BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050C21

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAB41076.1|  MAR-binding protein                                    384   1e-127   Nicotiana tabacum [American tobacco]
ref|XP_009769588.1|  PREDICTED: probable nucleolar protein 5-2          383   2e-127   Nicotiana sylvestris
ref|XP_009591833.1|  PREDICTED: probable nucleolar protein 5-2          382   4e-127   Nicotiana tomentosiformis
emb|CAN73717.1|  hypothetical protein VITISV_038844                     376   9e-126   Vitis vinifera
ref|XP_004247627.1|  PREDICTED: probable nucleolar protein 5-2          378   2e-125   
ref|XP_006362168.1|  PREDICTED: probable nucleolar protein 5-2-li...    377   2e-125   
emb|CBI34244.3|  unnamed protein product                                375   3e-125   Vitis vinifera
emb|CDP04715.1|  unnamed protein product                                372   1e-124   Coffea canephora [robusta coffee]
ref|XP_002273273.2|  PREDICTED: probable nucleolar protein 5-2          375   3e-124   Vitis vinifera
ref|XP_010243588.1|  PREDICTED: probable nucleolar protein 5-1          375   5e-124   Nelumbo nucifera [Indian lotus]
ref|XP_009382561.1|  PREDICTED: probable nucleolar protein 5-2          375   5e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004239682.1|  PREDICTED: probable nucleolar protein 5-2          373   6e-124   Solanum lycopersicum
ref|XP_006345813.1|  PREDICTED: probable nucleolar protein 5-2-like     373   9e-124   Solanum tuberosum [potatoes]
ref|XP_008799299.1|  PREDICTED: probable nucleolar protein 5-2          372   1e-123   Phoenix dactylifera
tpg|DAA45361.1|  TPA: hypothetical protein ZEAMMB73_906298              369   2e-123   
ref|XP_010904781.1|  PREDICTED: probable nucleolar protein 5-2          374   3e-123   Elaeis guineensis
ref|XP_010241493.1|  PREDICTED: probable nucleolar protein 5-2 is...    373   4e-123   Nelumbo nucifera [Indian lotus]
ref|XP_010097360.1|  hypothetical protein L484_010238                   371   4e-123   
ref|XP_008655653.1|  PREDICTED: probable nucleolar protein 5-2          371   1e-122   Zea mays [maize]
ref|XP_008671899.1|  PREDICTED: probable nucleolar protein 5-2          366   2e-122   
ref|XP_010938712.1|  PREDICTED: probable nucleolar protein 5-2          372   2e-122   Elaeis guineensis
ref|XP_008660157.1|  PREDICTED: probable nucleolar protein 5-2          370   3e-122   Zea mays [maize]
ref|XP_008649917.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    362   4e-122   
ref|XP_009411704.1|  PREDICTED: probable nucleolar protein 5-1          370   4e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456868.1|  hypothetical protein SORBIDRAFT_03g044260          370   6e-122   
ref|XP_011099778.1|  PREDICTED: probable nucleolar protein 5-2          370   8e-122   Sesamum indicum [beniseed]
ref|XP_003557835.1|  PREDICTED: probable nucleolar protein 5-2          369   1e-121   Brachypodium distachyon [annual false brome]
ref|XP_008796213.1|  PREDICTED: probable nucleolar protein 5-2 is...    369   1e-121   Phoenix dactylifera
ref|XP_008796212.1|  PREDICTED: probable nucleolar protein 5-2 is...    369   1e-121   Phoenix dactylifera
ref|XP_008666415.1|  PREDICTED: probable nucleolar protein 5-2          363   2e-121   
ref|NP_001050112.1|  Os03g0350100                                       368   2e-121   
ref|XP_011099781.1|  PREDICTED: probable nucleolar protein 5-2          369   2e-121   Sesamum indicum [beniseed]
ref|XP_010687356.1|  PREDICTED: probable nucleolar protein 5-2          368   2e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004984388.1|  PREDICTED: probable nucleolar protein 5-2-like     368   3e-121   Setaria italica
gb|ABF95925.1|  Nucleolar protein NOP5, putative, expressed             368   3e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650080.1|  PREDICTED: probable nucleolar protein 5-2-like     367   4e-121   Oryza brachyantha
ref|NP_001050113.1|  Os03g0350300                                       367   4e-121   
