHNYTSLV  281



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+ PDSS +AY  A   S+T+V++WCDVQLTKDG+GICFPD+ L NASN+  ++  
Sbjct  47   GGFSGVLPDSSVDAYGLAVQVSVTDVVLWCDVQLTKDGIGICFPDVNLGNASNIGDVYPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q++YLVNGVPT  WF IDF  K L  V L +G+ SR   FD     I TVE++   V+P
Sbjct  107  QQNSYLVNGVPTQGWFSIDFTLKDLAKVALIRGILSRPEAFD-YKYSIQTVENIATTVKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P  WLN+QHD+FY QHNLSMR+FVLSVSR V+I+YISSPEV+FL+SIA        K VF
Sbjct  166  PLFWLNIQHDAFYGQHNLSMRSFVLSVSRNVIIDYISSPEVSFLRSIAGSFRRNGPKFVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DE EPSTNQTYGSLL+NL  IKTFASGILVPK+YI PV+  + YL   TSLV
Sbjct  226  RFLGQDEVEPSTNQTYGSLLRNLTFIKTFASGILVPKNYILPVN--NLYLLQPTSLV  280



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 183/240 (76%), Gaps = 3/240 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG++PDSS  AYS A  TSL NVI+WCDVQLTKD  GIC PDIKL+NA+++  + + 
Sbjct  51   GGFSGIYPDSSDIAYSLAAQTSLANVILWCDVQLTKDREGICIPDIKLENATDIGHVSEF  110

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKV-  355
            K  TY VNGV T+ +F +D+  K+L + V L QG Y+R++RFDG+   ILTV ++  +  
Sbjct  111  KSKTYSVNGVQTSGYFSVDYTLKELLSNVVLIQGDYTRTNRFDGSDFPILTVNELVRRET  170

Query  356  -QPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTK  532
              P GLWLN+QHD FY+QHNLSM+ FVLSVSR V ++YISSPE  FL+S+ + + P  TK
Sbjct  171  PNPSGLWLNIQHDVFYAQHNLSMKNFVLSVSRTVNVSYISSPEAGFLRSLRALVKPSKTK  230

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            LVFRFL  D+ +PSTNQTYGSLL+NL SIKTFASGILVPK YIWPVD +S YL P TSLV
Sbjct  231  LVFRFLEKDKVDPSTNQTYGSLLKNLTSIKTFASGILVPKEYIWPVDPTSLYLLPHTSLV  290



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 181/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  
Sbjct  50   GGFSGLFPDSSYDAYNFAILTSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPT  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +Y VNGVPT+ WF IDF+ K L  VNL +G+ SRS +FDG    I+TV+ V  +++P
Sbjct  110  RQKSYPVNGVPTSGWFTIDFSLKDLKDVNLIRGILSRSEKFDGNSNPIMTVQSVSTQMKP  169

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLSM +F+++ S+ V+I++ISSPEVNF K IA R       LVF
Sbjct  170  SFFWLNVQHDAFYAQHNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVF  229

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DE EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  230  RFLGQDEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-QQYLLPHTSLV  285



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 181/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  
Sbjct  50   GGFSGLFPDSSYDAYNFAILTSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPT  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +Y VNGVPT+ WF IDF+ K L  VNL +G+ SRS +FDG    I+TV+ V  +++P
Sbjct  110  RQKSYPVNGVPTSGWFTIDFSLKDLKDVNLIRGILSRSKKFDGNSNPIMTVQSVSTQMKP  169

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLSM +F+++ S+ V+I++ISSPEVNF K IA R       LVF
Sbjct  170  SFFWLNVQHDAFYAQHNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVF  229

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DE EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  230  RFLGQDEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-QQYLLPHTSLV  285



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 181/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  
Sbjct  61   GGFSGLFPDSSYDAYNFAILTSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPT  120

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +Y VNGVPT+ WF IDF+ K L  VNL +G+ SRS +FDG    I+TV+ V  +++P
Sbjct  121  RQKSYPVNGVPTSGWFTIDFSLKDLKDVNLIRGILSRSEKFDGNSNPIMTVQSVSTQMKP  180

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLSM +F+++ S+ V+I++ISSPEVNF K IA R       LVF
Sbjct  181  SFFWLNVQHDAFYAQHNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVF  240

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG DE EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  241  RFLGQDEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-QQYLLPHTSLV  296



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   295 bits (756),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 179/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD  GICFPD+K+ NASN+  ++  
Sbjct  59   GGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAFGICFPDVKMMNASNIQEVYPK  118

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + ++YL+NGVPT  WF IDF+ K LT V L +G+ SRS+ FDG    I TV+D+  +++P
Sbjct  119  RTNSYLLNGVPTQDWFTIDFSLKDLTSVFLIRGILSRSNAFDGNSYTISTVQDIATQLKP  178

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLS+ +F+LSVS+ V INY+SSPEVNF ++I SR   +  K VF
Sbjct  179  QSFWLNVQHDAFYAQHNLSISSFLLSVSKTVTINYLSSPEVNFFRNIGSRFGRKGPKFVF  238

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V
Sbjct  239  RFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVV  293



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   295 bits (755),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 179/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +GICFPD+K+ NAS++  ++  
Sbjct  47   GGFSGLLPDSSIDAYSFVSQTSVPGTLLWCDVQLTKDAIGICFPDVKMMNASHIQDVYPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YL+NGV T  WF IDFNFK L  V L+QG+ SRS  F+G    I TV+D+  +++P
Sbjct  107  RKNSYLLNGVLTQDWFTIDFNFKDLNTVFLKQGILSRSDAFEGNNYAISTVKDISTQLKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM +F+LS+S+ V+I+Y+SSPEVNF ++I SR   +  K VF
Sbjct  167  EGFWLNVQHDAFYAQHNLSMSSFLLSISKTVIIDYLSSPEVNFFRNIGSRFGRKGPKFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL  NL  +KTFASGILVPKSYIWPV+  S YL P TS V
Sbjct  227  RFLEKDDVEVSTNQTYGSLAGNLTFVKTFASGILVPKSYIWPVE--SQYLLPHTSFV  281



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 181/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY F   +S  + +++CDV+LTKD VG+C PDIK+DN +N+A ++  
Sbjct  43   GGFSGLFPDSSPDAYGFVQYSSSPDTVLYCDVRLTKDEVGLCLPDIKMDNCTNIADIYAQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +YLVNGVPT+ WF +D+N  +L  V+L Q + SRS RFD      L VEDV +K +P
Sbjct  103  GQKSYLVNGVPTSGWFSVDYNNTELGQVSLIQSIASRSPRFDSNFYPPLAVEDVRSKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLNVQHD FYSQ NLSMR +++SVS+RVV+NYISSPEV+FL S+  R++ + TKLVF
Sbjct  163  PGIWLNVQHDRFYSQFNLSMRNYIISVSKRVVVNYISSPEVSFLTSVLGRVSKK-TKLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            R+L     EPS NQTYGS+L+NL  +KTFASGILVPKSYIWP   + +YLQP TS+V
Sbjct  222  RYLDESTLEPSMNQTYGSMLKNLTFVKTFASGILVPKSYIWPT-SADNYLQPHTSVV  277



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 181/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S  + I++CDV+LTKD +GIC PDI++DN +N+   +  
Sbjct  45   GGFSGLFPDSSEYAYQFALVASSPDTILYCDVRLTKDEIGICLPDIRMDNCTNIPDFYAQ  104

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +YLVNGVPT+ WF +D+N  +L  V L+Q + SR+ RFD +   +L VEDV +K +P
Sbjct  105  GQKSYLVNGVPTSGWFSVDYNGTELGQVTLKQSINSRTPRFDSSFFALLAVEDVQSKFKP  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLNVQHDSFYSQ NLSMR +++SVS+RVV NYISSPEV+FL SI  RI+ + TKLVF
Sbjct  165  PGIWLNVQHDSFYSQFNLSMRNYIISVSKRVVANYISSPEVSFLTSILGRISNK-TKLVF  223

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPS NQTYGS+++NL  +KTFASGILVPKSYIWP +   +YLQP TS+V
Sbjct  224  RFLDESTLEPSMNQTYGSMMKNLTFVKTFASGILVPKSYIWP-NSPDNYLQPYTSVV  279



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   295 bits (754),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 182/239 (76%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS A  TSL +V +WCDVQLTKD  GIC P++ L N++ V+    +
Sbjct  50   GGFSGIFPDSSGAAYSLALQTSLPDVALWCDVQLTKDAAGICLPNVNLLNSTYVSIAIPN  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K ++Y VNGV T  +F +D+  + L+ V L QGV+SRS+  D     ILTV+DV   V P
Sbjct  110  KTTSYSVNGVSTRGYFSVDYTLEDLSNVFLSQGVFSRSALLDANGYLILTVDDVVKSVAP  169

Query  362  --PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
              P LWLN+QHD+FY+QH LSMR++VLSVSRRV ++YISSPEV FL+SI +R +P++TKL
Sbjct  170  QKPNLWLNIQHDAFYTQHKLSMRSYVLSVSRRVPVSYISSPEVGFLRSITTRFDPKITKL  229

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  D+T+PSTNQTYGSLL+NL  IKTFASGILVPK YIWPVD +S YLQ  T+LV
Sbjct  230  VFRFLNQDDTDPSTNQTYGSLLKNLTFIKTFASGILVPKEYIWPVD-ASLYLQQHTTLV  287



>emb|CDY71959.1| BnaCnng75290D, partial [Brassica napus]
Length=328

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (72%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYS    TS+++ ++WCDVQLTKDGVGICFPD+K+ NAS++   +  
Sbjct  57   GGFSGLLPDSSVDAYSIVSQTSVSDAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYSK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YLVNGVPT  WF IDF  K L  V L +G+ SRS  FD     I TV+D+  +++P
Sbjct  117  RKNSYLVNGVPTQDWFTIDFTLKDLKPVFLIRGILSRSDAFDNNQYAISTVQDIAMELKP  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY QHNLS+  F+LS+ + V INY+SSPEV FL+SI  R      K VF
Sbjct  177  KSFWLNVQHDAFYGQHNLSISKFLLSLPKTVTINYLSSPEVTFLQSIGGRFGKAGPKFVF  236

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYG+LL NL  IKTFASG+LVPKSYIWP++    YL P TS V
Sbjct  237  RFLEKDDVEVSTNQTYGTLLGNLTFIKTFASGVLVPKSYIWPLE--DQYLSPHTSFV  291



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+ + ++WCDVQLTKD +GICFPD+ + NASN+  + K+
Sbjct  47   GGFSGLFPDSSYDAYNFAMLTSVPDAVLWCDVQLTKDALGICFPDLTMSNASNIEAVLKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +  +Y VNGVPT  WF +DF+ K L  VNL +G+ SRS +FD     I+TV+ V   ++P
Sbjct  107  RLKSYSVNGVPTQGWFTLDFSLKDLKDVNLIRGILSRSEKFDNNANPIMTVQSVATLIKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P  WLNVQHD+FY+Q NLSM +F+++ S+ V+I++ISSPEVNF K IA R   +    VF
Sbjct  167  PLFWLNVQHDAFYAQQNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRKGPSFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTT  703
            RFLG +E EP+TN+TYGS+L NL  +KTFASGILVPKSY+ P+D     L PT+
Sbjct  227  RFLGQEEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYVLPLDDKQYLLAPTS  280



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 179/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYSF G TS+ + ++WCD+QLTK+ +GICFPD+K+ NASN+  ++  
Sbjct  57   GGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKEAIGICFPDVKMMNASNIQEVYPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + ++YL+NGVPT  WF IDF+ K L  V L +G+ SRS+ FDG    I TV+D+  +++P
Sbjct  117  RTNSYLLNGVPTQDWFTIDFSLKDLKSVFLIRGILSRSNAFDGNSYTISTVQDIATQLKP  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLS+ +F+LSVS+ V +NY+SSPEV+F ++I SR   +  K VF
Sbjct  177  QSFWLNVQHDAFYAQHNLSISSFLLSVSKTVTVNYLSSPEVDFFRNIGSRFERKGPKFVF  236

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V
Sbjct  237  RFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVV  291



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLF DSS+NAY    L S ++  +WCDV+LTKDGVGIC PDI L+N +++   +  
Sbjct  44   GGFSGLFADSSYNAYKSVSLFSSSDTTLWCDVRLTKDGVGICLPDITLNNCTDIQYSYPQ  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +Y+VNGVPT+ WF +D++  +L  V + Q +YSR++ FD +   I +V+DV  +++P
Sbjct  104  GKKSYMVNGVPTSGWFSVDYDKNELAQVTVTQAIYSRTNAFDSSASPIYSVDDVKTQIKP  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              LWLN+QHD FY QHNLSMR +VLSVS+RV++NY+SSPE+ FL  IA R     TKL+F
Sbjct  164  GALWLNIQHDIFYRQHNLSMRNYVLSVSKRVIVNYLSSPELAFLSGIAPRFRNTKTKLIF  223

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D TEPSTNQTYG LL NL  IKTFASGILVPK+YIWP   S +YL+P TS+V
Sbjct  224  RFLGKDTTEPSTNQTYGLLLNNLTFIKTFASGILVPKNYIWPT-TSDNYLRPYTSIV  279



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 180/240 (75%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA LTS+ +V++WCD+QLTKDG GICFP + + NASN+   + +
Sbjct  43   GGFSGLFPDSSIDAYNFAMLTSVEDVVLWCDLQLTKDGAGICFPGLTMSNASNIEAAYPN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + +TYLVNGV T  WF IDF+ K L  VNL +G+ SRS RFDG    ILTV+DV  +++P
Sbjct  103  RTNTYLVNGVSTQGWFTIDFSLKDLNKVNLIRGILSRSERFDGNGYSILTVQDVNTELKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQH++FY+QHNLSM TF+ + S+ V+I++ISSPEVNF K IA R        VF
Sbjct  163  QGLWLNVQHEAFYAQHNLSMTTFLTTASKTVIIDFISSPEVNFFKKIAGRFGREGPIFVF  222

Query  542  RFLGN---DETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     ++ EP+TN++YGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV
Sbjct  223  RFLEKETXEQFEPTTNRSYGSILSNLTFVKTFASGILVPKSYVLPLDD-KQYLLPSTSLV  281



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 182/237 (77%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S  + I++CDV+LTKDG+G+C P+IK+DN +N+   +  
Sbjct  43   GGFSGLFPDSSEFAYQFAMIASSPDTILYCDVRLTKDGLGVCLPEIKMDNCTNIPDFYPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +YLVNGV TT WF +D+N  +L+ V+L+Q ++SR+ RFD +   +L VEDV +K +P
Sbjct  103  GKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQSIFSRTPRFDPSFFPLLAVEDVASKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLN+QHD FYSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ R++   TKL+F
Sbjct  163  PGMWLNIQHDGFYSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRVS-NNTKLMF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST +TYGS+L+NL  IKTFASGILVPK YIWPV    +YLQP TS+V
Sbjct  222  RFLDEATLEPSTKETYGSMLKNLTFIKTFASGILVPKKYIWPV-SPDNYLQPYTSIV  277



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 182/237 (77%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S  + I++CDV+LTKDG+G+C PDIK+DN +N+   +  
Sbjct  43   GGFSGLFPDSSEFAYQFAMIASSPDTILYCDVRLTKDGLGVCLPDIKMDNCTNIPDFYPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +YLVNGV TT WF +D+N  +L+ V+L+Q ++SR+ RFD +   +L VEDV +K +P
Sbjct  103  GKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQSIFSRTPRFDPSFFPLLAVEDVASKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLN+QHD FYSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ R++   TKLVF
Sbjct  163  PGMWLNIQHDGFYSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRVS-NNTKLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST +TYGS+L+NL  IKTFASGILVPK YIWPV    +YLQP TS+V
Sbjct  222  RFLDEATLEPSTKETYGSMLKNLTFIKTFASGILVPKKYIWPV-SPDNYLQPYTSIV  277



>ref|NP_001168748.1| uncharacterized protein LOC100382543 precursor [Zea mays]
 gb|ACN30591.1| unknown [Zea mays]
Length=747

 Score =   290 bits (741),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 178/237 (75%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA L S  + I++CDV+LTKD +GIC PDIK+DN +N+   +  
Sbjct  43   GGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDEIGICLPDIKMDNCTNIPDFYAQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +YLVNGVPT+ WF +D+N  +L  V L+Q + SR+ RFD +   +L VEDV +K +P
Sbjct  103  GQKSYLVNGVPTSGWFSVDYNGTELEQVTLKQSINSRTPRFDSSFFPLLAVEDVQSKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G+WLNVQHDSFYSQ NLSMR +++SVS+RVV+NYISSPEV+FL S+  RI+ + TKLVF
Sbjct  163  SGIWLNVQHDSFYSQFNLSMRNYIISVSKRVVVNYISSPEVSFLTSLLGRISNK-TKLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGS+L+NL  + TFASGILVPK YIWP     +YLQ  TS+V
Sbjct  222  RFLDESSLEPSTNQTYGSMLKNLTFVSTFASGILVPKGYIWP-HSPDNYLQQYTSVV  277



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   290 bits (741),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 180/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+++V++WCDVQLTKD +GICFPD+ + NAS++  ++  
Sbjct  47   GGFSGLFPDSSYDAYNFAMLTSVSDVVLWCDVQLTKDALGICFPDLTMSNASSIEVVYPT  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +Y VNGVPT+ WF IDF+ K L  VNL +G+ SRS +FDG    I+TV+ V  +++P
Sbjct  107  RQKSYPVNGVPTSGWFTIDFSLKDLKAVNLIRGILSRSEKFDGNSNPIMTVQSVATQMKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+Q NLSM +F+++ S+ V I++ISSPEVNF + I+ R       LVF
Sbjct  167  SFFWLNVQHDAFYAQQNLSMSSFLIAASKTVPIDFISSPEVNFFRKISGRFGRNGPSLVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +E EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  227  RFLRQEEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-QQYLLPPTSLV  282



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   290 bits (741),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P++ ++N +N+  ++  
Sbjct  56   GGFSGVFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLPELTINNGTNIQVVYPQ  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  YLVNGVPT+ WF +D++ K L+LV+L Q V+SR+ +FD +   IL VEDV  +V P
Sbjct  116  GEKNYLVNGVPTSGWFSVDYSIKDLSLVSLLQDVFSRTDKFDASLFPILAVEDVQKQVTP  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+QHD FY QHNLSMR+++LS+S+RV+++Y+SSPEV FL+SIA       TK +F
Sbjct  176  PALWLNIQHDMFYRQHNLSMRSYLLSLSKRVILSYVSSPEVIFLRSIAGTFRRTKTKFIF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGSLL+NL  IKTFASGILVPK YIWPV  S  YLQP TS+V
Sbjct  236  RFLDEATIEPSTNQTYGSLLKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPHTSIV  291



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 175/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA   SL +VI+WCDVQLTKD VGICFPD+ L NASN+  ++  
Sbjct  56   GGFSGLFPDSSLAAYQFAMQASLADVILWCDVQLTKDEVGICFPDLNLANASNIQDVYST  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ +Y VNGV T  WFPIDF+  +L  V+L +G++SRS RFDG+   ILT++DV  ++ P
Sbjct  116  RRKSYRVNGVTTQGWFPIDFSLTELQNVSLIRGIFSRSERFDGSGFAILTIQDVNTQLLP  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY Q NLSM +F+LSVSR V I++ISSPEVNF + IA R        VF
Sbjct  176  KGFWLNVQHDAFYEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFRKIAGRFGRNGPSFVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FL  ++ EP+ N+TYGS+L NL  +KTFASGILVPKSYI P+D+   YL P TSLV
Sbjct  236  QFLRKEDFEPTMNRTYGSILSNLTFVKTFASGILVPKSYILPIDE-EQYLVPHTSLV  291



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P++ ++N +N+  ++  
Sbjct  56   GGFSGIFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLPELTINNGTNIQVVYSQ  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  YLVNGVPT+ WF +D++ K L+ V+L QGV+SR+ +FD +   IL VEDV  +V+P
Sbjct  116  GEKNYLVNGVPTSGWFSVDYSIKDLSQVSLIQGVFSRTDKFDASLFPILAVEDVQKQVRP  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+QHD FY QHNLSMR+++LS+S+RV+++Y+SSPEV FL SIA       TK +F
Sbjct  176  PALWLNIQHDMFYRQHNLSMRSYLLSLSKRVILSYVSSPEVIFLSSIAGTFKRTKTKFIF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYG+LL+NL  IKTFASGILVPK YIWPV  S  YLQP TS+V
Sbjct  236  RFLDEATIEPSTNQTYGALLKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPYTSVV  291



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 175/237 (74%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGICFP + + N SNV   +  
Sbjct  58   GGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGICFPYVTMYNDSNVQEAYPK  117

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+++YL+NGVPT  WF +DF  + L  V L +GV SRS+ FD T   I TV++V ++ +P
Sbjct  118  KKNSYLLNGVPTQDWFTVDFTSRDLNTVFLTRGVLSRSNAFDNTQNVISTVQEVASEFKP  177

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM +F+L+VS+ V+I+Y+SSPEV+F ++I  R      K VF
Sbjct  178  AGFWLNVQHDAFYTQHNLSMSSFLLTVSKTVIIDYLSSPEVSFFRNIGGRFGKTGPKFVF  237

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL++NL  IKTFASG+LVPKSYIWPV     YL P TS V
Sbjct  238  RFLDKDDVEVSTNQTYGSLMKNLTFIKTFASGVLVPKSYIWPV--KDQYLLPHTSFV  292



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 178/237 (75%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA  TS+ + ++WCD+QLTKDG GICFPD+ + NASNV +++  
Sbjct  47   GGFSGLFPDSSLDAYNFAMQTSVLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             QSTY VNGVPT  WF ID + + LT V+L +G+ SRS +FDG    I TV+ V  +++P
Sbjct  107  GQSTYPVNGVPTPGWFTIDLSLRALTNVSLIRGILSRSDKFDGNGYTISTVQTVNKEMKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM  F++SV++ V++++ISSPEVNF + IA R        VF
Sbjct  167  QGFWLNVQHDAFYAQHNLSMSNFLVSVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  ++ EP+TN+TYGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV
Sbjct  227  RFLEKEQFEPTTNRTYGSILSNLTFVKTFASGILVPKSYVLPLDD-KQYLLPSTSLV  282



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 179/238 (75%), Gaps = 1/238 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY FA  T L N+I WCDVQLTKD  GICFPDIKL+NA+++   F +
Sbjct  50   GGFSGIFPDSSDLAYIFAVRTGLKNLIAWCDVQLTKDRQGICFPDIKLENATDINYAFPN  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            +  TY VNGVPTTA+F +D+  + L + V L QG YSR++ FD    +ILTV D+  +  
Sbjct  110  RSQTYPVNGVPTTAYFAVDYTLEDLRSYVVLTQGDYSRTNLFDYNLFEILTVSDLVKRAA  169

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPGLWLN+QHD FY++HNLSM+ ++LSVSR V ++YISSPE  FL+SI ++IN R TKLV
Sbjct  170  PPGLWLNIQHDLFYTKHNLSMKNYILSVSRTVNVSYISSPEAGFLRSIRTQINQRKTKLV  229

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  ++ +PST+  YGSLL+NL SIK FASGILVPK YIWPV  ++ YL   TSLV
Sbjct  230  FRFLKKNDVDPSTSLMYGSLLKNLTSIKAFASGILVPKEYIWPVHPTNLYLLSHTSLV  287



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 178/237 (75%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA  TS+ + ++WCD+QLTKDG GICFPD+ + NASNV +++  
Sbjct  47   GGFSGLFPDSSLDAYNFAMQTSVLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             QSTY VNGVPT  WF ID + + LT V+L +G+ SRS +FDG    I TV+ V  +++P
Sbjct  107  GQSTYPVNGVPTPGWFTIDLSLRALTNVSLIRGILSRSDKFDGNGYTISTVQTVNKEMKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM  F++SV++ V++++ISSPEVNF + IA R        VF
Sbjct  167  QGFWLNVQHDAFYAQHNLSMSNFLVSVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  ++ EP+TN+TYGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV
Sbjct  227  RFLEKEQFEPTTNRTYGSILSNLTFVKTFASGILVPKSYVLPLDD-KQYLLPSTSLV  282



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 180/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S  + +++CDV+LTKDG+G+C PDIK+DN +N+   +  
Sbjct  43   GGFSGLFPDSSEFAYQFAMIASSPDTVLYCDVRLTKDGLGVCLPDIKMDNCTNIPDFYPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +YLVNGV TT WF +D+N  +L+ V+L+Q ++SR+ RFD +   +L VEDV +K +P
Sbjct  103  GKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQAIFSRTPRFDPSFFPLLAVEDVASKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLN+QHD FYSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ RI+   TKLVF
Sbjct  163  PGMWLNIQHDDFYSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRISNN-TKLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST  TYGS+L+NL  IKTFASGILVPK Y+WPV    +YLQ  TS+V
Sbjct  222  RFLDEATLEPSTKDTYGSMLKNLTFIKTFASGILVPKKYVWPV-SPDNYLQMYTSIV  277



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 180/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S  + +++CDV+LTKDG+G+C PDIK+DN +N+   +  
Sbjct  43   GGFSGLFPDSSEFAYQFAMIASSPDTVLYCDVRLTKDGLGVCLPDIKMDNCTNIPDFYPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +YLVNGV TT WF +D+N  +L+ V+L+Q ++SR+ RFD +   +L VEDV +K +P
Sbjct  103  GKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQAIFSRTPRFDPSFFPLLAVEDVASKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLN+QHD FYSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ RI+   TKLVF
Sbjct  163  PGMWLNIQHDDFYSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRISNN-TKLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST  TYGS+L+NL  IKTFASGILVPK Y+WPV    +YLQ  TS+V
Sbjct  222  RFLDEATLEPSTKDTYGSMLKNLTFIKTFASGILVPKKYVWPV-SPDNYLQMYTSIV  277



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 176/237 (74%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD +GICFPD+K+ NASN+  ++  
Sbjct  57   GGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAIGICFPDVKMMNASNIQVVYPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YL+NGVPT  WF IDF  K L  V L +G+ SRS  FDG    I TV+D+  +++ 
Sbjct  117  RKNSYLLNGVPTQDWFTIDFTLKDLKSVFLIRGIMSRSDAFDGNGYTISTVQDIATQLKL  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLS+ +F+LS ++ V +NY+SSPEVNF ++I SR   +  K VF
Sbjct  177  QSFWLNVQHDAFYAQHNLSISSFLLSATKTVTVNYLSSPEVNFFRNIGSRFGRKGPKFVF  236

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V
Sbjct  237  RFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVV  291



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 175/237 (74%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGICFP + + N SNV   +  
Sbjct  58   GGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGICFPYVTMYNDSNVQDAYPK  117

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+++YL+NGVPT  WF +DF  + L  V L +GV SRS+ FD T   I TV++V ++ +P
Sbjct  118  KKNSYLLNGVPTQDWFTVDFTSRDLNTVFLTRGVLSRSNAFDNTQNVISTVQEVASEFKP  177

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM +F+L+VS+ V+I+Y+SSPEV+F ++I  R      K VF
Sbjct  178  AGFWLNVQHDAFYTQHNLSMSSFLLTVSKTVIIDYLSSPEVSFFRNIGGRFGKTGPKFVF  237

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL++NL  IKTFASG+LVPKSYIWPV     YL P TS V
Sbjct  238  RFLDKDDVEVSTNQTYGSLMKNLTFIKTFASGVLVPKSYIWPV--KDQYLLPHTSFV  292



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 177/237 (75%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYSF   TS+++ ++WCDVQLTKDG+GICFPD+ + NASN+   + +
Sbjct  53   GGFSGLLPDSSLDAYSFVSQTSVSDAVLWCDVQLTKDGIGICFPDLTMMNASNIQDAYPN  112

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YLVNGV T  WF IDF  K L  V L +G+ SRS  FD     I TV+DV  +++P
Sbjct  113  RKNSYLVNGVTTQDWFTIDFTSKDLRSVFLIRGILSRSDAFDNNRYTISTVQDVAKQLKP  172

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM TF+LSVS+ V I+Y+SSPEVNF ++I SR   +  K VF
Sbjct  173  VGFWLNVQHDAFYAQHNLSMSTFLLSVSKTVTIDYLSSPEVNFFRNIGSRFGKKGPKFVF  232

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STN TYGSL++NL  +KTFASG++VPKSYIWPV+  S YL P TS V
Sbjct  233  RFLEKDDVEVSTNLTYGSLVKNLTFVKTFASGVMVPKSYIWPVE--SLYLLPHTSFV  287



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 185/240 (77%), Gaps = 6/240 (3%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY+FA + S+ +VI+WCDVQLTKDGVGIC PD++LDNA++ + +   
Sbjct  48   GGFSGLFPDSSGVAYNFAAIVSVPDVILWCDVQLTKDGVGICLPDLRLDNATDASVILGT  107

Query  182  KQS-TYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             ++ +Y VNGV  +  F +D++FK+L  V++ QG+Y+RS++FDG    ILT EDV N+ +
Sbjct  108  TRTRSYSVNGVSMSGLFTVDYDFKELENVSVVQGIYTRSTKFDGNQFIILTPEDVANQFK  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSV--SRRVVINYISSPEVNFLKSIASRINPRVTK  532
            P G WLN+QHD F++QHN+SMR FVLSV  +R  ++NYISSPEV FL+SIA+R+ PR TK
Sbjct  168  PRGFWLNIQHDVFFTQHNVSMRNFVLSVIRTRSTIVNYISSPEVGFLRSIAARV-PRTTK  226

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            L+ RFLG  + E +TNQTY SL QNL  IKTFASGILVPK+YIWP +   SYLQ  TSLV
Sbjct  227  LILRFLGPTDREITTNQTYDSLKQNLTFIKTFASGILVPKTYIWPTE--DSYLQAQTSLV  284



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   285 bits (729),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 180/238 (76%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GG SG+FPDSS  AY  A   SL N+I+WCDVQLTKDG GIC  +IKL+NA+++  +F++
Sbjct  49   GGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTKDGEGICISNIKLENATDIDKIFEN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            +  TY VNGV T+A+F +D+   +L + V L QG ++R+  FD    +ILTV ++     
Sbjct  109  RSKTYSVNGVQTSAYFAVDYTLTELRSNVLLIQGDFARNPNFDDN-FEILTVNEMITITP  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
              G WLN+Q+D+FY+QHNLSM+ FVLSVSR V ++YISSPE  FL+SI + INPR+TK+V
Sbjct  168  ASGPWLNIQYDAFYAQHNLSMKNFVLSVSRTVNVSYISSPEAGFLRSIKAHINPRITKVV  227

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  DE +PSTN+TYGSLL+NLASIKTFASGILVPK YIWPVD +  YL P TSLV
Sbjct  228  FRFLEKDEVDPSTNRTYGSLLKNLASIKTFASGILVPKGYIWPVDPTGLYLLPHTSLV  285



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   286 bits (733),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 180/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY FA + S ++ I++CDV+LTKDG+GIC PDIK+DN +N+   ++ 
Sbjct  44   GGFSGIFPDSSEFAYQFALIASSSDTILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQ  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
               +YLVNGV T  WF +D+N  +L  V+L+Q ++SR+ RFD +   IL VED+ +K +P
Sbjct  104  GSKSYLVNGVSTAGWFSVDYNGTELGQVSLKQSIFSRTPRFDRSFFPILAVEDIASKFKP  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLNVQHDSFYSQ NLSM  ++LSVS+RV++ YISSPEV+FL  ++ ++    TKLVF
Sbjct  164  PGLWLNVQHDSFYSQFNLSMTNYILSVSKRVIVGYISSPEVSFLTKVSGKVRNN-TKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST QTYGS+L+NL  +KTFASGI+VPK+YIWPV    +YL+P TS+V
Sbjct  223  RFLDESTIEPSTKQTYGSMLKNLTFVKTFASGIIVPKNYIWPV-SPDNYLEPYTSVV  278



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 176/238 (74%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AY F    SL NVI+WCDVQLTKD  GIC P++KL+NA+++A   K 
Sbjct  51   GGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQLTKDSQGICVPNVKLENATDIAQNNKY  110

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            K  +Y VNGV T  +F  D+  K+L + V L QG YSR +   G   +ILTV+DV     
Sbjct  111  KSKSYQVNGVQTDGYFSADYTLKELRSNVFLVQGDYSRPTL--GGVFEILTVKDVVKTTF  168

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P GLWLN+QHD+FY+QHNLSM+ F+  V   V ++YISSPE  FLKSI + INP++TKLV
Sbjct  169  PQGLWLNIQHDAFYTQHNLSMKNFIRFVYTTVNVSYISSPEAGFLKSIKTDINPKITKLV  228

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFLG +E +PST QTYGSLLQNL  IKTFASGILVPK YIWPVD +S YLQP TSLV
Sbjct  229  FRFLGKEEVDPSTKQTYGSLLQNLTFIKTFASGILVPKDYIWPVDPTSHYLQPHTSLV  286



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 177/237 (75%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS ++YSF   TS+   ++WCD+QLTKD +GICFPD+K+ NASN+  +F  
Sbjct  57   GGFSGLFPDSSLDSYSFVAQTSVQGTVLWCDLQLTKDAIGICFPDVKMMNASNIQVVFPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YL++GV T  WF IDFNFK L  V L +G+ SRS  FDG    I TV+D+  +++P
Sbjct  117  QKNSYLLDGVLTQDWFTIDFNFKDLKNVFLIRGMLSRSDAFDGNNYAISTVQDIATQLKP  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQH++FY+QHNLS+ +F+LS  + V I+Y+SSPEVNF ++I SR+  +  K VF
Sbjct  177  KSFWLNVQHEAFYAQHNLSISSFLLSAPKTVTIHYLSSPEVNFFRNIGSRLGRKGPKFVF  236

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V
Sbjct  237  RFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVV  291



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 181/240 (75%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY+ A  TS  NVI+WCDVQLTKDG GICFP++KLDNA++++ +++ 
Sbjct  47   GGFSGIFPDSSSLAYNLALNTSSPNVILWCDVQLTKDGTGICFPELKLDNATDISVVYQG  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   + V+GVPT  WF +D+NF++L  V+L QGVYSR++ FDG    IL VE+V N ++ 
Sbjct  107  KAKDHFVSGVPTRGWFSVDYNFQELANVSLVQGVYSRTNVFDGNKLPILHVEEVANLIKS  166

Query  362  P--GLWLNVQHDSFYSQHNLSMRTFVLS-VSRRVVINYISSPEVNFLKSIASRINPRVTK  532
            P  GLWLN+QHDSF+ Q NLS+ TF+ S V++ V ++YISSP+V FLK + S  +   T 
Sbjct  167  PSTGLWLNIQHDSFFKQQNLSVETFLRSLVAKNVTVSYISSPDVGFLKRVKSIFSHGTTS  226

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            L+FR L   + EP+TNQ+YG LL+NLA IK FASGILVPK YIWPVD SS YLQP TSLV
Sbjct  227  LIFRVLEQSKIEPTTNQSYGKLLKNLAQIKAFASGILVPKGYIWPVD-SSLYLQPHTSLV  285



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 174/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+ +  +WCDVQLTKD +GICFPD+ + NAS +  ++  
Sbjct  48   GGFSGLFPDSSYDAYNFAMLTSVPDAALWCDVQLTKDALGICFPDLNMANASTIDGVYPK  107

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y VNGVPT  WF IDF+ K L  VNL +G+ SRS RFD     ILTV+ V  +++P
Sbjct  108  GQKSYSVNGVPTQGWFTIDFSLKDLKNVNLIRGILSRSERFDTNVNPILTVQSVATQIKP  167

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLSM +F+++ S+ V I++ISSPEVNF + IA R        VF
Sbjct  168  SFFWLNVQHDAFYAQHNLSMSSFLIAASKTVPIDFISSPEVNFFRKIAGRFGRNGPSFVF  227

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG +E EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  228  RFLGQEEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-QLYLLPPTSLV  283



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+ + ++WCDVQLTKD  GICFPD+ + NASN+  + K+
Sbjct  47   GGFSGLFPDSSYDAYNFAMLTSVPDAVLWCDVQLTKDAFGICFPDLTMSNASNIEAVHKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +  +Y VNGVPT   F +DF+ K L  VNL +G+ SRS +FD     I+TV+ V  +++P
Sbjct  107  RLKSYSVNGVPTQGRFTLDFSLKDLKDVNLIRGILSRSEKFDDNVNPIMTVQSVATQIKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P  WLNVQHD+FY+Q NLSM +F+++ S+ V+I++ISSPEVNF K IA R   +    VF
Sbjct  167  PLFWLNVQHDAFYAQQNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRKGPSFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTT  703
            RFLG +E EP+TN+TYGS+L NL  +KTFASGILVPKSY+ P+D+    L PT+
Sbjct  227  RFLGQEEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYVLPLDEEQYLLAPTS  280



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 180/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY FA + S  + I++CDV+LTKDG+GIC PDIK+DN +N+   ++ 
Sbjct  43   GGFSGIFPDSSEFAYQFALIASSPDTILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +YLVNGV T  WF +D+N  +L  V+L+Q ++SRS RFD +   IL VED+ +K +P
Sbjct  103  GRKSYLVNGVSTAGWFSVDYNGTELGQVSLKQSIFSRSPRFDPSFFPILAVEDIASKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLNVQHDSFYSQ NLSM  ++ SVS+RV+++YISSPEV+FL  ++ +++   T+LVF
Sbjct  163  PGMWLNVQHDSFYSQFNLSMSNYIFSVSKRVIVDYISSPEVSFLTKVSGKLSNN-TRLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST QTYGS+L+NL  +KTFASGI+VPK YIWPV    +YL+P TS+V
Sbjct  222  RFLDESTIEPSTKQTYGSMLKNLTFVKTFASGIIVPKKYIWPV-SPDNYLEPHTSVV  277



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS++AY+FA LTS+ + ++WCDVQLTKD +GICFPD+ + NASN+  + K+
Sbjct  47   GGFSGLFPDSSYDAYNFAMLTSVPDAVLWCDVQLTKDALGICFPDLTMSNASNIEVVHKN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +  +Y VNGVPT   F +DF+ K L  VNL +G+ SRS +FD     I+TV+ V  +++P
Sbjct  107  QLKSYSVNGVPTQGLFTLDFSLKDLKDVNLIRGILSRSEKFDDNANPIMTVQSVATQIKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P  WLNVQHD+FY+Q NLSM +F+++ S+ V I++ISSPEVNF K IA R   +    VF
Sbjct  167  PLYWLNVQHDAFYAQQNLSMSSFLVAASKTVFIDFISSPEVNFFKKIAGRFGRKGPSFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTT  703
            RFLG +E EP+TN+TYGS+L NL  +KTFASGILVPKSY+ P+D+    L PT+
Sbjct  227  RFLGQEEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYVLPLDEEQYLLAPTS  280



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 180/237 (76%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY FA + S  + I++CDV+LTKDG+GIC PDIK+DN +N+   ++ 
Sbjct  43   GGFSGIFPDSSEFAYQFALIASSPDTILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQ  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +YLVNGV T  WF +D+N  +L  V+L+Q ++SRS RFD +   IL VED+ +K +P
Sbjct  103  GRKSYLVNGVSTAGWFSVDYNGTELGQVSLKQSIFSRSPRFDPSFFPILAVEDIASKFKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PG+WLNVQHDSFYSQ NLSM  ++LSVS+RV+++YISSPEV+FL  ++ +++   T+LVF
Sbjct  163  PGMWLNVQHDSFYSQFNLSMSNYILSVSKRVIVDYISSPEVSFLTKVSGKLSNN-TRLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPST QTYGS+L+N   +KTFASGI+VPK YIWPV    +YL+P TS+V
Sbjct  222  RFLDESTIEPSTKQTYGSMLKNFTFVKTFASGIIVPKKYIWPV-SPDNYLEPHTSVV  277



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   285 bits (728),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 166/232 (72%), Gaps = 2/232 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AYSFA  TS+   ++WCDVQLTKDG GICFPD+ + NAS +   +  
Sbjct  47   GGFSGLFPDSSLDAYSFAMQTSVAGAVLWCDVQLTKDGAGICFPDLTMSNASTIDVAYPT  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q TY VNGVPT  WF IDF+ K L  V L +G+ SRS +FDG    I TV+ V   ++P
Sbjct  107  RQKTYTVNGVPTQNWFTIDFSLKDLKSVFLVRGILSRSDKFDGNGYAISTVQTVSTLLKP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM  F+LS S+  +I++ISSPEVNF K IA R   +    VF
Sbjct  167  EGFWLNVQHDAFYAQHNLSMSNFLLSASKTAIIDFISSPEVNFFKKIAGRFGRKGPTFVF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQP  697
            RFLG +E EP+TNQTYGS+L NL  +KTFAS ILVPKSY+ PV K   YL P
Sbjct  227  RFLGTEEFEPTTNQTYGSILSNLTFVKTFASAILVPKSYVLPVAK--QYLVP  276



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   286 bits (731),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 174/238 (73%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +A+ F    S  +  +WC+VQLTKD VGIC PDIKLDN +N+A ++  
Sbjct  98   GGFSGLFPDSSLDAFLFGVSVSSNDSFLWCNVQLTKDNVGICVPDIKLDNCTNIANVYPG  157

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++  Y+VNGV T  WF +D+   +L   V+L Q +YSR+  FD T   IL V+DV  +V+
Sbjct  158  REKVYVVNGVRTPGWFSVDYKATELAQSVSLIQAIYSRTFVFD-TMFPILAVDDVVTQVR  216

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPGLWLN+QHD FY QHNLSMR++VLSV +RV++NYISSPEVNFL SI  R     TKLV
Sbjct  217  PPGLWLNIQHDIFYQQHNLSMRSYVLSVFKRVIVNYISSPEVNFLTSIEKRFRQSTTKLV  276

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EPSTNQTY  LL+NL  IKTFASGILVPK YIWPV    +YLQP TS+V
Sbjct  277  FRFLNEDIAEPSTNQTYSLLLKNLTFIKTFASGILVPKHYIWPV-TPDNYLQPYTSIV  333



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   285 bits (728),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 180/238 (76%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GG SG+FPDSS  AY  A   SL N+I+WCDVQLTKDG GIC  +IKL+NA+++  +F++
Sbjct  49   GGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTKDGEGICISNIKLENATDIDKIFEN  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            +  TY VNGV T+A+F +D+   +L + V L QG ++R+  FD    +ILTV ++     
Sbjct  109  RSKTYSVNGVQTSAYFAVDYTLTELRSNVLLIQGDFARNPNFDDN-FEILTVNEMITITP  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
              G WLN+Q+D+FY+QHNLSM+ FVLSVSR V ++YISSPE  FL+SI + INPR+TK+V
Sbjct  168  ASGPWLNIQYDAFYAQHNLSMKNFVLSVSRTVNVSYISSPEAGFLRSIKAHINPRITKVV  227

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  DE +PSTN+TYGSLL+NLASIKTFASGILVPK YIWPVD +  YL P TSLV
Sbjct  228  FRFLEKDEVDPSTNRTYGSLLKNLASIKTFASGILVPKGYIWPVDPTGLYLLPHTSLV  285



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   285 bits (728),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 177/239 (74%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY  A  TSL +V +WCDVQLTKD  GI  P++ L N++ ++    +
Sbjct  51   GGFSGIFPDSSGAAYGLALETSLPDVALWCDVQLTKDASGIFLPNVNLLNSNYISFAIPN  110

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K + Y VNGV T  +F +D+  K L+ V L QGV+SRS+  D     ILTV DV   V P
Sbjct  111  KTTNYSVNGVSTRGYFSVDYTLKDLSNVLLSQGVFSRSTLLDANGYLILTVNDVVKSVAP  170

Query  362  --PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
              P LWLN+QHD+FY+QH LS+R++VLSVSR V ++YISSPEV FL+SI +R NP++TKL
Sbjct  171  QTPSLWLNIQHDAFYTQHKLSIRSYVLSVSRSVPVSYISSPEVGFLRSITTRFNPKITKL  230

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  D+T+PSTNQTYGSLL+NL  IKTFASGILVPK YIWPVD  S YLQP T+LV
Sbjct  231  VFRFLNQDDTDPSTNQTYGSLLKNLTFIKTFASGILVPKEYIWPVD-VSLYLQPHTTLV  288



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   284 bits (727),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 173/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS NAY  A  T L N + WC+V LTKDG GICFP+++L+NASN+  ++ D
Sbjct  50   GGFSGIFPDSSLNAYRLAVETGLRNSLAWCEVYLTKDGAGICFPELRLENASNIGEVYGD  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K +TY VNGV    WF +DF    L  V L+Q +Y+RS +FD T   + +V+DV ++  P
Sbjct  110  KHNTYTVNGVSVEGWFALDFTLDDLAYVQLRQRIYARSDKFDSTASSVQSVDDVVDQANP  169

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLN+ +D FYSQHNLS+R+FV+S +RR+ ++YISSPEV FL+S  SR     TKL+F
Sbjct  170  VGLWLNIPYDEFYSQHNLSVRSFVISATRRMNVSYISSPEVGFLRSTVSRFRTGPTKLIF  229

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG ++ E STNQTY SL +NL  IKTFASGILVPKSYIW VD S  YLQ  TSLV
Sbjct  230  QFLGPNDIELSTNQTYSSLAKNLTFIKTFASGILVPKSYIWVVD-SGLYLQNYTSLV  285



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   285 bits (728),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 176/238 (74%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AY F    SL NVI+WCDVQLTKD  GIC P++KL+NA+++A   K 
Sbjct  51   GGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQLTKDSQGICVPNVKLENATDIAQNNKY  110