ref|XP_007208461.1|  hypothetical protein PRUPE_ppa003941mg             366   5e-121   Prunus persica
dbj|BAN15014.1|  SAR DNA binding protein                                366   5e-121   Bromus inermis [awnless brome grass]
ref|XP_010241470.1|  PREDICTED: probable nucleolar protein 5-2 is...    367   7e-121   Nelumbo nucifera [Indian lotus]
ref|XP_008218165.1|  PREDICTED: probable nucleolar protein 5-2          366   8e-121   Prunus mume [ume]
emb|CAK22424.1|  matrix attachment region binding protein               367   8e-121   Beta vulgaris [beet]
gb|EEC75255.1|  hypothetical protein OsI_11566                          369   8e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_010025094.1|  PREDICTED: probable nucleolar protein 5-2          367   9e-121   Eucalyptus grandis [rose gum]
dbj|BAA31260.1|  SAR DNA binding protein                                364   9e-121   Oryza sativa [red rice]
ref|XP_004984387.1|  PREDICTED: probable nucleolar protein 5-2-like     366   1e-120   Setaria italica
ref|XP_002533223.1|  nucleolar protein nop56, putative                  365   3e-120   Ricinus communis
gb|EYU23804.1|  hypothetical protein MIMGU_mgv1a003941mg                363   1e-119   Erythranthe guttata [common monkey flower]
gb|EYU23803.1|  hypothetical protein MIMGU_mgv1a003693mg                363   1e-119   Erythranthe guttata [common monkey flower]
gb|KDP23603.1|  hypothetical protein JCGZ_23436                         364   1e-119   Jatropha curcas
gb|EMS65034.1|  hypothetical protein TRIUR3_04158                       361   8e-119   Triticum urartu
ref|XP_009342020.1|  PREDICTED: probable nucleolar protein 5-2          360   1e-118   Pyrus x bretschneideri [bai li]
ref|XP_008388628.1|  PREDICTED: probable nucleolar protein 5-2          360   1e-118   
ref|XP_002512277.1|  nucleolar protein nop56, putative                  361   1e-118   Ricinus communis
ref|XP_009364569.1|  PREDICTED: probable nucleolar protein 5-2          360   2e-118   Pyrus x bretschneideri [bai li]
ref|XP_008370662.1|  PREDICTED: probable nucleolar protein 5-2          360   3e-118   
ref|XP_003537858.1|  PREDICTED: probable nucleolar protein 5-2-like     359   5e-118   Glycine max [soybeans]
gb|KDP35364.1|  hypothetical protein JCGZ_10348                         359   7e-118   Jatropha curcas
gb|KHN25404.1|  Putative nucleolar protein 5-2                          358   8e-118   Glycine soja [wild soybean]
ref|XP_003540996.1|  PREDICTED: probable nucleolar protein 5-2-like     358   9e-118   Glycine max [soybeans]
ref|XP_007131795.1|  hypothetical protein PHAVU_011G042200g             357   4e-117   Phaseolus vulgaris [French bean]
gb|KJB26511.1|  hypothetical protein B456_004G245100                    353   6e-117   Gossypium raimondii
ref|XP_003562489.1|  PREDICTED: probable nucleolar protein 5-2          356   1e-116   Brachypodium distachyon [annual false brome]
ref|XP_008455669.1|  PREDICTED: probable nucleolar protein 5-2          354   4e-116   Cucumis melo [Oriental melon]
ref|XP_004139213.1|  PREDICTED: probable nucleolar protein 5-2-li...    354   4e-116   Cucumis sativus [cucumbers]
gb|EPS70798.1|  hypothetical protein M569_03961                         348   4e-116   Genlisea aurea
gb|KJB82563.1|  hypothetical protein B456_013G202500                    349   7e-116   Gossypium raimondii
gb|KJB45049.1|  hypothetical protein B456_007G287100                    349   8e-116   Gossypium raimondii
ref|XP_006838803.1|  hypothetical protein AMTR_s00002p00260990          355   8e-116   Amborella trichopoda
gb|KJB26509.1|  hypothetical protein B456_004G245100                    353   1e-115   Gossypium raimondii
ref|XP_004139212.1|  PREDICTED: probable nucleolar protein 5-2-li...    353   1e-115   
ref|XP_006491841.1|  PREDICTED: probable nucleolar protein 5-1-like     352   2e-115   Citrus sinensis [apfelsine]
ref|XP_007030688.1|  NOP56-like pre RNA processing ribonucleoprot...    348   3e-115   