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            K  +Y VNGV T  +F  D+  K+L + V L QG YSR +   G   +ILTV+DV     
Sbjct  111  KSKSYQVNGVQTDGYFSADYTLKELRSNVFLVQGDYSRPTL--GGVFEILTVKDVVKTTF  168

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P GLWLN+QHD+FY+QHNLSM+ F+  V   V ++YISSPE  FLKSI + INP++TKLV
Sbjct  169  PQGLWLNIQHDAFYTQHNLSMKNFIRFVYTTVNVSYISSPEAGFLKSIKTDINPKITKLV  228

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFLG +E +PST QTYGSLLQNL  IKTFASGILVPK YIWPVD +S YLQP TSLV
Sbjct  229  FRFLGKEEVDPSTKQTYGSLLQNLTFIKTFASGILVPKDYIWPVDPTSHYLQPHTSLV  286



>ref|NP_001047275.1| Os02g0588500 [Oryza sativa Japonica Group]
 dbj|BAD17453.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF09189.1| Os02g0588500 [Oryza sativa Japonica Group]
 gb|EAZ23618.1| hypothetical protein OsJ_07316 [Oryza sativa Japonica Group]
Length=749

 Score =   284 bits (727),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 176/237 (74%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY F    S  +  +WCDVQLTKDG GIC PDI++DN +N+A ++  
Sbjct  46   GGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDGAGICLPDIRMDNCTNIANVYPK  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + TY VNGV T  WF +D++   L+ VNL Q ++SR   +DGT   IL VE VF   + 
Sbjct  106  GKKTYSVNGVSTPGWFSVDYDSTGLSKVNLVQSLFSRVPYYDGT-LPILPVESVFANYKA  164

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLNVQHDSFYSQ NLSMR+++LSVS++ + +YISSPEVNFL S++ R+N + TKLVF
Sbjct  165  PAVWLNVQHDSFYSQFNLSMRSYILSVSKQYIADYISSPEVNFLTSLSGRVNKK-TKLVF  223

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            R L     EPSTNQTYGS+L+NL  IKTFASGILVPK+YIWPV +  +YLQP+TS+V
Sbjct  224  RLLNELAVEPSTNQTYGSMLKNLTFIKTFASGILVPKNYIWPVTQ-DNYLQPSTSVV  279



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY FA +TS+ +V++WCD+QLTKDG GICFP + + NAS++  ++ +
Sbjct  47   GGFSGLFPDSSLDAYKFAMITSVPDVVLWCDLQLTKDGAGICFPGLTMSNASSINGVYPN  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +YLVNGVPT  WF IDF+ + L  V L +G+ SRS +FDG    I TV+DV + ++P
Sbjct  107  RQKSYLVNGVPTQGWFTIDFSLRDLKDVTLIRGILSRSEKFDGNGYSIQTVQDV-DALKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY++HNLSM +F++S S+ V+I++ISSPEVNF + IA R        VF
Sbjct  166  QGFWLNVQHDAFYAEHNLSMSSFLVSASKTVIIDFISSPEVNFFRKIAGRFGRNGPSFVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +E EP+TN+TYGS+L NL  +KTFASGILVPKSYI P++     L  T+SLV
Sbjct  226  RFLEKEEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLNDEQYLLPQTSSLV  282



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 175/238 (74%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  
Sbjct  50   GGFSGLFPDSSAYAFQFALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPS  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++  Y VNGV T  WF +D+   +LT  V L Q +YSR   FD     IL V+DV  + +
Sbjct  110  REKVYDVNGVRTPGWFSVDYTLSELTQSVALTQAIYSRPDGFDNM-FPILAVDDV-TQFR  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPGLWLN+QHD FY +HNL+MR++VLSVSRRV++NYISSPEVNFL+SI +R     TKLV
Sbjct  168  PPGLWLNIQHDIFYRKHNLNMRSYVLSVSRRVIVNYISSPEVNFLRSIEARFRKSKTKLV  227

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EPSTNQTYG LL+NL  IKTFASGILVPK YIW V  S +YLQ  TS+V
Sbjct  228  FRFLNQDIPEPSTNQTYGLLLKNLTFIKTFASGILVPKHYIWLV-TSDNYLQSYTSIV  284



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSSFNAYSF   TS  + ++WCDVQLTKDGVGICFP + + N SNV   +  
Sbjct  58   GGFSGMFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGICFPYVTMYNDSNVRDAYPK  117

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +++YL+NGV T  WF +DF  K L  V L +GV SRS+ FD     I TV+DV  + +P
Sbjct  118  NKNSYLLNGVLTQDWFTVDFTSKDLNTVFLTRGVLSRSNAFDNNQNVISTVQDVATEFKP  177

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM +F+LSVS+ V+I+Y+SSPEV+F ++I +R      K VF
Sbjct  178  AGFWLNVQHDAFYTQHNLSMSSFLLSVSKTVIIDYLSSPEVSFFRNIGARFGKTGPKFVF  237

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYG+L++NL  IKTFASG+LVPKSYIWPV     YL P TS V
Sbjct  238  RFLDKDDVEVSTNQTYGALMRNLTFIKTFASGVLVPKSYIWPV--KDQYLLPHTSFV  292



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   282 bits (722),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (72%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYS    TS++  ++WCDVQLTKDGVGICFPD+K+ NAS++   +  
Sbjct  57   GGFSGLLPDSSVDAYSIVSQTSVSGAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YLVNGVPT  WF IDF  K L  V L +G+ SRS  FD     I TV+D+  +++P
Sbjct  117  RKNSYLVNGVPTQDWFTIDFTLKDLKSVFLIRGILSRSDAFDNNQYAISTVQDIAMELKP  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLS+  F+LS+ + V INY+SSPEV FL+SI  R      K VF
Sbjct  177  KSFWLNVQHDAFYAQHNLSISKFMLSLPKTVTINYLSSPEVTFLRSIGGRFGKAGPKFVF  236

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYG+LL NL  IKTFASG+LVPKSYIWP++    YL P TS V
Sbjct  237  RFLEKDDVEVSTNQTYGTLLGNLTFIKTFASGVLVPKSYIWPLE--DQYLSPHTSFV  291



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   282 bits (721),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (72%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYS    TS++  ++WCDVQLTKDGVGICFPD+K+ NAS++   +  
Sbjct  57   GGFSGLLPDSSVDAYSIVSQTSVSGAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++YLVNGVPT  WF IDF  K L  V L +G+ SRS  FD     I TV+D+  +++P
Sbjct  117  RKNSYLVNGVPTQDWFTIDFTLKDLKSVFLIRGILSRSDAFDNNQYAISTVQDIAMELKP  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+QHNLS+  F+LS+ + V INY+SSPEV FL+SI  R      K VF
Sbjct  177  KSFWLNVQHDAFYAQHNLSISKFLLSLPKTVTINYLSSPEVTFLRSIGGRFGKAGPKFVF  236

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ E STNQTYG+LL NL  IKTFASG+LVPKSYIWP++    YL P TS V
Sbjct  237  RFLEKDDVEVSTNQTYGTLLGNLTFIKTFASGVLVPKSYIWPLE--DQYLSPHTSFV  291



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   281 bits (720),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 173/238 (73%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSSFNAY FA  TS+    +WCDVQLTKDG GICFPD+KL+NAS V  ++ +
Sbjct  44   GGFSGLFPDSSFNAYDFAKQTSVAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPN  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            +Q TY VNGV T  WF IDF+ + L + V L +G+ SRS +F+G    I+TVEDV  +++
Sbjct  104  RQKTYSVNGVSTQGWFTIDFSLRDLISNVKLNRGILSRSEKFNGI-YAIMTVEDVTTQIK  162

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLNVQ+D+FY+QHNLSM +F++S S  V I+YISSPEVNF K IA R        V
Sbjct  163  PESFWLNVQYDAFYAQHNLSMSSFLISASTTVSIDYISSPEVNFFKKIAGRFGRNGPSFV  222

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FLG ++ EP+TN+TYGS+L NL  +KTFASGILVPKSYI P++     L P  SLV
Sbjct  223  FQFLGKEDFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLNDKQYLLLPPASLV  280



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 175/238 (74%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  
Sbjct  50   GGFSGLFPDSSAYAFQFALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPS  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++  Y VNGV T  WF +D+   +LT  V L Q +YSR   FD     IL V+DV  + +
Sbjct  110  REKVYDVNGVRTPGWFSVDYTLSELTQSVALTQAIYSRPDGFDNM-FPILAVDDV-TQFR  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPGLWLN+QHD FY +HNL+MR++VLSVSRRV++NYISSPEVNFL+SI +R     TKLV
Sbjct  168  PPGLWLNIQHDIFYRKHNLNMRSYVLSVSRRVIVNYISSPEVNFLRSIEARFRKSKTKLV  227

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EPSTNQTYG LL+NL  IKTFASGILVPK YIW V  S +YLQ  TS+V
Sbjct  228  FRFLNQDIPEPSTNQTYGLLLKNLTFIKTFASGILVPKHYIWLV-TSDNYLQSYTSIV  284



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 187/237 (79%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP  S  AY+ A +TS+ +V+++CDVQLTK+  GICFPD+ L+N+SNV  +F+ 
Sbjct  44   GGFSGLFPGFSSAAYNLALITSVPDVVLYCDVQLTKEAAGICFPDLLLNNSSNVDQVFEK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+ TY VNG PT   F ID++ K L  + + QGVYSRS++FDG    ILTVEDV  + +P
Sbjct  104  KEKTYPVNGFPTKGSFSIDYSLKDLANIFVTQGVYSRSNKFDGNMYPILTVEDVAMQFRP  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN++++ F+SQHNLSMR +VLSVS++VV+N+ISSPEV+FL SI +R++P  TKL+F
Sbjct  164  PGLWLNIENNIFFSQHNLSMRNYVLSVSKKVVVNFISSPEVDFLNSIKARVSPTTTKLIF  223

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FL   E EPSTNQTYGSLL+NL  IKTFASGI+VPK+YIWPV    +YL+P TS+V
Sbjct  224  KFLDEAEIEPSTNQTYGSLLKNLTFIKTFASGIIVPKTYIWPV-TVDNYLKPHTSIV  279



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    L   ++ I+WCDV+LTKDGVG+C P++ ++N +N+  ++  
Sbjct  21   GGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVRLTKDGVGVCLPELTINNGTNIDVVYPQ  80

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  Y VNGVPT+ WF +D++   L+ V L QGV SR++RFD +   ILTVEDV  +V+P
Sbjct  81   GKKNYPVNGVPTSGWFSVDYSINDLSPVLLMQGVLSRTNRFDAS-SVILTVEDVQKQVKP  139

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+QHD FY+QHNLSMR+++LS+S+RV++NY+SS EV FL SI        TK +F
Sbjct  140  PALWLNIQHDMFYTQHNLSMRSYLLSLSKRVILNYVSSAEVVFLSSITRTFKATKTKFIF  199

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGSL +NL  IKTFASGILVPK YIWPV  S  YLQP TS V
Sbjct  200  RFLDKAAIEPSTNQTYGSLSKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPHTSFV  255



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 174/238 (73%), Gaps = 13/238 (5%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP SS  AY F   TS+ +V++WCDVQLTK+G GICFPD+ L N+S+V  ++  
Sbjct  50   GGFSGLFPGSSSVAYDFTLSTSVPDVLLWCDVQLTKEGAGICFPDLLLSNSSDVDIIYPK  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
               TY            ID+  K L  V++ QG+YSR  RFDG   QILTVEDV   ++P
Sbjct  110  TVKTYT-----------IDYTLKDLANVSVTQGIYSRIDRFDGNGYQILTVEDVAKILKP  158

Query  362  P-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P GLWLN++++ F+SQHNLSMR FV SV R+VV+NYISSPEV FL SI   ++PR TKLV
Sbjct  159  PAGLWLNIENNIFFSQHNLSMRNFVHSVMRKVVVNYISSPEVAFLNSIKGAVSPRTTKLV  218

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFLG  E EPSTNQTYGSLL+NL  IKTFASGILVPK+YIWPV  + +YL+P TSLV
Sbjct  219  FRFLGLTEIEPSTNQTYGSLLKNLTFIKTFASGILVPKTYIWPV-TTDNYLEPHTSLV  275



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   279 bits (713),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    L   ++ I+WCDV+LTKDGVG+C P++ ++N +N+  ++  
Sbjct  56   GGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVRLTKDGVGVCLPELTINNGTNIDVVYPQ  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  Y VNGVPT+ WF +D++   L+ V L QGV SR++RFD +   ILTVEDV  +V+P
Sbjct  116  GKKNYPVNGVPTSGWFSVDYSINDLSPVLLMQGVLSRTNRFDAS-SVILTVEDVQKQVKP  174

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+QHD FY+QHNLSMR+++LS+S+RV++NY+SS EV FL SI        TK +F
Sbjct  175  PALWLNIQHDMFYTQHNLSMRSYLLSLSKRVILNYVSSAEVVFLSSITRTFKATKTKFIF  234

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGSL +NL  IKTFASGILVPK YIWPV  S  YLQP TS V
Sbjct  235  RFLDKAAIEPSTNQTYGSLSKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPHTSFV  290



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSSF AY    L S  +  +WCDV+LTKD VGIC PDIKLDN + +   F  
Sbjct  47   GGFSGLFPDSSFYAYKSVSLFSANDTTLWCDVRLTKDSVGICLPDIKLDNCTTIQYYFDK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + TY+VNG  T+ WF +D++   L  V L Q +YSR+ RFD     IL+V+DV  +VQP
Sbjct  107  GKKTYVVNGANTSGWFSVDYSISDLAPVTLTQAIYSRTYRFDSAGLPILSVDDVVTQVQP  166

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              LWLN+QHD+FY+QHNL+MR +VLS+++R+ +NY+SSPE+ FL+ IA   N   TKL+F
Sbjct  167  SSLWLNIQHDAFYTQHNLNMRNYVLSLTKRITVNYLSSPELAFLRKIAPSFNNTKTKLIF  226

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTN+TY  LL NL  I+TFASGILVPKSYIWPV    +YL P TS+V
Sbjct  227  RFLDKGIKEPSTNRTYRLLLNNLKLIRTFASGILVPKSYIWPV-TPDNYLLPYTSIV  282



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   284 bits (727),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AYSF   TS+    +WCDVQLTKDG GICFPD+KL+NAS +  ++ +
Sbjct  83   GGFSGLFPDSSLKAYSFVKQTSVAGAALWCDVQLTKDGAGICFPDLKLNNASTIDFVYPN  142

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ +YLVNGVPT  WF I+F+ ++L+ V L +G+  RS +FDG    I TV DV  +++P
Sbjct  143  RKKSYLVNGVPTQGWFTIEFSLRELSNVTLNRGILFRSEKFDGI-YPISTVGDVTTQIKP  201

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY+Q NLSM +F++S SR V I+Y+SSPEVNF K IA    P     VF
Sbjct  202  ESFWLNVQHDAFYAQQNLSMSSFLISASRNVSIDYVSSPEVNFFKKIAGDFGPNGPSFVF  261

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG +E EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  262  QFLGKEEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLD-DKQYLLPPTSLV  317



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA  TS+    +WCDVQLTKDG GICFPD+KL+NAS V  ++ +
Sbjct  44   GGFSGLFPDSSSIAYGFAKQTSVAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPN  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q TY VNGV T  WF IDF+ + L+ V L +G+ SRS +F+G    ILTVEDV  +++P
Sbjct  104  RQKTYSVNGVSTQGWFTIDFSLRDLSDVKLNRGILSRSEKFNGI-YPILTVEDVTTQIKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQ+D+FY+Q NLSM +F++S SR V I+YISSPEVNF K IA R        VF
Sbjct  163  ESFWLNVQYDAFYAQQNLSMSSFLISASRTVSIDYISSPEVNFFKKIAGRFGRNGPSFVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG ++ EP+TN+TY S+L NL  +KTFASGILVPKSYI P+D +   + P  SLV
Sbjct  223  QFLGKEDFEPTTNRTYDSILSNLTFVKTFASGILVPKSYILPLDDNQYLVLPPKSLV  279



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 169/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS NAYSFA  TS+    +WCDVQLTKDG GICFPD+KL+NAS V  ++ +
Sbjct  43   GGFSGLFPDSSLNAYSFAVQTSVPGSALWCDVQLTKDGAGICFPDLKLNNASTVEYVYPN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +Y VNGV T  WF IDF+ + L  V+L +G+ SR+ +FDG    ILTVEDV  +++P
Sbjct  103  RQKSYPVNGVSTQGWFTIDFSLRDLNDVSLIRGILSRTEKFDGI-YPILTVEDVTTQIKP  161

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+F+ Q NLSM  F++S SR V INYISSPEVNF   I+ R        VF
Sbjct  162  ESFWLNVQHDAFFEQQNLSMSKFLISASRIVSINYISSPEVNFFTKISGRFGRNGPLFVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FL  ++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P+D     + P  SLV
Sbjct  222  QFLRKEDIEPTTNQTYGSILSNLTFVKTFASGILVPKSYILPLDDKQYLVPPPKSLV  278



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   275 bits (704),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 175/240 (73%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  +Y+ A  TS  NV +WCDVQLTKDGVGICFPD KLDNA++++ ++  
Sbjct  38   GGFSGIFPDSSSPSYNLALKTSSLNVTLWCDVQLTKDGVGICFPDFKLDNATDISVVYPG  97

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   Y VN   T  WF  D+NF +L  V+L QGVYSR+++FDG+   IL VEDV   V+ 
Sbjct  98   KAKDYSVNNFSTRGWFSADYNFNELANVSLVQGVYSRTNKFDGSKYHILKVEDVAKLVKS  157

Query  362  P--GLWLNVQHDSFYSQHNLSMRTFVLSVSRR-VVINYISSPEVNFLKSIASRINPRVTK  532
            P  GLWLNVQHD+FY  HNLS++ F+LS+S + V INYISS  V+FL+ + S  + R + 
Sbjct  158  PSTGLWLNVQHDTFYKHHNLSVKKFLLSLSTKGVSINYISSTNVDFLRRVRSNSSLRKSI  217

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            L+FRFL   + EP+TNQTYG+LL+NL  I+ FASGILVPK YIWPVD S  YLQ  TS+V
Sbjct  218  LIFRFLEKHKIEPTTNQTYGALLKNLTLIRKFASGILVPKGYIWPVD-SELYLQQHTSIV  276



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   282 bits (721),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 174/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA  TS+ + +MWCDVQLTKDG GICFP + + NASN+   + +
Sbjct  46   GGFSGLFPDSSLDAYNFALQTSVADAVMWCDVQLTKDGAGICFPGLTMSNASNIEAAYPN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + +TYLV+GV T  WF IDF+ K L+ VNL +G+ SRS RFDG    I TV+ V  +++P
Sbjct  106  RTNTYLVSGVSTQGWFTIDFSLKDLSKVNLIRGILSRSDRFDGNGYTISTVQTVNIELKP  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQHD+FY+Q+NLSM  F++S S+ V I+YISSPEVNF   IA R        VF
Sbjct  166  RGLWLNVQHDAFYAQNNLSMSNFLISASKNVSIDYISSPEVNFFTKIAGRFGHNGPIFVF  225

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +  EP+TN++YGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV
Sbjct  226  RFLEKETFEPTTNRSYGSILSNLTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLV  281



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 175/239 (73%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSL--TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  175
            GGFSGLFPDSS  AY FA  TS+  T+ ++WCDVQLTKDG GICFPD+KL+NASN+  LF
Sbjct  44   GGFSGLFPDSSSVAYKFAKQTSVAGTSSVLWCDVQLTKDGHGICFPDLKLNNASNIGDLF  103

Query  176  KDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKV  355
             ++Q+ Y VNGV +  WF IDF+ + L   +L +G++SRS +FDG    ILTV+DV  ++
Sbjct  104  PNRQNFYPVNGVTSQGWFTIDFSLRDLKNASLIRGIFSRSEKFDGNGYSILTVQDVSMQI  163

Query  356  QPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            +P   WLN+QHD+FY+QHNLS+ +F++S SR V I+YISSP++NF   +  R        
Sbjct  164  KPESFWLNIQHDAFYAQHNLSISSFLISASRTVSIDYISSPKLNFFSKVKGRFWRNEPSF  223

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF+FLG +E EP+T +TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  224  VFQFLGKEEFEPTTKRTYGSILSNLTYVKTFASGILVPKSYILPLD-DKQYLLPPTSLV  281



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   281 bits (720),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 170/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY FA  TS+ + ++WCDVQLTKDG GICFPD+ + NAS +  ++  
Sbjct  44   GGFSGLFPDSSLDAYIFALQTSVADAVLWCDVQLTKDGAGICFPDLNMSNASIIEVVYPK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q TY VNGVPT  WF +DF+ K L  V L + + SRS RFDG    I TV+ V  +++P
Sbjct  104  GQKTYPVNGVPTQGWFTVDFSLKDLNKVYLIRAILSRSDRFDGNEYTISTVQTVNKELKP  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM TF++S S+ V ++Y+SSPEVNF   IA R      K VF
Sbjct  164  LGFWLNVQHDAFYAQHNLSMSTFLISASKTVSVDYLSSPEVNFFTKIAGRFGRNGPKFVF  223

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  ++ EP+TN+TYGS+L NL  +K FASGILVPKSY+ P+D    YL P+TSLV
Sbjct  224  RFLEKEQFEPTTNRTYGSILSNLTFVKNFASGILVPKSYVLPLD-DKQYLLPSTSLV  279



>gb|EMS62136.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=748

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 178/237 (75%), Gaps = 6/237 (3%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA   S  +   WCDV+LTKDGVGIC PDIK+DN + ++ LF  
Sbjct  47   GGFSGLFPDSSDPAYLFAA--SNQDSAQWCDVRLTKDGVGICLPDIKMDNCTTISDLFPK  104

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + TY VNGV TT WF +D+N   LT V L + + SR++RFDG+   ++ VE   ++ + 
Sbjct  105  GKKTYRVNGVSTTGWFSVDYNSIDLTNVTLLRAILSRTNRFDGS-FTLVQVEVALSQYKA  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P  WLNVQHDSFYSQ NLSMR+++LS+S++  ++YISSPEV+FLKS+  R+  R TKLVF
Sbjct  164  PA-WLNVQHDSFYSQFNLSMRSYILSMSKQYTVDYISSPEVSFLKSLVGRVG-RKTKLVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGS+L+NL+SIKTFASGILVPK YIWPV  + +YLQP+TS+V
Sbjct  222  RFLDEGLVEPSTNQTYGSMLKNLSSIKTFASGILVPKHYIWPV-TADNYLQPSTSVV  277



>gb|EMT15515.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=880

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 179/237 (76%), Gaps = 6/237 (3%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AYSFA   S  +   WCDV+LTKDGVGIC PDIK+DN + ++ LF  
Sbjct  46   GGFSGLFPDSSDPAYSFA--ASNQDSAQWCDVRLTKDGVGICLPDIKMDNCTTISDLFPK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + TYLVNGV TT WF +D+N   LT V L + + SR++RFDG+   ++ VE   ++ + 
Sbjct  104  GKKTYLVNGVSTTGWFSVDYNSIDLTNVTLLRAILSRTNRFDGS-FTLVQVEVALSQYKA  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P  WLNVQHDSFYSQ NLSMR+++LS+S++  ++YISSPEV+FLKS+  R+  R TKLV 
Sbjct  163  PA-WLNVQHDSFYSQFNLSMRSYILSMSKQYTVDYISSPEVSFLKSLVGRVG-RKTKLVL  220

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGS+L+NL+SIKTFASGILVPK YIWPV  + +YLQP+TS+V
Sbjct  221  RFLDEGLVEPSTNQTYGSILKNLSSIKTFASGILVPKHYIWPV-TADNYLQPSTSVV  276



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   280 bits (717),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA  TS+ + I+WCDVQLTKDG GICFPD+ + NAS +  ++  
Sbjct  44   GGFSGLFPDSSLDAYNFALQTSVADAILWCDVQLTKDGAGICFPDLNMSNASTIEVVYPK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q TY VNGVPT  WF +DF+ K L  V L +G+ SRS RFDG    I TV+ V  +++P
Sbjct  104  GQKTYPVNGVPTQGWFTVDFSLKDLNKVYLIRGILSRSDRFDGNGYTISTVQTVNIELRP  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQHD+FY+Q+NLSM  F++S S+ V I+YISSPEVNF   IA R        VF
Sbjct  164  RGLWLNVQHDAFYAQNNLSMSNFLISASKNVSIDYISSPEVNFFTKIAGRFGHNGPIFVF  223

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  +  EP+TN++YGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV
Sbjct  224  RFLEKETFEPTTNRSYGSILSNLTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLV  279



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 171/237 (72%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA LTS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ +
Sbjct  61   GGFSGLFPDSSSDAYNFAILTSVADVVLWCDVQLTKDGVGICFPDLNLANASIIKYIYPN  120

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y+VNGV T  WF ID  FK L  V L +G+ SRS +FD     I T+++V   ++ 
Sbjct  121  GQKSYMVNGVTTQGWFTIDTTFKDLENVTLNRGILSRSEKFDDV-NGISTIQNVAALIKQ  179

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY+QHNLSM  ++LSVSR   I++ISSPEVNF   IA R        VF
Sbjct  180  EGFWLNVQHDAFYAQHNLSMSNYLLSVSRTASIDFISSPEVNFFMKIAGRFGRNGPSFVF  239

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FL  ++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  240  QFLRQEDLEPTTNQTYGSILSNLTFVKTFASGILVPKSYILPLDD-QQYLLPYTSLV  295



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   273 bits (698),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 173/240 (72%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS    T   NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  
Sbjct  43   GGFSGIFPDSSSLAYSLTLDTCGPNVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPG  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNGV T  WF +D+N  +L  V++ QGVYSR+++FDG    I +VEDV   ++ 
Sbjct  103  KAKDYLVNGVSTRGWFSVDYNLAELANVSVVQGVYSRTNKFDGNKLPIRSVEDVAKLIKS  162

Query  362  P--GLWLNVQHDSFYSQHNLSMRTFVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTK  532
            P  GLWLN+QHDSF+ Q NLS+  F+ S+ ++ V +NYISSP+V+FL+ + S  +   T 
Sbjct  163  PSTGLWLNIQHDSFFKQQNLSVENFLQSLPAKSVPVNYISSPDVDFLRRVKSSFSSGPTG  222

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             +FRFL   + EP+TNQTYG LL+NL  IKTFASGILVPK YIWPVD S  YLQP T LV
Sbjct  223  FIFRFLEQSKLEPTTNQTYGELLKNLMLIKTFASGILVPKGYIWPVD-SGLYLQPHTPLV  281



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   274 bits (701),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 171/237 (72%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    L   ++ I WCDV+LTKDGVGIC P++ ++N +N+  ++  
Sbjct  58   GGFSGIFPDSSDLAYKLTYLVGSSDTISWCDVRLTKDGVGICLPELTINNGTNIQMVYPQ  117

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  YLVNGVPT+ WF +D++   L+ V L Q V SR+ +FD +   ILTVEDV  + +P
Sbjct  118  GKKNYLVNGVPTSGWFSVDYSINDLSQVLLTQEVLSRTDKFDAS-SFILTVEDVQKQAKP  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P LWLN+QHD FY+QHNLSMR++VLS+++RV++NY+SS EV FL S+A       TK +F
Sbjct  177  PALWLNIQHDMFYTQHNLSMRSYVLSLAKRVILNYVSSAEVVFLSSVARTFKGTKTKFIF  236

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RF+     EPSTNQTYGSLL+NL  IKTFASGILVPK YI+PV  S  YLQP TS V
Sbjct  237  RFIDEAAIEPSTNQTYGSLLKNLTFIKTFASGILVPKQYIYPV-TSDFYLQPHTSFV  292



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AYSFA  TS+    +WCDVQLTKDG+GICFPD+ L+NAS +  ++  
Sbjct  53   GGFSGLFPDSSLAAYSFAMQTSVAGSALWCDVQLTKDGLGICFPDLTLNNASTIEFVYPS  112

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +Y VNGV T  WF IDF+   L  V+L +G+YSRS +FD     ILTV+ V    + 
Sbjct  113  RQKSYPVNGVRTRGWFTIDFSLSDLNNVSLIRGIYSRSEKFDENGYSILTVQIVTTLKEQ  172

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY QHNLSM +F++S SR V I+YISSPE+NF + +A R        VF
Sbjct  173  EVFWLNVQHDAFYEQHNLSMSSFLISASRTVSIDYISSPELNFFRKVAGRFGRDGPIFVF  232

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG ++ EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  233  RFLGKEDFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-KQYLLPPTSLV  288



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 170/237 (72%), Gaps = 4/237 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY  A +TS  NV +WCD+QL KD +G CFP +  +N SN+  +F  
Sbjct  43   GGFSGMFPDSSIVAYDSATVTSTPNVTLWCDLQLAKDDIGFCFPHLSFENGSNIEYVFPG  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ +Y+VNGVP+  WFP+D+   +L  + L Q +YSR   FD     I TVE+V N    
Sbjct  103  QKKSYIVNGVPSKGWFPVDYTIDELFTLTLTQDIYSRPPIFDDI-YSIATVEEVANASS-  160

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              LWLN+QH +FYSQHNLSMR +VLSVS+ V ++YISSPE++FL+SI      R+TKL+F
Sbjct  161  -SLWLNIQHTAFYSQHNLSMRNYVLSVSKHVAVSYISSPEISFLQSIKKNFARRMTKLIF  219

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  DE EPS+N TYG L++NL+ I+TF+SGILVPKS+IWPVD +  YL P TSLV
Sbjct  220  RFLEQDEIEPSSNLTYGHLMKNLSYIRTFSSGILVPKSFIWPVD-AEFYLLPHTSLV  275



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 170/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS  AY+ A LTS+T+V++WCDVQLTKDG GICFPD+ + NASN+  ++ +
Sbjct  56   GGFSGLLPDSSLVAYNLATLTSVTSVVLWCDVQLTKDGAGICFPDLNMANASNIDVVYPN  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++++Y VNGV T  WF ID   + L  V L +G+ SRS +FDG    I T++ V   ++P
Sbjct  116  RKNSYPVNGVTTQGWFAIDSTLRDLQNVALIRGILSRSDKFDGNGYPISTIQSVNEHIKP  175

Query  362  PG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             G  WLNVQHD+FY Q NL M +F+LS SR V IN+ISSPEVNF K IA R        V
Sbjct  176  QGGFWLNVQHDAFYEQQNLIMSSFLLSASRTVSINFISSPEVNFFKKIAGRFKRNGPSFV  235

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FL N++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  236  FQFLRNEDFEPTTNQTYGSILGNLTFVKTFASGILVPKSYILPLD-DKQYLLPPTSLV  292



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL+PDSS  AY  A LTS+ +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +
Sbjct  56   GGFSGLYPDSSIAAYQLATLTSVADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPN  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ +Y VNGV T  WFP DF+  +L    L +G+ SR+ RFDG    I T+EDV   +  
Sbjct  116  REKSYSVNGVTTKGWFPNDFSLTELQNFLLIRGILSRTDRFDGNGYLISTIEDVVTTLNR  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY Q NLSM +F+LSVSR V I++ISSPEVNF K I           VF
Sbjct  176  EGFWLNVQHDAFYEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG ++ EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  236  QFLGKEDFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-EQYLVPHTSLV  291



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL+PDSS  AY  A LTS+ +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +
Sbjct  56   GGFSGLYPDSSIAAYQLATLTSVADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPN  115

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ +Y VNGV T  WFP DF+  +L    L +G+ SR+ RFDG    I T+EDV   +  
Sbjct  116  REKSYSVNGVTTKGWFPNDFSLTELQNFLLIRGILSRTDRFDGNGYLISTIEDVVTTLNR  175

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY Q NLSM +F+LSVSR V I++ISSPEVNF K I           VF
Sbjct  176  EGFWLNVQHDAFYEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG ++ EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  236  QFLGKEDFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-EQYLVPHTSLV  291



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY  A  T   NV +WCDVQLTKDGVGICFP++KLDNA++++  +  
Sbjct  43   GGFSGIFPDSSSLAYGLALDTCGPNVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPG  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNGV T  WF +D+NF +L  V++ QGVYSR+++FDG    ILTVE V   ++ 
Sbjct  103  KAKDYLVNGVSTRGWFSVDYNFGELANVSVVQGVYSRTNKFDGNKLPILTVEQVVKLIKS  162

Query  362  P--GLWLNVQHDSFYSQHNLSMRTFVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTK  532
            P  GLWLN QH SF+ Q NLS+  F+ S+  R V +NYISSP+V+FL+ + S  +   T 
Sbjct  163  PSTGLWLNFQHASFFKQQNLSVENFLQSLPGRSVPVNYISSPDVDFLRRVKSSFSSGPTS  222

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             +FR L   + EP+TNQTYG LL+NLA IKTF+SGILVPK YIWPVD S  YLQP T LV
Sbjct  223  FIFRILEQSKIEPTTNQTYGELLKNLALIKTFSSGILVPKGYIWPVD-SDHYLQPHTPLV  281



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY  A  T   NV +WCDVQLTKDGVGICFP++KLDNA++++  +  
Sbjct  43   GGFSGIFPDSSSLAYGLALDTCGPNVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPG  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVNGV T  WF +D+NF +L  V++ QGVYSR+++FDG    ILTVE V   ++ 
Sbjct  103  KAKDYLVNGVSTRGWFSVDYNFGELANVSVVQGVYSRTNKFDGNKLPILTVEQVAKLIKS  162

Query  362  P--GLWLNVQHDSFYSQHNLSMRTFVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTK  532
            P  GLWLN QH SF+ Q NLS+  F+ S+  R V +NYISSP+V+FL+ + S  +   T 
Sbjct  163  PSTGLWLNFQHASFFKQQNLSVENFLQSLPGRSVPVNYISSPDVDFLRRVKSSFSSGPTS  222

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             +FR L   + EP+TNQTYG LL+NLA IKTF+SGILVPK YIWPVD S  YLQP T LV
Sbjct  223  FIFRILEQSKIEPTTNQTYGELLKNLALIKTFSSGILVPKGYIWPVD-SDHYLQPHTPLV  281



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   272 bits (695),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL+PDSS  AY  A LTS+ +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +
Sbjct  78   GGFSGLYPDSSIAAYQLATLTSVADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPN  137

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ +Y VNGV T  WFP DF+  +L    L +G+ SR+ RFDG    I T+EDV   +  
Sbjct  138  REKSYSVNGVTTKGWFPNDFSLTELQNFLLIRGILSRTDRFDGNGYLISTIEDVVTTLNR  197

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             G WLNVQHD+FY Q NLSM +F+LSVSR V I++ISSPEVNF K I           VF
Sbjct  198  EGFWLNVQHDAFYEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVF  257

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG ++ EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  258  QFLGKEDFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-EQYLVPHTSLV  313



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   271 bits (694),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 175/240 (73%), Gaps = 6/240 (3%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AY  + L  L+NVI+WCDVQLTKDG GICFP + LDN+S++     +
Sbjct  48   GGFSGIFPDSSIDAYE-STLLLLSNVILWCDVQLTKDGAGICFPYLNLDNSSDITFYIPN  106

Query  182  KQST---YLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNK  352
                   Y VNG P    F +DF    L    L QG++SRS+ FD     ILTVEDV  +
Sbjct  107  DSKNNRIYYVNGQPMQGHFSVDFTLNDLKNFFLVQGIFSRSNVFDHI-LGILTVEDVAKQ  165

Query  353  VQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTK  532
            ++ PGLWLNVQ+D+F+ QHNLSMR+FVLSVSRRV ++YISSPEV FLKSI ++     TK
Sbjct  166  LKKPGLWLNVQYDAFFKQHNLSMRSFVLSVSRRVNVSYISSPEVAFLKSITTQFKRSTTK  225

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            LVFRFL  D+ EP+TNQTYGS+L+NL  +KTFAS IL+PK+YIWPV ++  YLQP TS+V
Sbjct  226  LVFRFLRADDIEPTTNQTYGSILKNLTFVKTFASAILIPKNYIWPV-RTDLYLQPHTSVV  284



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYS    T   NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  
Sbjct  43   GGFSGIFPDSSSLAYSLTLDTCGPNVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPG  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K   YLVN V T  WF +D+N  +L  V++ QGVYSR+++FDG    I +VEDV   ++ 
Sbjct  103  KAKDYLVNEVSTRGWFSVDYNLAELANVSVVQGVYSRTNKFDGNKLPIRSVEDVAKLIKS  162

Query  362  P--GLWLNVQHDSFYSQHNLSMRTFVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTK  532
            P  GLWLN+QHDSF+ Q NLS+  F+ S+ ++ V +NYISSP+V+FL+ + S  +   T 
Sbjct  163  PSTGLWLNIQHDSFFKQQNLSVENFLQSLPAKSVPVNYISSPDVDFLRRVKSSFSSGPTG  222

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             +FRFL   + EP+TNQTYG LL+NL  IKTFASGILVPK YIWPVD S  YLQP T LV
Sbjct  223  FIFRFLEQSKLEPTTNQTYGELLKNLMLIKTFASGILVPKGYIWPVD-SGLYLQPHTPLV  281



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 181/236 (77%), Gaps = 1/236 (0%)
 Frame = +2

Query  5    GFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDK  184
            GFSGLFP SS  AY+ A +TS+ +V++WCDVQLTKD  GICFPDIKLDN+SNV  +++D+
Sbjct  46   GFSGLFPPSSSYAYNLAMMTSVPDVVLWCDVQLTKDAAGICFPDIKLDNSSNVNLVYEDR  105

Query  185  QSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP  364
              TY V+G     +F IDF  ++L+ ++L QG+Y+RS  FDG+  QI  V+DVF + +PP
Sbjct  106  VKTYDVDGASVKGYFAIDFTVEELSNISLTQGIYTRSPDFDGSLFQIQLVDDVFVQNKPP  165

Query  365  GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFR  544
            G WLNVQ+D+FY QH LSMR+F++  S+RV+I++ISS +++FL+++A       TK +FR
Sbjct  166  GFWLNVQNDAFYRQHKLSMRSFLIGASKRVIISHISSSDISFLQALARPFASSKTKRIFR  225

Query  545  FLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F   D  EPSTNQT+GSLL+NL  IKTFA+GILVPK+YIWPVD ++SYL P TSLV
Sbjct  226  FFDVDAVEPSTNQTFGSLLKNLTMIKTFAAGILVPKTYIWPVD-ATSYLLPHTSLV  280



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 172/239 (72%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S+ +V++WCDVQLTKDG GICFPD+ L NASN   ++ +
Sbjct  46   GGFSGLFPDSSLAAYQFAMVVSVADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPN  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL--TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKV  355
            +Q +Y VNGV T  WFPIDF+  +L   L +L +G+ SRS +FD     I TV++V  ++
Sbjct  106  RQKSYPVNGVTTKGWFPIDFSLTELQKVLFSLIRGILSRSGKFDENGYSISTVQNVATQM  165

Query  356  QPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            +P   WLNVQHD FY QHNLSM +F+LS SR V I++ISSPEVNF + IA          
Sbjct  166  KPALFWLNVQHDEFYEQHNLSMSSFLLSTSRTVSIDFISSPEVNFFRKIAGGFGNNGPSF  225

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF+F+G ++ EP+TN+TYGS+L NL+ +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  226  VFQFMGKEDFEPTTNRTYGSILSNLSFVKTFASGILVPKSYILPLD-DKQYLLPHTSLV  283



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 172/239 (72%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA + S+ +V++WCDVQLTKDG GICFPD+ L NASN   ++ +
Sbjct  57   GGFSGLFPDSSLAAYQFAMVVSVADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPN  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL--TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKV  355
            +Q +Y VNGV T  WFPIDF+  +L   L +L +G+ SRS +FD     I TV++V  ++
Sbjct  117  RQKSYPVNGVTTKGWFPIDFSLTELQKVLFSLIRGILSRSGKFDENGYSISTVQNVATQM  176

Query  356  QPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            +P   WLNVQHD FY QHNLSM +F+LS SR V I++ISSPEVNF + IA          
Sbjct  177  KPALFWLNVQHDEFYEQHNLSMSSFLLSTSRTVSIDFISSPEVNFFRKIAGGFGNNGPSF  236

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF+F+G ++ EP+TN+TYGS+L NL+ +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  237  VFQFMGKEDFEPTTNRTYGSILSNLSFVKTFASGILVPKSYILPLD-DKQYLLPHTSLV  294



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 175/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY+ A  TS+ +V++WCDVQLTKDGVGICFPD+ + NAS V  ++ +
Sbjct  57   GGFSGLLPDSSLDAYNLAIQTSVADVVLWCDVQLTKDGVGICFPDLNMANASTVQNVYPN  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y VNGV T  WF I F+ + L  V+L +G+ SR+ +FDG    I T+++V  +++P
Sbjct  117  GQKSYPVNGVSTQGWFTIAFSLRDLQNVSLIRGILSRTDKFDGNGYTIPTIQNVTEQIKP  176

Query  362  PG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             G LWL+VQHD+FY QHNLSM +F++SVSR V I++ISSPEVNF K I           V
Sbjct  177  QGGLWLHVQHDAFYEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGHFKRNGPSFV  236

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FLG ++ EP+TN+TYGS+L NLA +KTFAS ILVPKSYI+P+D  + YL P TSLV
Sbjct  237  FQFLGKEDFEPTTNRTYGSILSNLAFVKTFASKILVPKSYIFPLD-DNQYLLPPTSLV  293



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 175/240 (73%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFPD+KLDNA++++ ++  
Sbjct  42   GGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFPDVKLDNATDISVVYPG  101

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ-  358
            K   Y VN VPT  WF  DFNFK+L +V+L QGVYSR+ +FDG+   IL+VE+V   V+ 
Sbjct  102  KAKDYSVNMVPTRGWFSFDFNFKELQIVSLVQGVYSRTPKFDGSNYYILSVENVAKLVKS  161

Query  359  -PPGLWLNVQHDSFYSQHNLSMRTFVLSVS-RRVVINYISSPEVNFLKSIASRINPRVTK  532
               GLWLNVQHD+FY  HNLS+  ++ S+S  +V I+YISSP  NFL+ +  + + + T 
Sbjct  162  SSAGLWLNVQHDTFYKHHNLSVEKYLHSLSAEKVTISYISSPNANFLQRVRKKSSLKKTV  221

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             VFRFL   + EP++N+TYG+LL++L  I+TFASGILVPKSYIW VD S  YL   TSLV
Sbjct  222  TVFRFLDQYKIEPTSNKTYGALLKHLKFIRTFASGILVPKSYIWSVD-SELYLHQHTSLV  280



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 169/237 (71%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY      SL +V++WCDVQLTKDG GIC PDI L   +++ +++  
Sbjct  10   GGFSGLFPDSSNLAYQDVVQVSLPSVVVWCDVQLTKDGAGICLPDISLQQETDINSVYGT  69

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
              ++YL+NGV    W  +DF   QL  V L Q   SR+  FD     ILTV++V N    
Sbjct  70   NNASYLINGVTKQGWLSLDFTLAQLNNVTLVQQNLSRAPYFDDA-LPILTVQEVVNIANA  128

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLNVQHD+F+S+H LSMR+F++SVSR V+INYISSPE+ FL S+ASR+    TKLVF
Sbjct  129  PGLWLNVQHDAFFSEHKLSMRSFIISVSRDVIINYISSPEIGFLHSVASRLT-NSTKLVF  187

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D+ EP+TN+TY SLL NL  I TFASGILVPK+YIWPV+ SS YL   TSLV
Sbjct  188  RFLGPDDVEPTTNETYSSLLSNLTLIGTFASGILVPKTYIWPVN-SSRYLLNYTSLV  243



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 170/239 (71%), Gaps = 4/239 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY+ A  TS+ +V++WCDVQLTKDGVGIC+PD+ L NAS V  ++ +
Sbjct  54   GGFSGLLPDSSLDAYNLAIQTSVADVVLWCDVQLTKDGVGICYPDLNLANASTVQFVYPN  113

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y VNGV T  WF ID   + L  V L +G+ SRS +FDG    ILT+++V  +++P
Sbjct  114  GQKSYPVNGVTTQGWFTIDSTLRDLQNVALIRGILSRSDKFDGNRNMILTIQNVAEQIKP  173

Query  362  P-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
              G WLNVQHD+FY QHNLSM +F+LS SR V +++ISSPEVNF   IA R        V
Sbjct  174  QGGFWLNVQHDAFYEQHNLSMSSFLLSTSRTVSMDFISSPEVNFFMKIAGRFKRNGPSFV  233

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP-VDKSSSYLQPTTSLV  712
            F+FL  +E EP+TNQTYGS+L NL  +KTFASGILVPKSYI   VDK   YL P TSLV
Sbjct  234  FQFLRKEEIEPTTNQTYGSILSNLTFVKTFASGILVPKSYILRLVDK--QYLVPHTSLV  290



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   269 bits (687),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 167/238 (70%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY+ A   S+ +V++WCDVQLTK GVGICFPD+ L NAS V   +  
Sbjct  60   GGFSGLLPDSSLDAYNLAIQKSVADVVLWCDVQLTKYGVGICFPDLNLANASTVQYAYPK  119

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y VNGV T  WF ID   + L  V L +G+ SRS RFDG    IL +++V  +++P
Sbjct  120  GQKSYPVNGVTTQGWFTIDSTMRDLQNVALIRGILSRSDRFDGNGYTILMIQNVAEQIKP  179

Query  362  PG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             G  WLNVQHD+FY +HNLSM +F+LS S+ V +++ISSPEVNF K IA R        V
Sbjct  180  QGGFWLNVQHDAFYEEHNLSMSSFLLSASKTVSMDFISSPEVNFFKKIAGRFKRNGPSFV  239