ref|XP_006432265.1|  hypothetical protein CICLE_v10000758mg             352   3e-115   Citrus clementina [clementine]
ref|XP_004507477.1|  PREDICTED: probable nucleolar protein 5-1-like     352   3e-115   Cicer arietinum [garbanzo]
ref|XP_010674932.1|  PREDICTED: probable nucleolar protein 5-2          352   7e-115   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB82560.1|  hypothetical protein B456_013G202500                    351   8e-115   Gossypium raimondii
gb|KJB45047.1|  hypothetical protein B456_007G287100                    351   9e-115   Gossypium raimondii
gb|KHG01423.1|  putative nucleolar 5-2 -like protein                    351   1e-114   Gossypium arboreum [tree cotton]
gb|KHG00213.1|  putative nucleolar 5-2 -like protein                    350   1e-114   Gossypium arboreum [tree cotton]
ref|XP_002319598.1|  hypothetical protein POPTR_0013s03260g             350   1e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011013586.1|  PREDICTED: probable nucleolar protein 5-1          350   2e-114   Populus euphratica
ref|XP_011032532.1|  PREDICTED: probable nucleolar protein 5-1          350   2e-114   Populus euphratica
ref|XP_006382714.1|  hypothetical protein POPTR_0005s04710g             350   3e-114   Populus trichocarpa [western balsam poplar]
ref|XP_008650437.1|  PREDICTED: probable nucleolar protein 5-2          345   4e-114   
gb|KHG01259.1|  putative nucleolar 5-2 -like protein                    348   5e-114   Gossypium arboreum [tree cotton]
ref|XP_011003824.1|  PREDICTED: probable nucleolar protein 5-2          348   8e-114   Populus euphratica
ref|XP_007030686.1|  NOP56-like pre RNA processing ribonucleoprot...    348   1e-113   
ref|XP_007030689.1|  NOP56-like pre RNA processing ribonucleoprot...    342   1e-113   
ref|XP_003611088.1|  SAR DNA-binding protein-1                          345   5e-112   Medicago truncatula
ref|XP_010546633.1|  PREDICTED: probable nucleolar protein 5-2          343   7e-112   Tarenaya hassleriana [spider flower]
gb|AAC16330.1|  SAR DNA-binding protein-1                               343   1e-111   Pisum sativum [garden pea]
ref|XP_010550954.1|  PREDICTED: probable nucleolar protein 5-2          342   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_003606983.1|  SAR DNA-binding protein-1                          341   4e-111   
ref|XP_007030687.1|  NOP56-like pre RNA processing ribonucleoprot...    341   4e-111   
tpg|DAA47456.1|  TPA: hypothetical protein ZEAMMB73_782083              332   1e-110   
ref|XP_006468094.1|  PREDICTED: probable nucleolar protein 5-2-li...    339   2e-110   Citrus sinensis [apfelsine]
gb|ACJ85748.1|  unknown                                                 339   2e-110   Medicago truncatula
ref|XP_006468095.1|  PREDICTED: probable nucleolar protein 5-2-li...    340   2e-110   Citrus sinensis [apfelsine]
ref|XP_006468096.1|  PREDICTED: probable nucleolar protein 5-2-li...    339   3e-110   Citrus sinensis [apfelsine]
ref|XP_006468097.1|  PREDICTED: probable nucleolar protein 5-2-li...    340   3e-110   Citrus sinensis [apfelsine]
ref|XP_006436388.1|  hypothetical protein CICLE_v10031140mg             338   5e-110   Citrus clementina [clementine]
tpg|DAA47457.1|  TPA: hypothetical protein ZEAMMB73_782083              333   6e-109   
ref|XP_006408115.1|  hypothetical protein EUTSA_v10020473mg             333   3e-108   Eutrema salsugineum [saltwater cress]
emb|CDX80674.1|  BnaC07g27700D                                          333   6e-108   
ref|XP_009151230.1|  PREDICTED: probable nucleolar protein 5-1          332   1e-107   Brassica rapa
emb|CDY19706.1|  BnaA09g03590D                                          332   2e-107   Brassica napus [oilseed rape]
ref|XP_009111930.1|  PREDICTED: probable nucleolar protein 5-1          332   2e-107   Brassica rapa
emb|CDY00004.1|  BnaC09g02970D                                          331   2e-107   
ref|XP_010421656.1|  PREDICTED: probable nucleolar protein 5-1 is...    331   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010455156.1|  PREDICTED: probable nucleolar protein 5-1          330   3e-107   Camelina sativa [gold-of-pleasure]