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FLG ++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  240  FQFLGKEDVEPTTNQTYGSILSNLTFVKTFASGILVPKSYILPLD-DKQYLIPHTSLV  296



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   268 bits (685),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 175/240 (73%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFPD+KLDNA++++ ++  
Sbjct  65   GGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFPDVKLDNATDISVVYPG  124

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ-  358
            K   Y VN VPT  WF  DFNFK+L +V+L QGVYSR+ +FDG+   IL+VE+V   V+ 
Sbjct  125  KAKDYSVNMVPTRGWFSFDFNFKELQIVSLVQGVYSRTPKFDGSNYYILSVENVAKLVKS  184

Query  359  -PPGLWLNVQHDSFYSQHNLSMRTFVLSVS-RRVVINYISSPEVNFLKSIASRINPRVTK  532
               GLWLNVQHD+FY  HNLS+  ++ S+S  +V I+YISSP  NFL+ +  + + + T 
Sbjct  185  SSAGLWLNVQHDTFYKHHNLSVEKYLHSLSAEKVTISYISSPNANFLQRVRKKSSLKKTV  244

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             VFRFL   + EP++N+TYG+LL++L  I+TFASGILVPKSYIW VD S  YL   TSLV
Sbjct  245  TVFRFLDQYKIEPTSNKTYGALLKHLKFIRTFASGILVPKSYIWSVD-SELYLHQHTSLV  303



>ref|XP_004973845.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Setaria italica]
Length=679

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AYSFA + S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++ 
Sbjct  57   GGFSGVFPDSSSDAYSFALIASAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQA  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ TY+++GV    WF +DF   +L  V+L Q ++SR+ RFD     IL+V D+ + V+ 
Sbjct  117  RKRTYVIDGVRKNGWFALDFTKDELQSVSLTQAIWSRTYRFDSVGYSILSVTDLLSIVKQ  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLNVQHD+FY +H L+MR ++LS+ +RV ++YISSPE+ FL++I+  ++ R TKLVF
Sbjct  177  PSVWLNVQHDTFYKEHGLNMRNYILSIQKRVSVDYISSPELGFLQNISGTVH-RKTKLVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             FL     + S NQTYGSLL NL  IK+ ASGI+VPK+YIWPV K  +YLQP+TS+V
Sbjct  236  SFLDKSLLDHSINQTYGSLLSNLTLIKSIASGIMVPKTYIWPVTK-DNYLQPSTSIV  291



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   273 bits (699),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDS  +AY  A  TS+   ++WCDVQLTKD  GIC+PD+KL+N S + +++  
Sbjct  44   GGFSGLFPDSILDAYKLAMQTSVPGAVLWCDVQLTKDDFGICYPDLKLNNHSTIESVYPK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ +YLVNGVPT  WF IDF+ + L  V+L QG+ S++ + DG    ILTV+DV  +++P
Sbjct  104  RRKSYLVNGVPTNGWFTIDFSLRDLKNVSLIQGILSQTGKIDGNGFSILTVQDVTAQIKP  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              +WLNVQHD+FY+QHNLSM +F++S SR V I+YISSPE+NF + +           VF
Sbjct  164  ESIWLNVQHDAFYAQHNLSMSSFLVSASRTVSIDYISSPELNFFQKLTGHFGRNGPSFVF  223

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FLG ++ EP+T +TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  224  KFLGKEDFEPTTKRTYGSILSNLTYVKTFASGILVPKSYILPLD-DKQYLLPPTSLV  279



>ref|NP_001169682.1| hypothetical protein precursor [Zea mays]
 gb|ACN34414.1| unknown [Zea mays]
 gb|ACN34504.1| unknown [Zea mays]
 gb|AFW62775.1| hypothetical protein ZEAMMB73_123565 [Zea mays]
Length=753

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 174/238 (73%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY F G++S  +  +WCDV+LTKDG GIC P I +DN + +A++F  
Sbjct  52   GGFSGLFPDSSDYAYQFVGISSSPDTTVWCDVRLTKDGAGICLPSINMDNCTIIASVFPQ  111

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY VNGV T  WF +D+    L   V+L+Q V SR+  +DG   QI  VE++F   +
Sbjct  112  GKKTYKVNGVSTAGWFSVDYTSTVLLQNVSLKQSVLSRTPAYDGL-FQINPVENIFTLYK  170

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             P +WLNVQHDSFYSQ  LSMR+++LS+S++ +++YISSPEVNFL SI+ R++ + TKLV
Sbjct  171  APAVWLNVQHDSFYSQFKLSMRSYILSLSKQFIVDYISSPEVNFLTSISGRVSKK-TKLV  229

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL     EPSTNQTYGS+L+NL  +KTFASGILVPKSYIWPV    +YL P TS+V
Sbjct  230  FRFLDERSIEPSTNQTYGSMLKNLTFVKTFASGILVPKSYIWPV-TPDNYLLPYTSVV  286



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 170/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY+ A  TS+ +VI+WCDV LTKDG+GICFP++ L NAS +  ++ +
Sbjct  60   GGFSGLLPDSSLDAYNLAIQTSVADVILWCDVHLTKDGIGICFPNLNLANASTIQYVYPN  119

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y VNGV T  WF ID   + L  V L +G+ SRS +FDG    I T++ V  +++P
Sbjct  120  GQKSYPVNGVITQGWFTIDSTLRDLENVTLIRGLLSRSDKFDGNGYLISTIQSVTEQIKP  179

Query  362  PG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             G  WLNVQHD+FY QHNLSM +F++SVSR V I++ISSPEVNF K I  R+       V
Sbjct  180  QGGFWLNVQHDAFYEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGRVKRNGPSFV  239

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FLG ++ EPSTN+TY S+L NLA +KTFAS ILVPKSYI+P+D    YL P TSLV
Sbjct  240  FQFLGKEDFEPSTNRTYASILSNLAFVKTFASKILVPKSYIFPLD-DKQYLLPLTSLV  296



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 166/223 (74%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY F  + S  +  + CDV+LTKDG GIC P+IK+DN + ++ +F  
Sbjct  47   GGFSGLFPDSSDLAYQFVPIASSPDTALLCDVRLTKDGAGICLPNIKMDNCTFISDVFPQ  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +STY VNGV TT WF +DF    L  V L+Q ++SR S FDG+  QI+ VE V +  + 
Sbjct  107  GKSTYNVNGVSTTGWFSVDFTSTDLQNVTLRQSIFSRPSYFDGS-MQIVPVEAVLSVFKA  165

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLNVQHDSFYSQ  LSMR+++LS+S++ + +YISSPEVNFL SI+ R++ R TKLVF
Sbjct  166  PAVWLNVQHDSFYSQFKLSMRSYILSLSKQYIADYISSPEVNFLTSISGRVSKR-TKLVF  224

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  670
            RFL     EPSTNQTYGS+L+NL  +KTFASGILVPK+YIWPV
Sbjct  225  RFLDERSIEPSTNQTYGSMLKNLTFVKTFASGILVPKNYIWPV  267



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   271 bits (692),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 170/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY+ A  TS+ +V++WCDVQLTKDGVGICFPD+ L NASN+  ++ +
Sbjct  79   GGFSGLLPDSSLDAYNLAIQTSVADVVLWCDVQLTKDGVGICFPDLNLFNASNIEDVYPN  138

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y VNGV T  WF ID   + L  V L +G++SRS +FDG    I T++ V  +++P
Sbjct  139  GQKSYPVNGVTTQGWFTIDSTLRDLQNVTLSRGIFSRSDKFDGNLYPISTIQSVTEQMKP  198

Query  362  P-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
              G WLNVQHD+FY QHNLSM +F+L  SR V +++ISSPEVNF K IA R        V
Sbjct  199  EGGFWLNVQHDAFYKQHNLSMSSFILXASRTVSMDFISSPEVNFFKKIAGRFKRNGPSFV  258

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FLG ++ EP+TNQTYG +L NL  +KT+ASGILVPKSYI+ +D    YL P TSLV
Sbjct  259  FQFLGKEDFEPTTNQTYGFILSNLTFVKTYASGILVPKSYIFQLD-DKQYLIPHTSLV  315



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 169/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY+ A  TS+  V++WCDVQLTKDG GICFP++ + NASN+  ++ +
Sbjct  54   GGFSGLLPDSSLDAYNLAIQTSVAEVVLWCDVQLTKDGAGICFPELNMANASNIDFVYPN  113

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q +Y VNGV T  WF ID   + L  V L +G+ SRS++FDG    I T+++V  +++P
Sbjct  114  GQKSYPVNGVTTQGWFAIDSTLRDLQNVILTRGILSRSNKFDGNGYTIPTIQNVTEQMKP  173

Query  362  PG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             G  WLNVQHD+FY QHNLSM +F+L  SR V +++ISSPEVNF K IA R        V
Sbjct  174  EGGFWLNVQHDAFYEQHNLSMSSFILXASRTVSMDFISSPEVNFFKKIAGRFKRNGPSFV  233

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FLG ++ EP+TNQTYG +L NL  +KTFASGILVPKSYI+ +D    YL P TSLV
Sbjct  234  FQFLGKEDFEPTTNQTYGFILSNLTFVKTFASGILVPKSYIFQLD-DKQYLIPHTSLV  290



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AYSFA + S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++ 
Sbjct  57   GGFSGVFPDSSSDAYSFALIASAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQA  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ TY+++GV    WF +DF   +L  V+L Q ++SR+ RFD     IL+V D+ + V+ 
Sbjct  117  RKRTYVIDGVRKNGWFALDFTKDELQSVSLTQAIWSRTYRFDSVGYSILSVTDLLSIVKQ  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLNVQHD+FY +H L+MR ++LS+ +RV ++YISSPE+ FL++I+  ++ R TKLVF
Sbjct  177  PSVWLNVQHDTFYKEHGLNMRNYILSIQKRVSVDYISSPELGFLQNISGTVH-RKTKLVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             FL     + S NQTYGSLL NL  IK+ ASGI+VPK+YIWPV K  +YLQP+TS+V
Sbjct  236  SFLDKSLLDHSINQTYGSLLSNLTLIKSIASGIMVPKTYIWPVTK-DNYLQPSTSIV  291



>ref|XP_006856834.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 170/238 (71%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ F    +L   I WCDVQLTKDG G+C P + LDN +N+  +++ 
Sbjct  50   GGFSGLFPDSSTFAFDFPNSLNLPRPISWCDVQLTKDGKGVCLPSLLLDNCTNIQEIYQT  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY VNG   T WF IDF  +QL   V L QG+++R++ FD T   IL VE V  + Q
Sbjct  110  GKKTYTVNGEILTGWFSIDFTIEQLVNNVTLIQGIFTRTNAFDAT-GSILPVEYVGTQTQ  168

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             PG WLN+QHD F+ QHNLSMR++V+SVSR++V++YISSP+V FL SI +R     TKLV
Sbjct  169  APGFWLNIQHDIFFRQHNLSMRSYVISVSRQMVVDYISSPDVAFLSSIGARFKGSKTKLV  228

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EP TNQ+YGSLL+NL  +KTFASGILVPK YIWP + S +YL+P +++V
Sbjct  229  FRFLEVDAVEPLTNQSYGSLLKNLTFVKTFASGILVPKDYIWPTN-SDNYLEPHSAVV  285



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 163/232 (70%), Gaps = 2/232 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA  TS+   ++WCDVQLTKDG  ICFPD+KL+NAS V   + +
Sbjct  43   GGFSGLFPDSSSAAYGFAVQTSVPGAVLWCDVQLTKDGAAICFPDLKLNNASTVEYFYPN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q +Y VNGV T  WF IDF+   L+ V L +G+ SR+ +FDG    ILTVE V  +++P
Sbjct  103  RQKSYPVNGVSTQGWFTIDFSLSDLSNVYLLRGILSRTEKFDGR-YPILTVEYVTTQIKP  161

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
               WLNVQHD+FY Q NLSM  F++S SR V INYISSPEVNF   IA R+       VF
Sbjct  162  ESFWLNVQHDAFYEQQNLSMSNFLISASRIVSINYISSPEVNFFTKIAGRLRRNGPIYVF  221

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQP  697
            +FL  ++ EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P
Sbjct  222  QFLRKEDIEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-KQYLVP  272



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   269 bits (687),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 175/239 (73%), Gaps = 4/239 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY+ A  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS V  ++ +
Sbjct  60   GGFSGLLPDSSIDAYNLAIQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTVQFVYTN  119

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             Q++Y V+GV T  WF ID   K L  V+L +G+ SRS +FDG    ILT+++V  +++P
Sbjct  120  GQNSYPVHGVTTQGWFAIDSTLKDLQNVSLIRGILSRSDKFDGNGYTILTIQNVTEQIKP  179

Query  362  P-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
              G WL+VQHD+FY QHNLSM +F++SVSR V I++ISSPEVNF K I  R        V
Sbjct  180  QGGFWLHVQHDAFYEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGRFKLNGPSFV  239

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV-DKSSSYLQPTTSLV  712
            F+FLG ++ EP+TN+TYGS+L NL  +KTFAS ILVPKSYI+P+ DK   YL P TSLV
Sbjct  240  FQFLGKEDFEPTTNRTYGSILSNLTFVKTFASKILVPKSYIFPLGDK--QYLLPPTSLV  296



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  +Y F+ +    + I WCDV+LTKDG G+C PDI LDN +N+  ++ +
Sbjct  63   GGFSGLFPDSSSFSYKFSYVAGSPDTISWCDVRLTKDGNGVCLPDIVLDNCTNIKLVYPE  122

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  Y+VNGVPT+ WF +D++ + L+ V+L Q + SRS++FD +   ILTVED+  +V+P
Sbjct  123  GKMNYIVNGVPTSGWFSVDYDIQNLSQVSLAQAILSRSNKFDASLFPILTVEDLVAQVKP  182

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              LWLN+QHD FY Q NL MR ++L +S+  + +Y+SSPEV FL SI  R     TKL+F
Sbjct  183  AKLWLNIQHDIFYRQLNLDMRRYLLYLSKHDIPSYVSSPEVGFLSSIVGRFRTSKTKLIF  242

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFLG D  EPSTN TYGSLL+NL  +KTFASGIL+PK YIWPV  SS YL+  TS+V
Sbjct  243  RFLGEDTIEPSTNVTYGSLLKNLTFVKTFASGILIPKYYIWPV-TSSGYLESYTSVV  298



>gb|AFW72078.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=360

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 166/238 (70%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P I +DN + +  +F +
Sbjct  49   GGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLPSINMDNCTMIDNVFPE  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY VNGV T  WF +D+    L   V L+Q V SR+  +DG+   I +VE+VF    
Sbjct  109  GKKTYNVNGVSTVGWFSVDYTSTDLLPNVTLKQSVLSRTPVYDGS-MLINSVENVFTSFN  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
               +WLNVQ DSFYSQ  LSMR ++LS+S++ + +YISSPEVNFL SI+ R++ + TKLV
Sbjct  168  ASAVWLNVQQDSFYSQFKLSMRNYILSLSKQFITDYISSPEVNFLTSISGRVSKK-TKLV  226

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL     EPSTNQTYGS+L+NL  +KTFASGILVPKSYIWPV    +YL P TS+V
Sbjct  227  FRFLDEGSIEPSTNQTYGSMLKNLTFVKTFASGILVPKSYIWPV-TPDNYLLPYTSVV  283



>ref|NP_001142429.1| uncharacterized protein LOC100274608 [Zea mays]
 gb|ACG23909.1| hypothetical protein [Zea mays]
Length=364

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 166/237 (70%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYSFA +TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +
Sbjct  67   GGFSGVFPDSSQGAYSFAMITSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPE  126

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ TY+++GV  T WF  DF   +L  V+L Q ++ R+ RFDG    I++V D  + V P
Sbjct  127  RKRTYVIDGVRKTGWFVSDFTIAELQSVSLTQAIWPRTRRFDGI-YPIISVTDFRSLVMP  185

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              +WLNVQHD FY QH L MR ++LS+ + V ++YISSPE+ FLK+++ R+  R TKLVF
Sbjct  186  SPVWLNVQHDIFYKQHGLDMRNYILSIKKGVSMDYISSPELGFLKNMSGRVG-RKTKLVF  244

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     + S NQTYGSL  NL  IK+ ASGI+VPKSYIWPV K  +YL P+TS+V
Sbjct  245  RFLEKALLDHSINQTYGSLSSNLPFIKSIASGIIVPKSYIWPVTK-DNYLLPSTSIV  300



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 172/237 (73%), Gaps = 4/237 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS NAY FA ++  + V  WCDV+LTKDG GIC PDI++++ ++++  F  
Sbjct  46   GGFSGLFPDSSENAYLFATISQDSAV--WCDVRLTKDGSGICLPDIQMESCTSISNAFPK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + TY VNGV  T WF +D+    L  V L+Q V SRS R+DG    I+ VE V  + + 
Sbjct  104  GKKTYNVNGVSVTGWFSVDYKDTDLGKVFLRQSVSSRSERYDGGGLLIVPVEAVIAQFKA  163

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLN+QHDSFYSQ NLSMR+++LS+S++  ++YISSPEV  LKS+  R++ + TKLVF
Sbjct  164  PAVWLNLQHDSFYSQFNLSMRSYILSLSKQYTVDYISSPEVTILKSLLGRVSKK-TKLVF  222

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGS+L+NL  IKTFASGILVPK YI PV  + +YL+P TS+V
Sbjct  223  RFLDEGTAEPSTNQTYGSMLKNLTFIKTFASGILVPKHYILPV-TADNYLKPHTSVV  278



>tpg|DAA63616.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=364

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 166/237 (70%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYSFA +TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +
Sbjct  67   GGFSGVFPDSSQGAYSFAMITSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPE  126

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ TY+++GV  T WF  DF   +L  V+L Q ++ R+ RFDG    I+++ D  + V P
Sbjct  127  RKRTYVIDGVRKTGWFVSDFTIAELQSVSLTQAIWPRTRRFDGI-YPIISITDFRSLVMP  185

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              +WLNVQHD FY QH L MR ++LS+ + V ++YISSPE+ FLK+++ R+  R TKLVF
Sbjct  186  SPVWLNVQHDIFYKQHGLDMRNYILSIKKGVSMDYISSPELGFLKNMSGRVG-RKTKLVF  244

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     + S NQTYGSL  NL  IK+ ASGI+VPKSYIWPV K  +YL P+TS+V
Sbjct  245  RFLEKALLDHSINQTYGSLSSNLPFIKSIASGIIVPKSYIWPVTK-DNYLLPSTSIV  300



>gb|AAV64238.1| unknown [Zea mays]
Length=382

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 166/237 (70%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYSFA +TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +
Sbjct  67   GGFSGVFPDSSQGAYSFAMITSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPE  126

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ TY+++GV  T WF  DF   +L  V+L Q ++ R+ RFDG    I+++ D  + V P
Sbjct  127  RKRTYVIDGVRKTGWFVSDFTIAELQSVSLTQAIWPRTRRFDGI-YPIISITDFRSLVMP  185

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              +WLNVQHD FY QH L MR ++LS+ + V ++YISSPE+ FLK+++ R+  R TKLVF
Sbjct  186  SPVWLNVQHDIFYKQHGLDMRNYILSIKKGVSMDYISSPELGFLKNMSGRVG-RKTKLVF  244

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     + S NQTYGSL  NL  IK+ ASGI+VPKSYIWPV K  +YL P+TS+V
Sbjct  245  RFLEKALLDHSINQTYGSLSSNLPFIKSIASGIIVPKSYIWPVTK-DNYLLPSTSIV  300



>gb|AAV64200.1| unknown [Zea mays]
 tpg|DAA63617.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=382

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 166/237 (70%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AYSFA +TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +
Sbjct  67   GGFSGVFPDSSQGAYSFAMITSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPE  126

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ TY+++GV  T WF  DF   +L  V+L Q ++ R+ RFDG    I+++ D  + V P
Sbjct  127  RKRTYVIDGVRKTGWFVSDFTIAELQSVSLTQAIWPRTRRFDGI-YPIISITDFRSLVMP  185

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              +WLNVQHD FY QH L MR ++LS+ + V ++YISSPE+ FLK+++ R+  R TKLVF
Sbjct  186  SPVWLNVQHDIFYKQHGLDMRNYILSIKKGVSMDYISSPELGFLKNMSGRVG-RKTKLVF  244

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     + S NQTYGSL  NL  IK+ ASGI+VPKSYIWPV K  +YL P+TS+V
Sbjct  245  RFLEKALLDHSINQTYGSLSSNLPFIKSIASGIIVPKSYIWPVTK-DNYLLPSTSIV  300



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 167/237 (70%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  AY   G  S  + +MWCDV+LTKDG GIC P I +DN + +A  F  
Sbjct  51   GGFSGLFPESSLYAYQILGSLSSPDTVMWCDVRLTKDGGGICLPSIDMDNCTTIANFFPQ  110

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + TY VNGV T  WF +D+    L  V+L+Q V SR+  +DG    I+ VE+V+ +  P
Sbjct  111  GKKTYNVNGVSTVGWFSVDYTSTDLLNVSLKQSVLSRTGVYDGI-FPIIPVENVYTQFNP  169

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              +WLNVQ DSFYSQ  LSMR+++LS+ +  V++YISSPEVNFL SI+ R++ + TKLVF
Sbjct  170  VAVWLNVQQDSFYSQFKLSMRSYILSLLKNFVVDYISSPEVNFLTSISGRVSKK-TKLVF  228

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL     EPSTNQTYGS+L+NL  +KTFASGILVPKSYIWPV    +YL P TS+V
Sbjct  229  RFLDERSIEPSTNQTYGSMLKNLTFVKTFASGILVPKSYIWPV-TPDNYLLPYTSVV  284



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 174/237 (73%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICFP++ LDN S+V T++ +
Sbjct  39   GGFSGMFPDSSSQAYQLVNITTSPDVMLWCDLQLTKDGVGICFPNLNLDNGSDVMTIYPN  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +             F +DF +K+L+ V L +GV SR + FD     ILT+E+V  K+  
Sbjct  99   YKER-----------FSVDFTWKELSDVKLARGVLSRPNIFDDL-SSILTIEEV-AKLTA  145

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLN+Q  +FY+QHNLSMR  VLS+SRR+ +N+ISSPE++FLKS+ + + P VTKL+F
Sbjct  146  SGLWLNIQDSAFYAQHNLSMRNSVLSLSRRLKVNFISSPEISFLKSMKNSVKPTVTKLIF  205

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FL  D  EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWP+D S+ YLQP TSLV
Sbjct  206  KFLKQDHIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYIWPID-SALYLQPHTSLV  261



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 172/237 (73%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    +T+   V++WCD+QLTKDGVGICFP++ L N SNV +++ +
Sbjct  39   GGFSGMFPDSSIQAYQLVNITTSPEVMLWCDLQLTKDGVGICFPNLNLHNGSNVISIYPN  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +             F +DF +K+L+ V L QGV SR   FD     IL +E+V  K+  
Sbjct  99   YKER-----------FSVDFTWKELSDVKLAQGVISRPEIFDDV-SSILPIEEV-AKLTA  145

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLN+Q  +FY+QHNLSMR  V+S+SRR+++N+ISSPE++FLKS+ + + P VTKL+F
Sbjct  146  SGLWLNIQDSAFYTQHNLSMRNSVISLSRRLIVNFISSPEISFLKSMKNSVKPTVTKLIF  205

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FL  D+ EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S+ YLQP TSLV
Sbjct  206  KFLKQDDIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYIWPVD-SALYLQPHTSLV  261



>ref|XP_006279181.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12079.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=677

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 166/239 (69%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY FA  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ +
Sbjct  57   GGFSGLLPDSSIDAYGFAIQTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPN  116

Query  182  -KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             K  +Y VNGV    WF IDF+   L  V+L +G+ SRS RFDG    I T+++V  K+ 
Sbjct  117  HKPKSYPVNGVTRQGWFTIDFSLGDLQNVSLIRGILSRSDRFDGNGYAISTIQNVAEKIS  176

Query  359  PPG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            P G  WLNVQHD+FY Q NLS+ +F+LSVSR V I++ISSPEVNF   I  +        
Sbjct  177  PQGGFWLNVQHDAFYEQQNLSISSFLLSVSRTVSIDFISSPEVNFFMKIVGQFGRNGPTS  236

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  ++ E +TNQTY S+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  237  VFRFLRKEDFEQTTNQTYSSILSNLTFVKTFASGILVPKSYILPLDD-KQYLLPHTSLV  294



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 165/237 (70%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG GICFP++ LDNASNV  ++ +
Sbjct  39   GGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAGICFPNLNLDNASNVKDVYPN  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +            W  + F +K+L+ V L+QGV+SR   FD     IL +E+V  K+  
Sbjct  99   HKE-----------WLSVGFTWKELSTVTLEQGVFSRLQIFDDV-SNILRIEEV-AKLGT  145

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLN+QH  FY+QHNLSMR FVLS+S  + IN+ISSP+++FLKS+   + P  TKL+F
Sbjct  146  SGLWLNIQHSDFYTQHNLSMRNFVLSISSHMKINFISSPDISFLKSVKKDVKPTKTKLIF  205

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ +P TNQ+Y SL +NL  IKTF+SGILVPKSYIWPV  S  YLQP TSLV
Sbjct  206  RFLSQDQIDPFTNQSYASLAKNLTFIKTFSSGILVPKSYIWPV-SSDLYLQPHTSLV  261



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 165/237 (70%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG GICFP++ LDNASNV  ++ +
Sbjct  39   GGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAGICFPNLNLDNASNVKDVYPN  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +            W  + F +K+L+ V L+QGV+SR   FD     IL +E+V  K+  
Sbjct  99   HKE-----------WLSVGFTWKELSTVTLEQGVFSRLQIFDDV-SNILRIEEV-AKLGT  145

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLN+QH  FY+QHNLSMR FVLS+S  + IN+ISSP+++FLKS+   + P  TKL+F
Sbjct  146  SGLWLNIQHSDFYTQHNLSMRNFVLSISSHMKINFISSPDISFLKSVKKDVKPTKTKLIF  205

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ +P TNQ+Y SL +NL  IKTF+SGILVPKSYIWPV  S  YLQP TSLV
Sbjct  206  RFLSQDQIDPFTNQSYASLAKNLTFIKTFSSGILVPKSYIWPV-SSDLYLQPHTSLV  261



>ref|XP_006647435.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=747

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 167/238 (70%), Gaps = 10/238 (4%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY      S     +WCDVQLTKDG GIC PDI ++N + +++    
Sbjct  48   GGFSGLFPDSSDFAYG-----SAPGAALWCDVQLTKDGAGICLPDINMNNCTGISSFDPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
               TY VNGVP   WFP+D+    L   V L+Q + SR+ +FDG    I+ VEDV +K +
Sbjct  103  GIKTYNVNGVPVKGWFPMDYKSADLLQQVFLKQPILSRTDKFDGL--AIVPVEDVLSKYK  160

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             P +WLNVQHDSFYSQ NL+MR+++LSVS++  ++YISSPEVNFL S+  R++ + TKLV
Sbjct  161  TPAVWLNVQHDSFYSQFNLNMRSYILSVSKQFAVDYISSPEVNFLNSLLGRVSKK-TKLV  219

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL     EPSTNQTYGSLL+NL  IKT ASG+LVPK YI PV K  +YLQP TS+V
Sbjct  220  FRFLDEQTVEPSTNQTYGSLLKNLTFIKTIASGVLVPKHYILPVTK-DNYLQPHTSVV  276



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 165/239 (69%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYS A  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ +
Sbjct  57   GGFSGLLPDSSLDAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPN  116

Query  182  -KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             K  +Y VNGV    WF IDF+   L  V+L +G+ SRS +FDG    I T+++V  ++ 
Sbjct  117  HKPKSYPVNGVTRQGWFTIDFSLGDLQNVSLIRGILSRSDKFDGNGYAISTIQNVAEQIS  176

Query  359  PPG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            P G  WLNVQHD+FY Q NLSM +F+LS S  V I +ISSPEVNF   IA          
Sbjct  177  PQGGFWLNVQHDAFYEQQNLSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSF  236

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF+FL  ++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P++    YL P TSLV
Sbjct  237  VFQFLEKEDFEPTTNQTYGSILSNLTFVKTFASGILVPKSYILPLN-DKRYLLPHTSLV  294



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 165/239 (69%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYS A  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ +
Sbjct  57   GGFSGLLPDSSLDAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPN  116

Query  182  -KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             K  +Y VNGV    WF IDF+   L  V+L +G+ SRS +FDG    I T+++V  ++ 
Sbjct  117  HKPKSYPVNGVTRQGWFTIDFSLGDLQNVSLIRGILSRSDKFDGNGYAISTIQNVAEQIS  176

Query  359  PPG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            P G  WLNVQHD+FY Q NLSM +F+LS S  V I +ISSPEVNF   IA          
Sbjct  177  PQGGFWLNVQHDAFYEQQNLSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSF  236

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF+FL  ++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P++    YL P TSLV
Sbjct  237  VFQFLEKEDFEPTTNQTYGSILSNLTFVKTFASGILVPKSYILPLND-KRYLLPHTSLV  294



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 166/239 (69%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AY FA  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ +
Sbjct  57   GGFSGLLPDSSIDAYGFAIQTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPN  116

Query  182  -KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             K  +Y VNGV    WF IDF+   L  V+L +G+ SRS RFDG    I T+++V  K+ 
Sbjct  117  HKPKSYPVNGVTRQGWFTIDFSLGDLQNVSLIRGILSRSDRFDGNGYAISTIQNVAEKIS  176

Query  359  PPG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            P G  WLNVQHD+FY Q NLS+ +F+LSVSR V I++ISSPEVNF   I  +        
Sbjct  177  PQGGFWLNVQHDAFYEQQNLSISSFLLSVSRTVSIDFISSPEVNFFMKIVGQFGRNGPTS  236

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VFRFL  ++ E +TNQTY S+L NL  +KTFASGILVPKSYI P+D    YL P TSLV
Sbjct  237  VFRFLRKEDFEQTTNQTYSSILSNLTFVKTFASGILVPKSYILPLDD-KQYLLPHTSLV  294



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 165/239 (69%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGL PDSS +AYS A  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ +
Sbjct  57   GGFSGLLPDSSLDAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPN  116

Query  182  -KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             K  +Y VNGV    WF IDF+   L  V+L +G+ SRS +FDG    I T+++V  ++ 
Sbjct  117  HKPKSYPVNGVTRQGWFTIDFSLGDLQNVSLIRGILSRSDKFDGNGYAISTIQNVAEQIS  176

Query  359  PPG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            P G  WLNVQHD+FY Q NLSM +F+LS S  V I +ISSPEVNF   IA          
Sbjct  177  PQGGFWLNVQHDAFYEQQNLSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSF  236

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF+FL  ++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P++    YL P TSLV
Sbjct  237  VFQFLEKEDFEPTTNQTYGSILSNLTFVKTFASGILVPKSYILPLND-KRYLLPHTSLV  294



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 173/241 (72%), Gaps = 7/241 (3%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF--  175
            GGFSG+FPDSS+ A+SFA L S  +  +WCDVQLTKDGVGIC  DI + N +N A ++  
Sbjct  58   GGFSGVFPDSSYYAFSFALLASAPDTSLWCDVQLTKDGVGICLRDINMSNCTNAAQVYPV  117

Query  176  -KDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFN  349
               K++ Y+++GVP T +F +DF   ++ T ++L QG+YSR+ RFD T   IL+V D  +
Sbjct  118  KNKKEAKYVIDGVPKTGYFSLDFTLSEIQTTLSLTQGIYSRTERFD-TMYSILSVTDFQS  176

Query  350  KVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVT  529
             V+PP +WLNVQ D FY QH L+MR++++S+ + V + YISSPE+ FLKSI+ R   R T
Sbjct  177  NVKPPSVWLNVQRDIFYKQHGLNMRSYIVSILKSVPVKYISSPELGFLKSISKRAG-RRT  235

Query  530  KLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSL  709
            KLVFRF  N  ++PSTNQTY SL +NL  IKT ASGI+VPK YIWPV  + +YLQP TS 
Sbjct  236  KLVFRFPDNFLSDPSTNQTYSSLSKNLTFIKTIASGIMVPKIYIWPV-TNDNYLQPPTSF  294

Query  710  V  712
            V
Sbjct  295  V  295



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   255 bits (651),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 172/240 (72%), Gaps = 20/240 (8%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATL---  172
            GGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICFP++KLDN SNV  +   
Sbjct  39   GGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICFPNLKLDNGSNVIRIDPH  98

Query  173  FKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNK  352
            +K++              F +DF +K+L+ V L QGV SR   FD     IL +E+V  K
Sbjct  99   YKER--------------FSVDFTWKELSDVKLAQGVVSRPYIFDDV-SSILAIEEV-AK  142

Query  353  VQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTK  532
            +   GLWLN+Q  +FY++HNLSMR  V+S+SRR+ +N+ISSP ++FLKS+ + + P VTK
Sbjct  143  LTASGLWLNIQDSAFYAKHNLSMRNSVVSLSRRLKVNFISSPGISFLKSMKNSVKPTVTK  202

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            L+FRFL  +  EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S+ YLQP TSLV
Sbjct  203  LIFRFLKQEHIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYIWPVD-SALYLQPHTSLV  261



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   254 bits (650),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 172/240 (72%), Gaps = 20/240 (8%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATL---  172
            GGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICFP++KLDN SNV  +   
Sbjct  39   GGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICFPNLKLDNGSNVIRIDPH  98

Query  173  FKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNK  352
            +K++              F +DF +K+L+ V L QGV SR   FD     IL +E+V  K
Sbjct  99   YKER--------------FSVDFTWKELSDVKLAQGVVSRPYIFDDV-SSILAIEEV-AK  142

Query  353  VQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTK  532
            +   GLWLN+Q  +FY++HNLSMR  V+S+SRR+ +N+ISSP ++FLKS+ + + P VTK
Sbjct  143  LTASGLWLNIQDSAFYAKHNLSMRNSVVSLSRRLKVNFISSPGISFLKSMKNSVKPTVTK  202

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            L+FRFL  +  EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S+ YLQP TSLV
Sbjct  203  LIFRFLKQEHIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYIWPVD-SALYLQPHTSLV  261



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 166/238 (70%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P I +DN + +  +F +
Sbjct  49   GGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLPSINMDNCTMIDNVFPE  108

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY VNGV T  WF +D+    L   V L+Q V SR+  +DG+   I +VE+VF    
Sbjct  109  GKKTYNVNGVSTVGWFSVDYTSTDLLPNVTLKQSVLSRTPVYDGS-MLINSVENVFTSFN  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
               +WLNVQ DSFYSQ  LSMR ++LS+S++ + +YISSPEVNFL SI+ R++ + TKLV
Sbjct  168  ASAVWLNVQQDSFYSQFKLSMRNYILSLSKQFITDYISSPEVNFLTSISGRVSKK-TKLV  226

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL     EPSTNQTYGS+L+NL  +KTFASGILVPKSYIWPV    +YL P TS+V
Sbjct  227  FRFLDEGSIEPSTNQTYGSMLKNLTFVKTFASGILVPKSYIWPV-TPDNYLLPYTSVV  283



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 164/239 (69%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  A+ FA   S+  VI+WCDVQLTKD VGICFPD+ L NASN+  ++  
Sbjct  38   GGFSGLFPDSSLAAFQFAMQASVDEVILWCDVQLTKDEVGICFPDLNLANASNIQDVYST  97

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL--TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKV  355
            ++ +Y VNGV T  WFPIDF+  +L   L +L +G+ SRS +FD     I T++DV  ++
Sbjct  98   RRKSYPVNGVTTQGWFPIDFSLTELQNVLFSLIRGILSRSEKFDENGFAISTIQDVNTQL  157

Query  356  QPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
             P   WLNV HD+FY Q N SM +F+LS +R V I++ISSPEV F + IA R        
Sbjct  158  LPKDFWLNVPHDAFYEQQNYSMSSFLLSAARTVSIDFISSPEVGFFRKIAGRYGRNGPSF  217

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF+FLG ++ EP+TN+TYGS+  NL  +KTFASGILVPKSYI  +D    YL P TSLV
Sbjct  218  VFQFLGKEDFEPTTNRTYGSIFNNLTYVKTFASGILVPKSYILQLD-DKHYLLPPTSLV  275



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 166/237 (70%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY  A +T+ T+V +WCD+QLTKDGVGICFP++ LDN SNV  ++ +
Sbjct  39   GGFSGIFPDSSIQAYQLASITTSTDVTLWCDLQLTKDGVGICFPNLNLDNGSNVMNVYPN  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + +           F IDF  K+L+ V   Q V SRS+ FD     I T+ DV  +   
Sbjct  99   YKES-----------FSIDFTKKELSRVGCAQSVPSRSNIFDDA-YPICTINDV-AETAA  145

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQ  +FYSQHN++MR FV+S+S+RV   +ISSPE+ FLKS+ +     VTKL+F
Sbjct  146  SGLWLNVQDSAFYSQHNMNMRNFVVSISKRVRFKFISSPEITFLKSMKNSAKRTVTKLIF  205

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S  YLQP TSLV
Sbjct  206  RFLNQDQIEPFTNQSYGSLSKNLSYIRTFSSGILVPKSYIWPVD-SYLYLQPHTSLV  261



>ref|XP_004979884.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=1128

 Score =   255 bits (652),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 166/237 (70%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +AYSF  + S     +WCDVQLTKDGVG+C  DI +DN +NVA  +  
Sbjct  57   GGFSGVFPDSSSDAYSFTLMASAAGTTLWCDVQLTKDGVGVCLRDINMDNCTNVAQAYPA  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++ TY+++GV    WF +DF   +L  V L Q ++SR+  FD     IL+V D+ + V+ 
Sbjct  117  RKRTYVIDGVRKNGWFALDFTKDELQSVILTQAIWSRTYSFDSVGYSILSVTDLLSIVKQ  176

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLNVQHD+FY +H L+MR ++ S+ +RV ++YISSPE+ FL++I+  +  + TKLVF
Sbjct  177  PSVWLNVQHDTFYKEHGLNMRNYIFSIQKRVSVDYISSPELGFLQNISGTVRGK-TKLVF  235

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             FL     + S N+TYGSLL NL  IK+ A GI+VPK+YIWPV K  +YLQP+TS+V
Sbjct  236  SFLDKSLLDHSINRTYGSLLSNLTLIKSIAFGIMVPKTYIWPVTK-DNYLQPSTSIV  291



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 165/237 (70%), Gaps = 1/237 (0%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS NA++FA  ++ +   +WCDVQLTKDGVGIC  D+ ++N +++   +  
Sbjct  64   GGFSGVFPDSSSNAFTFALTSTSSATTLWCDVQLTKDGVGICLRDLLMNNCTSIDQTYPQ  123

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + TY+VNG     WFPID+    L  V L Q ++SR  +FD     IL V ++ + V+P
Sbjct  124  GKKTYIVNGKKQDGWFPIDYTMSSLQSVILTQAIWSRPDKFDFAYLPILPVTNLTSLVKP  183

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              LWLN++HD FY QH L+M  ++LS+S+   + YISSPE+ FL+SI  R+N R TKLVF
Sbjct  184  SSLWLNIEHDIFYRQHGLNMTKYILSISKNAAVKYISSPELGFLRSILGRVN-RKTKLVF  242

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RF     ++PS+NQTYGSLL NL  IKT ASGI+VPK YIWPV  +++Y+QP+ S+V
Sbjct  243  RFPDAASSDPSSNQTYGSLLSNLTFIKTVASGIIVPKEYIWPVAPNNNYIQPSKSIV  299



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 166/237 (70%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS NAY FA  ++  + ++WC+VQLTKDGVGIC  D+ +DN ++++  ++ 
Sbjct  60   GGFSGVFPDSSKNAYVFALSSTSGDTVLWCNVQLTKDGVGICLRDLLMDNCTSISQAYRA  119

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +  YLVNG     WFPID+    L  V L Q ++SR+ +FD     IL V +V +  +P
Sbjct  120  GKKAYLVNGEEKKGWFPIDYTMSSLQSVILTQAIWSRTDKFDFAFLPILPVTNVIDLAKP  179

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              +WLN++HD FY QH L+M  ++LS+ +   + YISSPE+ FL+SI+ R+N R TKLVF
Sbjct  180  SSVWLNIEHDIFYRQHGLNMTKYILSIPKGGSVQYISSPELGFLQSISGRVN-RKTKLVF  238

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL    ++PS+NQTYGSLL NL  IKT ASGI+VPK YIWPV  +++Y+QP  S+V
Sbjct  239  RFLDATSSDPSSNQTYGSLLSNLTFIKTVASGIMVPKEYIWPV-TTNNYIQPAKSIV  294



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score =   250 bits (639),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 173/238 (73%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS +A++FA L S  +  +WCDVQLTKDGVGIC PDI + N +++A ++  
Sbjct  65   GGFSGVFPDSSQDAFAFALLASAPDTSLWCDVQLTKDGVGICLPDINMQNCTDIAQVYSA  124

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            ++S Y+V+G P T WFP+DFNF +   V L Q ++SR+ +FD     IL V D+ +   P
Sbjct  125  RKSKYVVHGAPKTGWFPVDFNFSEFQGVILTQRIWSRTDKFDYVQYGILAVTDLQSIATP  184

Query  362  -PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
             P +WLNVQHD FY +H L+MR+++LS+ +R+ + YISSPE+ FL+SI+ R+  + TKLV
Sbjct  185  APSVWLNVQHDIFYREHGLNMRSYILSILKRMSVKYISSPELGFLQSISGRVGGK-TKLV  243

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF     T+PSTN+TY S+L NLA IK  ASGI+VPKSYIWPV  + +YL P TS+V
Sbjct  244  FRFPETPLTDPSTNKTYRSMLSNLALIKATASGIMVPKSYIWPV-TNDNYLLPPTSIV  300



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 164/237 (69%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY    LT+  +V +WCD+QLTKDGVGICFP++ LDN S+V  ++ +
Sbjct  39   GGFSGLFPDSSEYAYELVNLTTSEDVTLWCDLQLTKDGVGICFPNLNLDNGSDVVDVYPN  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +             F +DF +K+L+ V L Q + SR + FD     IL  E+V  K+  
Sbjct  99   HKEI-----------FSVDFTWKELSNVTLVQNIVSRQAIFDHV-SSILPTEEV-AKIGT  145

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLN+QH  FY+QHNLSMR  V+S+SRR+ I +ISSPE++FL+++   +N  VTKL+F
Sbjct  146  SGLWLNIQHSDFYAQHNLSMRNSVVSLSRRMKIKFISSPEISFLRNMKKDVNTTVTKLIF  205

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D  +P TNQ+YGSL +NL+ IKTF+SGILVPKSYIWP+  S  YLQP TS V
Sbjct  206  RFLNQDRIDPFTNQSYGSLAKNLSYIKTFSSGILVPKSYIWPL-GSDLYLQPHTSFV  261



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 169/237 (71%), Gaps = 20/237 (8%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    +T+  N+ +WCD+QLTKDGVGICFP++ L N S+V  ++ +
Sbjct  169  GGFSGVFPDSSSKAYELVSVTTSLNLALWCDLQLTKDGVGICFPNLNLYNDSDVKDVYPN  228

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K             WF +DF +K L+ VNL Q V SRS  FDG+  QILTVE +  ++  
Sbjct  229  KNE-----------WFSVDFTWKDLSDVNLVQNVKSRSGVFDGS-YQILTVE-IVAELGA  275

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            PGLWLN+Q+ +FY QHNLSMR +V+S+S+RV  ++ISSPE++FLKS+       VTKL+F
Sbjct  276  PGLWLNIQNSAFYRQHNLSMRNYVVSLSKRV--DFISSPEISFLKSMKK----DVTKLIF  329

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RFL  D+ EP TNQTY SL +NL+ IKTF+SGILVPKSYIWPV  S  YL+P TSLV
Sbjct  330  RFLNQDQIEPFTNQTYSSLSKNLSYIKTFSSGILVPKSYIWPVG-SDLYLKPHTSLV  385



>dbj|BAJ93663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 168/237 (71%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  A++FA L S  +  +WCDVQLTKDGVG+C  DI + N +N A ++  
Sbjct  60   GGFSGVFPDSSQAAFAFALLASAPDTSVWCDVQLTKDGVGVCLRDINMANCTNAALVYPA  119

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+  Y+++GVP T +F +DFN+ ++    L QG YSR+ RFD     I +V D+ + ++P
Sbjct  120  KKKKYVIDGVPKTGYFSLDFNYSEVQTTYLTQGFYSRTDRFDSI-YTIFSVTDLQSYIKP  178

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLNVQ D FY+QH L+MR +++S+ + V + YISSPE+ FLKSI+ R+  R TKLVF
Sbjct  179  PSVWLNVQRDIFYTQHGLNMRRYIVSILKSVSVKYISSPELGFLKSISKRVGSR-TKLVF  237

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RF  N  ++PS NQTY  L +NL  IKT ASGI+VPKSYIWPV  + +YLQP TS V
Sbjct  238  RFPDNFMSDPSINQTYSLLSKNLTFIKTIASGIMVPKSYIWPV-TNDNYLQPPTSFV  293



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 168/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FP+SS  AY FA  TS+++V+++CD+QLTKDG GIC  +++LDN++ ++  + +
Sbjct  44   GGFSGVFPESSQFAYQFALSTSISDVVLFCDLQLTKDGNGICQTELRLDNSTTISAYYPE  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY VNG   + WF +DF  ++L   + L Q VYSR+S FD T   I+TVEDV   ++
Sbjct  104  GEKTYNVNGKNISGWFAVDFTVEELFNNITLSQNVYSRASIFDET-LPIMTVEDV-TGLR  161

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WLNV++D FY QHNL+   ++    + + I+YISSPE+ FLK++  ++N   TKL+
Sbjct  162  PPKFWLNVEYDMFYVQHNLNAEAYIEEALKHMRIDYISSPEIGFLKNLNGKLNTDTTKLI  221

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EP+T Q YGS+L NL  IKTFASGILVPK YIWPV+ +  YL+  T+LV
Sbjct  222  FRFLEADAVEPTTKQKYGSILSNLPEIKTFASGILVPKEYIWPVN-AQKYLEAHTNLV  278



>gb|KCW78936.1| hypothetical protein EUGRSUZ_C00368 [Eucalyptus grandis]
Length=737

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 160/238 (67%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  A   A  +S+ +V+++CD+QLTKDG+GIC PDIKLDN +++A +F  
Sbjct  46   GGFSGIFPDSSEFAVDMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDNTTDIAMVFPK  105

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY VNG     WF +D+   +L   V L Q V SR S FDG    +  V+D+  +  
Sbjct  106  GEKTYTVNGQDLKGWFAVDYTSDELFNNVTLVQNVLSRPSLFDGA-MSVQAVDDIVGRKT  164

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
               LWLNVQ+D FY++H  S  T+V  V R   ++Y+SSPE+ FLK++  ++N   TKL+
Sbjct  165  VNLLWLNVQYDGFYNEHKHSPATYVQKVVRYYPVDYLSSPEIGFLKAMKGKVNKARTKLI  224

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EPSTNQTYGS+L+NL SIK FASGILVPK YI+PV  +  YL   TSLV
Sbjct  225  FRFLAEDAVEPSTNQTYGSILKNLESIKAFASGILVPKEYIYPV-GTDKYLGAPTSLV  281



>ref|XP_009396661.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=744

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 165/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  AY FA  TSL NV+++CD+QLTKDG GIC  D++LDN++ ++ +F  
Sbjct  39   GGFSGLFPESSQFAYQFAQSTSLKNVVLYCDLQLTKDGAGICHSDLRLDNSTTISAVFPK  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             ++TY VNG P   WF IDF   QL   V L Q ++SR S FDG    +  VEDV   + 
Sbjct  99   GRTTYSVNGRPVQGWFSIDFTSDQLYNNVTLIQSIFSRPSVFDGN-LPVSMVEDVAG-LH  156

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P  LW+NVQ+ +F+ +H+L    ++ SVSR  +I+ ISSPE+ FLKS++       TKL+
Sbjct  157  PYQLWVNVQYSTFFKEHDLDAVDYIRSVSRETIIDCISSPEIGFLKSLSGLPGRHKTKLI  216

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF+  D+ EPST +TY +LL +L +IK+FASGILVPKSYIWPV+K   YL+  TSLV
Sbjct  217  FRFMEVDDVEPSTKKTYQALLNDLVTIKSFASGILVPKSYIWPVNK-DQYLEAHTSLV  273



>ref|XP_010488033.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5-like 
[Camelina sativa]
Length=266

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 154/230 (67%), Gaps = 17/230 (7%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY    +T+  ++ +WC++QLTKDGVGICFP++ L N S V   + +
Sbjct  39   GGFSGIFPDSSIQAYELVNITTSPDITLWCELQLTKDGVGICFPNLNLQNGSTVKKFYPN  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             + T           F +DF +K+L+ V L QGVYSR+  FD     I  VE+       
Sbjct  99   YKET-----------FSVDFTWKELSSVTLSQGVYSRTPIFDDN-WPITKVEET----AA  142

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRIN-PRVTKLV  538
              LWLN+Q  +FY+QHNL++R FV+S+SRRV  N+ISSPE++ LKS+   +    VTKL+
Sbjct  143  SSLWLNIQDSAFYAQHNLNVRKFVVSMSRRVRFNFISSPEISLLKSMKKSVKRTTVTKLM  202

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSY  688
            FRFL  D+ EP TNQ+YGSL +NL+ IKTF+SGILVPKSYIWP D   +Y
Sbjct  203  FRFLNQDQIEPFTNQSYGSLAKNLSYIKTFSSGILVPKSYIWPADSYLTY  252



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 164/235 (70%), Gaps = 3/235 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A+  A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F  
Sbjct  39   GGFSGLFPESSQFAHQIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPK  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY +NG     WF +D+   QL   V L Q +YSR S FDGT   + TV+D    ++
Sbjct  99   SQKTYTINGENVQGWFALDYTSDQLFNNVTLTQSIYSRPSLFDGT-LPLSTVDDAIG-IK  156

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPG WLNVQ+D+FY+ + LS+ +++   +R + I+YISSPE+ FLK++   IN   TKL+
Sbjct  157  PPGFWLNVQYDAFYAANKLSVSSYIQKTTRFMGISYISSPEIGFLKNMNKIINKAKTKLI  216

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTT  703
            FRFL  D  EP+T Q Y S+L++L+SIK+ ASGILVPK YIWP+ K    L P++
Sbjct  217  FRFLDADAVEPTTKQPYSSILKDLSSIKSIASGILVPKEYIWPLSKDQYLLTPSS  271



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GG+SG+FP+SS  AY FA  TSL   ++ CD+QL+KDG GIC  ++KLDN++ ++T F  
Sbjct  50   GGYSGIFPESSQFAYQFALATSLKETVLLCDLQLSKDGAGICHSNLKLDNSTTISTAFPK  109

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            + +TY VNG     WF +DF   +L   V   Q ++SR S FDG    +  V+D+     
Sbjct  110  RDTTYSVNGQSLHGWFSVDFTSDELLGNVTTIQNIFSRPSIFDGN-LPLSMVQDI-TGFH  167

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLNVQ+D FY +H L    FVL+ S +VV +YISSP + FLKS++ ++    TKL+
Sbjct  168  PSQFWLNVQYDMFYKEHKLDPAKFVLTASEKVVFDYISSPGIGFLKSLSGKLGKAKTKLI  227

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EPSTNQTY S+L+NL++IK+FASGILVPKSYIWPV+K  +YL+P+T+LV
Sbjct  228  FRFLDADAVEPSTNQTYSSILKNLSTIKSFASGILVPKSYIWPVNK-DNYLEPSTTLV  284



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 164/235 (70%), Gaps = 3/235 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A+  A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F  
Sbjct  39   GGFSGLFPESSQFAHQIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPK  98

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY +NG     WF +D+   QL   V L Q +YSR S FDGT   + TV+D    ++
Sbjct  99   SQKTYTINGENVQGWFALDYTSDQLFNNVTLTQSIYSRPSLFDGT-LPLSTVDDAIG-IK  156

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PPG WLNVQ+D+FY+ + LS+ +++   +R + I+YISSPE+ FLK++   IN   TKL+
Sbjct  157  PPGFWLNVQYDAFYAANKLSVSSYIQKTTRFMGISYISSPEIGFLKNMNKIINKAKTKLI  216

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTT  703
            FRFL  D  EP+T Q Y S+L++L+SIK+ ASGILVPK YIWP+ K    L P++
Sbjct  217  FRFLDADAVEPTTKQPYSSILKDLSSIKSIASGILVPKEYIWPLSKDQYLLTPSS  271



>gb|EMS66577.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=1368

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 167/237 (70%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  A++FA L S  +  +WCDVQLTKDGVGIC  DI + N +N AT +  
Sbjct  61   GGFSGVFPDSSQAAFAFALLASAPDTSVWCDVQLTKDGVGICLRDINMANCTNAATAYPA  120

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            K+  Y+++GVP T  F +DF + ++    L QG YSR+ RFD     I +V D+ + ++P
Sbjct  121  KKKKYVIDGVPKTGHFSLDFTYSEVQNTYLTQGFYSRTDRFDSI-YNIFSVTDLQSHIKP  179

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
            P +WLNVQHD FYSQH L+MR +++S+ + V + YISSPE+ FLKSI+ R+  R TKLVF
Sbjct  180  PSVWLNVQHDVFYSQHGLNMRRYIVSILKSVSVKYISSPEIGFLKSISKRVRGR-TKLVF  238

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            RF  N  ++PSTNQTY SL +NL  IKT ASGI+VPKSYIW V  + +YL P TS V
Sbjct  239  RFPDNFLSDPSTNQTYSSLSKNLTFIKTIASGIMVPKSYIWQV-TNDNYLLPPTSFV  294



>ref|XP_011017989.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=749

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 163/238 (68%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TSL++V++ C +QLTKDGVGIC  D++LDN  N+A +F+ 
Sbjct  40   GGFSGLFPESSDFANQMALATSLSDVVVLCHLQLTKDGVGICQGDVRLDNTKNIAMVFEK  99

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
               TY VNG   T WF IDF   QL   V+L Q ++SR S FD     I TV+DV +   
Sbjct  100  GSRTYKVNGQDLTGWFAIDFTADQLLANVSLVQNIFSRPSAFDAM-LPISTVDDVRSS-N  157

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WLNVQ+D+FY+++  S+  ++   +R   +NYISSPE+ FLK I   +N   TKLV
Sbjct  158  PPAFWLNVQYDAFYTENKQSVTNYIQKATRLQGVNYISSPEIGFLKKIKGLVNKAKTKLV  217

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FL    TEP+T QTYGS+L NLA+IKTFASGI+VPK YIWPV+ +++YL+  TSLV
Sbjct  218  FVFLDKKATEPTTKQTYGSILGNLATIKTFASGIVVPKDYIWPVN-AANYLEAPTSLV  274



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 169/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  T +++V+++C++QLTKDG+G+C PDI++DN++ +++++  
Sbjct  41   GGFSGLFPESSSFANQIAVSTGMSDVVVFCNLQLTKDGIGVCLPDIRIDNSTTISSIYPK  100

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q +Y VNG     WF +DF   +L   V L Q ++SRSS FDG    I TVEDV   V+
Sbjct  101  GQKSYNVNGQNLRGWFTLDFTSDELLNNVTLTQNIFSRSSLFDGQ-LPISTVEDV-TGVK  158

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+  +DSFY+Q+ LS   ++   ++ ++INY+SSPE+ FLK++  ++N   TKL+
Sbjct  159  PPQFWLSAPYDSFYNQNKLSPAAYIEQSAKHMIINYLSSPEIGFLKTMGGKVNKLKTKLI  218

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FLG ++ EP+TNQ Y S+LQNL ++K+FASGILVPK YIWPV  SS YL   TSLV
Sbjct  219  FQFLGPEQVEPTTNQKYSSILQNLTTVKSFASGILVPKEYIWPV-SSSGYLGKPTSLV  275



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TSL+ V + C++QLTK+GVGIC  DI+LDN +N+A +F+ 
Sbjct  40   GGFSGLFPESSDFANQMALATSLSGVAVLCNLQLTKEGVGICQGDIRLDNTTNIAMVFEK  99

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
               TY VNG   T WF IDF   QL   V+L Q ++SR S FD     I TV+DV +   
Sbjct  100  GSRTYKVNGQDITGWFAIDFTADQLLANVSLLQNIFSRPSAFDAM-LPISTVDDVRSS-N  157

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WLNVQ+D+FY+++ LS+  ++   +R   +NYISSPE+ FLK I   +N   TKLV
Sbjct  158  PPAFWLNVQYDAFYTENKLSVANYIQKATRLQGVNYISSPEIGFLKKINGLVNKAKTKLV  217

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FL  + TEP+T QTYGS+L NLA+IK FASGI+VPK YIWPV+ +++YL+  TSLV
Sbjct  218  FVFLDKNATEPTTKQTYGSILGNLATIKAFASGIVVPKDYIWPVN-AANYLEAPTSLV  274



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 165/237 (70%), Gaps = 15/237 (6%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FP SS +AY    L +   V +WCD+QLTKDGVGICFP + LDNAS+V  +  +
Sbjct  42   GGFSGMFPYSSKDAYELVKLIT-PGVTLWCDLQLTKDGVGICFPSLNLDNASDVKNILPN  100

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
             +            WF  DF +KQL  V+L Q + SR+  FD     I T+E+V N+   
Sbjct  101  NKE-----------WFSSDFTWKQLFNVSLVQNINSRTEIFD-VNDPIWTIEEVANR-GA  147

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
              LWLN+Q  +FY+QHNLSMR  V+S+S+R+  N+ISSPE++FL+S+ + + PRVTKL+F
Sbjct  148  SSLWLNIQDSAFYAQHNLSMRNTVVSLSKRIKFNFISSPEISFLQSMKNSVKPRVTKLIF  207

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FL  D+ +P TN++YGSL +NL+ I+TF+SGILVPKSYIWPV  S  YL+P TSLV
Sbjct  208  KFLDQDQIDPFTNKSYGSLAKNLSYIRTFSSGILVPKSYIWPV-SSDHYLRPHTSLV  263



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   236 bits (601),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 154/237 (65%), Gaps = 40/237 (17%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA LTS+ +V++WCD+QLTKDG GICFP + + NASN+   + +
Sbjct  43   GGFSGLFPDSSIDAYNFAMLTSVEDVVLWCDLQLTKDGAGICFPGLTMSNASNIEAAYPN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + +TYLVNGV T  WF IDF+ K L  VNL +G+ SRS RFDG    ILTV+DV  +++P
Sbjct  103  RTNTYLVNGVSTQGWFTIDFSLKDLNKVNLIRGILSRSERFDGNGYSILTVQDVNTELKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQH++FY+QHNLSM TF+ + S+ ++I++ISSPEVNF K IA R          
Sbjct  163  QGLWLNVQHEAFYAQHNLSMTTFLTTASKTIIIDFISSPEVNFFKKIAGR----------  212

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
                           +G               ILVPKSY+ P+D    YL P+TSLV
Sbjct  213  ---------------FGR--------------ILVPKSYVLPLDD-KQYLLPSTSLV  239



>ref|XP_008811210.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 162/238 (68%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D++LDN++ ++T+F  
Sbjct  62   GGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDLRLDNSTTISTVFPK  121

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            + +TY VNG     WF +DF   +L + V   Q ++SR S FDG    + +V+D+ +   
Sbjct  122  RDATYSVNGQSLKGWFSLDFTMDELISNVTTIQNIFSRPSLFDGN-LPVSSVQDI-SGFH  179

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLN+Q+  FY +H L    F+L+   ++  +YISSPE++FLKS+  ++    TKL+
Sbjct  180  PSRFWLNLQYGMFYKEHKLDPAKFILTALEKMDFDYISSPEIDFLKSLNGKLGQAKTKLI  239

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF   +E EPSTNQTY S+L+NLA+IK+FASGILVPKSYIWPV K   YL+  T+LV
Sbjct  240  FRFQDEEEVEPSTNQTYSSILKNLATIKSFASGILVPKSYIWPVSK-DMYLESATTLV  296



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TS+ +V++ C++QLTKDGVGIC  DI+LDN +N+A LF+ 
Sbjct  40   GGFSGLFPESSDFANQMALGTSVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFEK  99

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
               TY VNG   T WF +DF   QL   V+L Q ++SR S FDG    + TV+DV N   
Sbjct  100  GSKTYKVNGQDLTGWFALDFTADQLLANVSLVQNIFSRPSAFDGM-LPMSTVDDVRNS-N  157

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WLNVQ+D+FY+++ LS+  ++   +R   +NYISSPE+ FLK +   +    TKL+
Sbjct  158  PPAFWLNVQYDAFYTENKLSVTNYIQKATRLQGVNYISSPEIGFLKRMNGLVKKAKTKLI  217

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FL    TEP++NQTYGS+L NLA+IK FASGI+VPK YIWPV+ +++YL   TSLV
Sbjct  218  FVFLDKKATEPTSNQTYGSILGNLATIKKFASGIVVPKDYIWPVN-TANYLDAPTSLV  274



>ref|XP_006829998.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
 gb|ERM97414.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
Length=756

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 168/238 (71%), Gaps = 3/238 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A SFA   SL+NV++ C++QLTKDG GIC  D++LDN++N+A ++  
Sbjct  43   GGFSGLFPESSDFANSFALSVSLSNVVLLCELQLTKDGRGICRSDLRLDNSTNIADVYPH  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY+VNG P   WF IDF  +QL   V L Q ++SR S FD     I  VEDV     
Sbjct  103  NKKTYIVNGKPLQGWFAIDFLERQLFNKVTLIQNIFSRPSIFDNV-LPIAAVEDVQRMRP  161

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+VQ+D+FY+Q+ L M ++V+S+S+  ++ ++SSPEV  LK+I  ++    TKL+
Sbjct  162  PPRFWLSVQYDTFYTQNKLDMASYVISLSKTSILEFVSSPEVGLLKNINGKLKGGKTKLI  221

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FL  ++ EPST +TY SLL+NL+SIK FASG+LVPK+YIW V+ S  YL+  T+LV
Sbjct  222  FQFLKPEDIEPSTKKTYASLLENLSSIKAFASGVLVPKNYIWAVN-SDLYLKSPTTLV  278



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 162/238 (68%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D++LDN++ ++T+F  
Sbjct  62   GGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDLRLDNSTTISTVFPK  121

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            + +TY VNG     WF +DF   +L + V   Q ++SR S FDG    + +V+D+ +   
Sbjct  122  RDATYSVNGQSLKGWFSLDFTMDELISNVTTIQNIFSRPSLFDGN-LPVSSVQDI-SGFH  179

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLN+Q+  FY +H L    F+L+   ++  +YISSPE++FLKS+  ++    TKL+
Sbjct  180  PSRFWLNLQYGMFYKEHKLDPAKFILTALEKMDFDYISSPEIDFLKSLNGKLGQAKTKLI  239

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRF   +E EPSTNQTY S+L+NLA+IK+FASGILVPKSYIWPV K   YL+  T+LV
Sbjct  240  FRFQDEEEVEPSTNQTYSSILKNLATIKSFASGILVPKSYIWPVSK-DMYLESATTLV  296



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   233 bits (595),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 160/239 (67%), Gaps = 6/239 (3%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FP+SS  AY FA  +SL   ++ CD+QLTKDG GIC  D+KLDN++ ++++F  
Sbjct  60   GGFSGIFPESSQFAYQFALASSLKETVLLCDLQLTKDGAGICLSDLKLDNSTTISSVFPK  119

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGT-PQQILTVEDVFNKV  355
            + +TY VNG     WF +DF   +L + V   Q ++SR S FDG  P  +L     F+  
Sbjct  120  RDTTYSVNGQSLKGWFSVDFTTDELISNVTTIQNIFSRPSLFDGNLPVSLLQEISGFHPY  179

Query  356  QPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL  535
            Q    WLNVQ+D FY +H L    F+L+ S ++  +YISSPE+ FLKS+  +     TKL
Sbjct  180  Q---FWLNVQYDMFYKEHKLDPAKFILTASEKMDFDYISSPEIGFLKSLNGKFGKAKTKL  236

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            +FRFL  D  EPSTNQTY S+L++L +IK+FASGILVPKSYIWPV+K   YL+  T+LV
Sbjct  237  IFRFLDADAVEPSTNQTYSSILKSLTAIKSFASGILVPKSYIWPVNK-DKYLESATTLV  294



>ref|XP_010928375.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL7-like [Elaeis guineensis]
Length=768

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 160/244 (66%), Gaps = 10/244 (4%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV------GICFPDIKLDNASNV  163
            GG+SG+FP+SS  AY FA  TSL   ++ CD+QLTKDG       GIC  D+KLDN++ +
Sbjct  52   GGYSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGXXXXXXXGICRSDLKLDNSTTI  111

Query  164  ATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVED  340
            +T F  + +TY VNG     WF +DF   +L   V   Q ++SR S FDG     L++  
Sbjct  112  STAFPKRGTTYSVNGQSVHGWFSVDFTSDELLGNVTTIQNIFSRPSIFDG--NLPLSMVQ  169

Query  341  VFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINP  520
              ++  P   WLNVQ+D FY +H L    F+L+ S  VV +YISSPE+ FLKS+  ++  
Sbjct  170  EISRFHPSQFWLNVQYDMFYKEHKLDPAKFILTASENVVFDYISSPEIGFLKSLNGKLGK  229

Query  521  RVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPT  700
              TKL+FRFL  D  EPSTNQTY  +L+NLA+IK+FASGILVPKSY+WP +K   YL+P+
Sbjct  230  AKTKLIFRFLAADAVEPSTNQTYSLILKNLATIKSFASGILVPKSYVWPANK-DKYLEPS  288

Query  701  TSLV  712
            T+LV
Sbjct  289  TTLV  292



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TS+ +V++ C++QLTKDGVGIC  DI+LDN +N+A LF+ 
Sbjct  40   GGFSGLFPESSDFANQMALGTSVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFEK  99

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
               TY VNG   T WF +DF   QL   V+L Q ++SR S FDG    + TV+DV N   
Sbjct  100  GSKTYKVNGQDLTGWFALDFTADQLLANVSLVQNIFSRPSAFDGM-LPMSTVDDVRNS-N  157

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WLNVQ+D+FY+++ LS+  ++   +R   +NYISSPE+ FLK +   +N   TKL+
Sbjct  158  PPAFWLNVQYDAFYTENKLSVTNYIQKATRLQGVNYISSPEIGFLKRMNGLVNKAKTKLI  217

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FL    TEP+++QTYGS+L NLA+IK FASGI+VPK YIW V+ +++YL   TSLV
Sbjct  218  FVFLDKKATEPTSSQTYGSILGNLATIKKFASGIVVPKDYIWTVN-TANYLDAPTSLV  274



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 164/240 (68%), Gaps = 8/240 (3%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY F G  SL + I++CD+QLTKDGVG C  ++KLDN++N+A LF  
Sbjct  43   GGFSGLFPDSSRFAYDFVGQVSLPDSILYCDLQLTKDGVGFCQSELKLDNSTNIALLFPK  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNL--QQGVYSRSSRFDGTPQQILTVEDVFNKV  355
             Q +Y VNG     WF ID+    L L NL   Q V +R + FDG P  +L VEDV +  
Sbjct  103  GQKSYNVNGKDVRGWFAIDYLADAL-LPNLTSAQNVLTRPNAFDGQP--LLLVEDVTSIS  159

Query  356  QPPG-LWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTK  532
            +PP  +WLNVQ+D FY+   +S   ++  + R   INYISSPE+ FLKSIA++++   TK
Sbjct  160  KPPPRVWLNVQYDLFYNLQKISPALYLEDL-RFAGINYISSPEIGFLKSIAAKVDKVRTK  218

Query  533  LVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            LV RFL  +  EP+T Q YG +L+NLA+IK +ASGILVPK+YIWP++K   YL P T+LV
Sbjct  219  LVLRFLEPEAVEPTTKQAYGEILKNLAAIKPYASGILVPKTYIWPINK-EMYLMPPTTLV  277



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 160/238 (67%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A   SL     +C++QLTKD VGIC  +I LDN + ++  +  
Sbjct  57   GGFSGLFPESSTYAIDMAKSQSLPGYAFFCNLQLTKDSVGICLSNILLDNTTTISMFYPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF +DF   QL   V+L Q ++SR S FDGT   I TVED    ++
Sbjct  117  DQKTYNVNGKDIRGWFALDFTADQLLNNVSLTQNIFSRPSHFDGT-LPIATVEDALG-IK  174

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLNV +D+FYSQH +SM +FV  V R   +NYISSPE+ FLK++++++N   TKL+
Sbjct  175  PDKFWLNVPYDTFYSQHKISMASFVEKVIRFPSMNYISSPEIGFLKTVSAKVNKGRTKLI  234

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FL  +ETEP+T Q Y +L++NL  IK+ A+GILVPK YIWPV+K ++YL+  T+LV
Sbjct  235  FQFLDPEETEPTTKQKYSALVKNLEMIKSVAAGILVPKEYIWPVNK-NNYLEAATTLV  291



>ref|XP_004951679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Setaria italica]
Length=756

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 162/238 (68%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY FA  TSL +V+++CD+Q + D  G C   + LDN++ V+ +F  
Sbjct  44   GGFSGLFPDSSQYAYQFALSTSLPDVVLFCDLQFSSDSTGFCKTGLTLDNSTTVSEVFPK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY V+G     WF +DF   QL   V L Q ++SR S FDG+   + T++D+  +++
Sbjct  104  MEKTYKVHGEDVHGWFSLDFTADQLIQNVTLIQNIFSRPSTFDGS-MGMYTLDDIV-ELR  161

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP +WLNVQ++SF+ +H LS   ++L + ++  + YISS E++FLKS+  ++    TKLV
Sbjct  162  PPQIWLNVQYNSFFLEHKLSTEDYILGLPKKFSLTYISSTEIDFLKSLGGKLKKSKTKLV  221

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EPST +TYG LL++L SIK FA GILVPK+YIWP++K   YL P+TSLV
Sbjct  222  FRFLNEDVIEPSTKKTYGELLKDLKSIKDFAVGILVPKTYIWPLNK-DQYLSPSTSLV  278



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 160/238 (67%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A   SL     +C++QLTKD VGIC  +I LDN + ++  +  
Sbjct  57   GGFSGLFPESSTYAIDMAKSQSLPGYAFFCNLQLTKDSVGICLSNILLDNTTTISMFYPK  116

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF +DF   QL   V+L Q ++SR S FDGT   I TVED    ++
Sbjct  117  DQKTYNVNGKDIRGWFALDFTADQLLNNVSLTQNIFSRPSYFDGT-LPIATVEDALG-IK  174

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLNV +D+FYSQH +SM +FV  V R   +NYISSPE+ FLK++++++N   TKL+
Sbjct  175  PDKFWLNVPYDTFYSQHKISMASFVEKVIRFPSMNYISSPEIGFLKTVSAKVNKGRTKLI  234

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FL  +ETEP+T Q Y +L++NL  IK+ A+GILVPK YIWPV+K ++YL+  T+LV
Sbjct  235  FQFLDPEETEPTTKQKYSALVKNLEMIKSVAAGILVPKEYIWPVNK-NNYLEAATTLV  291



>tpg|DAA47913.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=607

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 156/238 (66%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG FPDSS  AYSF    S     MWCDVQLTKDGVG+C  D+ + N + V   +  
Sbjct  69   GGFSGAFPDSSEGAYSFGASASAPGTAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPG  128

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++ TY+++GV  T WF  DF   +L   V L Q ++SR+ R DG    I+TV DV + V 
Sbjct  129  RKRTYVIDGVHKTGWFVPDFTSAELLQSVYLTQAIWSRTERMDGI-YPIVTVPDVQSIVN  187

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
               +WLNVQH  FY Q +L M +++ S+ + V ++YISSPE+ FL++I++R+  R TKLV
Sbjct  188  TSPIWLNVQHPIFYKQRDLDMSSYIHSIRKLVRMDYISSPEIGFLRNISARVRRR-TKLV  246

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FL     + S NQTYGSL +NL  +++ ASGILVPK YIWPV  + +YL P+TS+V
Sbjct  247  FSFLDKKLLDHSVNQTYGSLARNLTFVRSVASGILVPKDYIWPV-TADNYLLPSTSIV  303



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 154/237 (65%), Gaps = 40/237 (17%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS +AY+FA LTS+ +V++WCD+QLTKDG GICFP + + NASN+   + +
Sbjct  43   GGFSGLFPDSSIDAYNFAMLTSVEDVVLWCDLQLTKDGAGICFPGLTMSNASNIEAAYPN  102

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            + +TYLVNGV T  WF IDF+ K L  VNL +G+ SRS RFDG    ILTV+DV  +++P
Sbjct  103  RTNTYLVNGVSTQGWFTIDFSLKDLNKVNLIRGILSRSERFDGNGYSILTVQDVNTELKP  162

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  541
             GLWLNVQH++FY+QHNLSM TF+ + S+ ++I++ISSPEVNF K IA R          
Sbjct  163  QGLWLNVQHEAFYAQHNLSMTTFLTTTSKTIIIDFISSPEVNFFKKIAGR----------  212

Query  542  RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
                           +G               ILVPKSY+ P+D    YL P+TSLV
Sbjct  213  ---------------FGR--------------ILVPKSYVLPLDD-KQYLLPSTSLV  239



>ref|XP_010050300.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=792

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 162/273 (59%), Gaps = 38/273 (14%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  A   A  +S+ +V+++CD+QLTKDG+GIC PDIKLDN +++A +F  
Sbjct  35   GGFSGIFPDSSEFAVDMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDNTTDIAMVFPK  94

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-----------------------TLVNL-------  271
             + TY VNG     WF +D+   +L                        L++L       
Sbjct  95   GEKTYTVNGQDLKGWFAVDYTSDELFNNVTCSRRKGCSRNYLRLKKTKKLISLFCHCIVL  154

Query  272  ------QQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  433
                   Q V SR S FDG    +  V+D+  +     LWLNVQ+D FY++H  S  T+V
Sbjct  155  LSFPAVVQNVLSRPSLFDGA-MSVQAVDDIVGRKTVNLLWLNVQYDGFYNEHKHSPATYV  213

Query  434  LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  613
              V R   ++Y+SSPE+ FLK++  ++N   TKL+FRFL  D  EPSTNQTYGS+L+NL 
Sbjct  214  QKVVRYYPVDYLSSPEIGFLKAMKGKVNKARTKLIFRFLAEDAVEPSTNQTYGSILKNLE  273

Query  614  SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            SIK FASGILVPK YI+PV  +  YL   TSLV
Sbjct  274  SIKAFASGILVPKEYIYPV-GTDKYLGAPTSLV  305



>ref|NP_001170117.1| hypothetical protein [Zea mays]
 gb|ACN35879.1| unknown [Zea mays]
Length=713

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 156/238 (66%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG FPDSS  AYSF    S     MWCDVQLTKDGVG+C  D+ + N + V   +  
Sbjct  69   GGFSGAFPDSSEGAYSFGASASAPGTAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPG  128

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++ TY+++GV  T WF  DF   +L   V L Q ++SR+ R DG    I+TV DV + V 
Sbjct  129  RKRTYVIDGVHKTGWFVPDFTSAELLQSVYLTQAIWSRTERMDGI-YPIVTVPDVQSIVN  187

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
               +WLNVQH  FY Q +L M +++ S+ + V ++YISSPE+ FL++I++R+  R TKLV
Sbjct  188  TSPIWLNVQHPIFYKQRDLDMSSYIHSIRKLVRMDYISSPEIGFLRNISARVR-RRTKLV  246

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FL     + S NQTYGSL +NL  +++ ASGILVPK YIWPV  + +YL P+TS+V
Sbjct  247  FSFLDKKLLDHSVNQTYGSLARNLTFVRSVASGILVPKDYIWPV-TADNYLLPSTSIV  303



>ref|XP_010443532.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=546

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 156/238 (66%), Gaps = 5/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ ++TLF  
Sbjct  47   GGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISTLFPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF ID++ + + + V+L Q ++SR S FDG    +  VEDV    +
Sbjct  107  AQKTYKVNGQDLKGWFVIDYDAETIFSNVSLIQNIFSRPSIFDGQ-MPVSAVEDVLG-TK  164

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+
Sbjct  165  PPKFWLSVQYDAFYMEHKLSAAEYLRSLQFR-GINVISSPEIGFLKSIGMDAGRAKTKLI  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V
Sbjct  224  FEFKDPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFV  280



>ref|XP_010485211.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=431

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 155/238 (65%), Gaps = 5/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TS   + M C++Q++KDGVG+C  DI+LDNA+ ++TLF  
Sbjct  47   GGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMSKDGVGLCLSDIRLDNATTISTLFPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF +D++   + + V+L Q ++SR S FDG    +  VEDV    +
Sbjct  107  AQKTYKVNGQDLKGWFVLDYDADTIFSNVSLVQNIFSRPSIFDGQ-MPVSAVEDVLG-TK  164

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+
Sbjct  165  PPKFWLSVQYDAFYMEHKLSAAEYLRSLRFRG-INVISSPEIGFLKSIGMDAGRAKTKLI  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V
Sbjct  224  FEFKDPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFV  280



>ref|XP_008645839.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645847.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645851.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645857.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 tpg|DAA47914.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=745

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 156/238 (66%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG FPDSS  AYSF    S     MWCDVQLTKDGVG+C  D+ + N + V   +  
Sbjct  69   GGFSGAFPDSSEGAYSFGASASAPGTAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPG  128

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
            ++ TY+++GV  T WF  DF   +L   V L Q ++SR+ R DG    I+TV DV + V 
Sbjct  129  RKRTYVIDGVHKTGWFVPDFTSAELLQSVYLTQAIWSRTERMDGI-YPIVTVPDVQSIVN  187

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
               +WLNVQH  FY Q +L M +++ S+ + V ++YISSPE+ FL++I++R+  R TKLV
Sbjct  188  TSPIWLNVQHPIFYKQRDLDMSSYIHSIRKLVRMDYISSPEIGFLRNISARVR-RRTKLV  246

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F FL     + S NQTYGSL +NL  +++ ASGILVPK YIWPV  + +YL P+TS+V
Sbjct  247  FSFLDKKLLDHSVNQTYGSLARNLTFVRSVASGILVPKDYIWPV-TADNYLLPSTSIV  303



>emb|CDY11831.1| BnaC03g12570D [Brassica napus]
Length=566

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 160/238 (67%), Gaps = 5/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS +A +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF  
Sbjct  47   GGFSGLFPESSASANAFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF +D++   + + V+L Q ++SR S FDG    I  VEDV    +
Sbjct  107  AQKTYKVNGQDLKGWFALDYSADTIFSNVSLVQNIFSRPSIFDGQ-MPISAVEDVLG-TK  164

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+VQ+DSFY +H LS   ++ ++  R  I +ISSPE+ FLKSI        TKL+
Sbjct  165  PPKFWLSVQYDSFYMEHKLSAAEYLKTLRFR-GITFISSPEIAFLKSIGMDAGMSKTKLI  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F F   +  EP+TN+ Y  +L +LA+IK FASG+LVPK YIWP+D S++YL+P ++ V
Sbjct  224  FEFKDPEAIEPTTNKKYSEILLDLAAIKAFASGVLVPKDYIWPLD-SANYLKPASTFV  280



>ref|XP_002445920.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
 gb|EES15415.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
Length=885

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 162/243 (67%), Gaps = 11/243 (5%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSL--TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  175
            GGFSG+FPDSS +AYSFA + S   T   MWCDVQLTKDGVG+C  DI ++N + V   +
Sbjct  166  GGFSGVFPDSSQDAYSFAKVASAPGTGTAMWCDVQLTKDGVGVCLRDINMNNCTTVGQAY  225

Query  176  KDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVED---V  343
              ++ TY+++G+  T WF  DF   +L + V L Q ++SRS RFD     I++V D   +
Sbjct  226  PARKRTYVIDGMHKTGWFVSDFTIAELQSAVYLTQAIWSRSERFDAI-YPIVSVTDFQYL  284

Query  344  FNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPR  523
             N   P  +WLNVQH  FY QH L M  ++ S+ + V ++YISSPE+ FLK+I++R+  R
Sbjct  285  VNMSSP--VWLNVQHPIFYKQHGLDMSRYIFSIRKLVSMDYISSPELGFLKNISARVG-R  341

Query  524  VTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTT  703
             TKLV+ FL  +  + S NQTYG L  NL  IK+ ASGI+VPK YIWPV  S +YL+P+T
Sbjct  342  KTKLVYSFLDKNLLDHSMNQTYGLLSTNLTFIKSIASGIMVPKDYIWPV-TSDNYLRPST  400

Query  704  SLV  712
            S+V
Sbjct  401  SIV  403



>gb|AFW70515.1| hypothetical protein ZEAMMB73_076757 [Zea mays]
Length=366

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 159/238 (67%), Gaps = 5/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSG+FPDSS  AY FA   SL +V++ CD+Q + D +G C   + LDN++ V+  F  
Sbjct  44   GGFSGVFPDSSQFAYQFALTASLPDVVLLCDLQFSSDHIGFCKTGLTLDNSTTVSERFPK  103

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             + TY + G     WF +DF  +QL   + L Q ++SR S FD +   + T++DV  ++ 
Sbjct  104  MERTYKLLGEDVHGWFSLDFTAEQLVQNITLIQNIFSRPSTFDDS-LGMYTLDDVV-ELH  161

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP +WLNVQ++SF+ +H LS   ++L + +   ++YISSPEV FLKS+A ++    TKL+
Sbjct  162  PPQIWLNVQYNSFFLEHKLSSEDYILELPKDS-LSYISSPEVEFLKSLAGKLKKAKTKLI  220

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  +  EPST +TYG LL++L SIK FA+GILVPK+YIWP+ K   YL P+TSLV
Sbjct  221  FRFLNENVEEPSTKKTYGELLKDLKSIKAFAAGILVPKTYIWPL-KKDQYLAPSTSLV  277



>ref|XP_006474608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Citrus sinensis]
Length=789

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 160/239 (67%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GG SG+FP+SS  AY  A    L+N IM C++Q +KDG+G+C  D++L+N + +   FKD
Sbjct  61   GGSSGVFPESSSLAYIMAKSNCLSNAIMLCNLQFSKDGLGVCLSDVRLNNITTINGAFKD  120

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  361
            +Q+T  +NG     WF +D+  +QL  + L Q VY+RS  FD T Q I T + + N    
Sbjct  121  QQTTKNINGNNVRGWFSVDYTLEQLGQLYLVQNVYTRSEAFDNT-QPIPTPDTIVNYDGV  179

Query  362  PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVIN--YISSPEVNFLKSIASRINPRVTKL  535
              LWLNV +D FYSQHN+S   ++    ++++ N  YISSPE+ FLK++  +++   TKL
Sbjct  180  SNLWLNVPYDLFYSQHNISAAKYITEYLQKLISNVYYISSPEIGFLKTMDRKVDHNTTKL  239

Query  536  VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            VF  L  +  EP+TNQTYGS+L+NL +IK+FASGI+VPKSYI PV+  + YL+P T+LV
Sbjct  240  VFMVLEPNAVEPTTNQTYGSILKNLTAIKSFASGIVVPKSYIIPVNNKTRYLEPATTLV  298



>gb|KCW70260.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=574

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  215  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  394
            T  WF IDF    L  V L QG+YSR+++FDG    ILTV+D+ ++V+PP LWLN+QHD 
Sbjct  3    TQGWFSIDFTLNDLANVVLTQGIYSRTNKFDGNLFPILTVQDMVSQVKPPALWLNIQHDM  62

Query  395  FYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  574
            F++QHNLSMR+FV++ S+ V+I+YISSPEV+FL+SIA R++P  TKL+FRF+G D  EPS
Sbjct  63   FFTQHNLSMRSFVIATSKSVIIDYISSPEVDFLRSIAGRVSPTKTKLIFRFMGKDVLEPS  122

Query  575  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             NQTYGSL +NL  +KTFASGILVPK YIWPVD  S+YLQ  TSLV
Sbjct  123  INQTYGSLSKNLTFVKTFASGILVPKVYIWPVD-GSNYLQAHTSLV  167



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 156/238 (66%), Gaps = 5/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ ++TLF  
Sbjct  47   GGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISTLFAK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF ID++ + + + V+L Q ++SR S FDG    +  VEDV    +
Sbjct  107  AQKTYKVNGQDLKGWFVIDYDAETIFSNVSLIQNIFSRPSIFDGQ-MPVSAVEDVLG-TK  164

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+
Sbjct  165  PPKFWLSVQYDAFYMEHKLSAAEYLRSLQFR-GINVISSPEIGFLKSIGMDAGRAKTKLI  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V
Sbjct  224  FEFKEPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFV  280



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 157/238 (66%), Gaps = 5/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS +A   A  TS   + M C++Q+TKDGVG+C  DI LDNA+ ++TLF  
Sbjct  47   GGFSGLFPESSASANDLAISTSSPGLTMLCNLQMTKDGVGLCLSDITLDNATTISTLFPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF +D++   + + V+L Q ++SR S FDG    +  VEDV    +
Sbjct  107  AQKTYKVNGQDLKGWFVLDYSADTIFSNVSLVQNIFSRPSIFDGQ-MPVSAVEDVLG-AK  164

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+VQ+DSFY +H LS   ++ S+  R  IN+ISSPE+ FLKSI        TKL+
Sbjct  165  PPKFWLSVQYDSFYMEHKLSTAEYLRSLGLRG-INFISSPEIGFLKSIGMDAGRAKTKLI  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F F   +  EP+TN+ Y  L QNLA+IK FASGILVPK YIWP+D S+ Y++P +++V
Sbjct  224  FEFKDPEAIEPTTNKKYSELQQNLAAIKAFASGILVPKDYIWPID-SAKYIKPASTIV  280



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 157/238 (66%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP++S  A + A   SL     +C++QLTKD VGIC  +I LDN + ++  +  
Sbjct  53   GGFSGLFPEASTYANNMAKSLSLQGSAFFCNLQLTKDSVGICLSNILLDNTTTISMFYPK  112

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQ-LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF +DF   Q L  V+L Q +YSR S+FDG    I TVED     +
Sbjct  113  GQKTYKVNGKDIRGWFALDFTADQVLNNVSLTQNIYSRPSQFDGI-LPIATVEDALG-AK  170

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLNVQ+D+FY++H +SM +FV   ++   I YISSPE+ FLK+I  ++N   TKL+
Sbjct  171  PDKFWLNVQYDAFYNEHKISMASFVEKAAKFAPIPYISSPEIRFLKAIGGKVNKMRTKLI  230

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FL  +ETEP+T Q Y +L++ L  IK+ A+GILVPK YIWPV+K ++Y++  T+LV
Sbjct  231  FQFLDPEETEPTTKQKYSALVKQLGMIKSVAAGILVPKEYIWPVNK-NNYVEKATTLV  287



>gb|AFW66254.1| hypothetical protein ZEAMMB73_246886 [Zea mays]
Length=755

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 158/238 (66%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFPDSS  AY  A  TSL +V++ CD+Q + D +G C   + LDN++ VA +F  
Sbjct  45   GGFSGLFPDSSQMAYQLALSTSLPDVVLLCDLQFSSDRIGFCKTGLTLDNSTTVAEIFPK  104

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
               TY + G     WF +DF  +QL   V L Q ++SR S FD +   + T++DV  ++ 
Sbjct  105  MDRTYKLQGEDVHGWFSLDFTAEQLVQNVTLIQNIFSRPSTFDAS-FGMYTLDDVV-ELH  162

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP +WLNV+++SF+ +H LS   ++L + +   + YISSPE+ FLKS++ ++    TKL+
Sbjct  163  PPQIWLNVEYNSFFMEHKLSSEDYILELPKDFSLTYISSPEIGFLKSLSGKLRNAKTKLI  222

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            FRFL  D  EPST +TYG LL++L SIK FA+G+LVPK+YIWP+ K   YL P+TSLV
Sbjct  223  FRFLNEDVEEPSTKKTYGELLKDLKSIKEFAAGVLVPKTYIWPL-KKDQYLAPSTSLV  279



>ref|XP_009358473.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 157/238 (66%), Gaps = 4/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GG SGLFP++S  A   A   SL     +C++QL+KD VGIC  +I LDN + ++T F +
Sbjct  53   GGLSGLFPEASIPANDLAKTLSLPGSAFFCNLQLSKDNVGICLSNILLDNTTTISTFFPN  112

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF +DF   +L   V+L Q +YSR S+FDG    I TVEDV  + +
Sbjct  113  GQKTYNVNGKDIRGWFALDFTADELLANVSLTQNIYSRPSQFDGM-MPIATVEDVL-ETK  170

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            P   WLNV +DSFY+QH +SM +FV    +   I YISSPE+ FLK+I  ++N   TKL+
Sbjct  171  PNKFWLNVPYDSFYNQHKISMVSFVEKAVKFAPIPYISSPEIGFLKAIGGKVNKMKTKLI  230

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F+FL  +ETEP+T + Y +L++ L  IK+ A+GILVPK YIWPV+K ++YL+  T+LV
Sbjct  231  FQFLYPEETEPTTKEKYSALVKQLGMIKSVAAGILVPKEYIWPVNK-NNYLEAATTLV  287



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 156/238 (66%), Gaps = 5/238 (2%)
 Frame = +2

Query  2    GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  181
            GGFSGLFP+SS  A   A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ ++TLF  
Sbjct  47   GGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISTLFPK  106

Query  182  KQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQ  358
             Q TY VNG     WF ID++ + + + V+L Q ++SR S FDG    +  VEDV    +
Sbjct  107  AQKTYKVNGQDLKGWFVIDYDAETIFSNVSLIQNIFSRPSIFDGQ-MPVSAVEDVLG-TK  164

Query  359  PPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLV  538
            PP  WL+VQ+D+FY +H LS   ++ S+  R  I+ ISSPE+ FLKSI        TKL+
Sbjct  165  PPKFWLSVQYDAFYMEHKLSAAEYLRSLQFR-GISVISSPEIGFLKSIGMDAGRAKTKLI  223

Query  539  FRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
            F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V
Sbjct  224  FEFKNPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFV  280



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  215  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  394
            T  WF IDF    L  V L QG+YSR+++FDG    ILTV+D+ ++V+PP LWLN+QHD 
Sbjct  3    TQGWFSIDFTLNDLANVVLTQGIYSRTNKFDGNLFPILTVQDMVSQVKPPALWLNIQHDM  62

Query  395  FYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  574
            F++QHNLSMR+FV++ S+ V+I+YISSPEV+FL+SIA R++P  TKL+FRF+G D  EPS
Sbjct  63   FFTQHNLSMRSFVIATSKSVIIDYISSPEVDFLRSIAGRVSPTKTKLIFRFMGKDVLEPS  122

Query  575  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLV  712
             NQTYGSL +NL  +KTFASGILVPK YIWPVD  S+YLQ  TSLV
Sbjct  123  INQTYGSLSKNLTFVKTFASGILVPKVYIWPVD-GSNYLQAHTSLV  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395