gb|AAC16331.1|  SAR DNA-binding protein-2                               331   3e-107   Pisum sativum [garden pea]
ref|XP_010494044.1|  PREDICTED: probable nucleolar protein 5-1          329   1e-106   Camelina sativa [gold-of-pleasure]
gb|AFW84118.1|  hypothetical protein ZEAMMB73_870642                    330   1e-106   
gb|KFK37913.1|  hypothetical protein AALP_AA3G046300                    328   3e-106   Arabis alpina [alpine rockcress]
ref|XP_006394992.1|  hypothetical protein EUTSA_v10003966mg             327   7e-106   Eutrema salsugineum [saltwater cress]
emb|CDY52494.1|  BnaAnng11410D                                          325   4e-105   Brassica napus [oilseed rape]
ref|XP_002884489.1|  hypothetical protein ARALYDRAFT_896572             325   4e-105   Arabidopsis lyrata subsp. lyrata
ref|NP_187157.1|  putative SAR DNA-binding protein                      325   8e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485906.1|  PREDICTED: probable nucleolar protein 5-2          323   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010422824.1|  PREDICTED: probable nucleolar protein 5-2          323   4e-104   Camelina sativa [gold-of-pleasure]
gb|AAN72071.1|  SAR DNA-binding protein - like                          319   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756465.1|  predicted protein                                  323   6e-104   
gb|AAB61073.1|  similar to S. cerevisiae SIK1P (PID:g984964)            319   8e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CAE45597.1|  SAR DNA-binding protein-like protein                   321   2e-103   Lotus japonicus
ref|NP_198064.1|  putative SAR DNA-binding protein                      319   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464014.1|  PREDICTED: probable nucleolar protein 5-2          320   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_001753892.1|  predicted protein                                  320   1e-102   
ref|XP_002874406.1|  hypothetical protein ARALYDRAFT_489610             318   2e-102   
ref|XP_011457678.1|  PREDICTED: probable nucleolar protein 5-2          318   6e-102   Fragaria vesca subsp. vesca
gb|KFK23538.1|  hypothetical protein AALP_AAs63573U000200               315   1e-101   Arabis alpina [alpine rockcress]
ref|XP_006297275.1|  hypothetical protein CARUB_v10013290mg             317   4e-101   
ref|XP_006287421.1|  hypothetical protein CARUB_v10000627mg             315   5e-101   
ref|XP_002970093.1|  hypothetical protein SELMODRAFT_146841             311   3e-99    Selaginella moellendorffii
gb|EEE59058.1|  hypothetical protein OsJ_10836                          307   4e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002985284.1|  hypothetical protein SELMODRAFT_121625             306   2e-97    Selaginella moellendorffii
ref|XP_005850162.1|  hypothetical protein CHLNCDRAFT_57124              313   3e-95    Chlorella variabilis
ref|XP_005650009.1|  Nop-domain-containing protein                      290   2e-91    Coccomyxa subellipsoidea C-169
gb|KJB26512.1|  hypothetical protein B456_004G245100                    287   2e-90    Gossypium raimondii
gb|KIY95194.1|  putative nucleolar protein NOP5-2                       275   3e-88    Monoraphidium neglectum
gb|AAZ31075.2|  MAR-binding protein                                     281   5e-88    Dunaliella salina
gb|ACA96503.1|  MAR-binding protein                                     281   5e-88    Dunaliella salina
emb|CDY50583.1|  BnaC02g39570D                                          280   1e-87    Brassica napus [oilseed rape]
emb|CEF96991.1|  NOSIC                                                  278   2e-87    Ostreococcus tauri
ref|XP_002507734.1|  nucleolar RNA binding protein                      277   3e-87    Micromonas commoda
gb|KDO50620.1|  hypothetical protein CISIN_1g0088522mg                  266   3e-87    Citrus sinensis [apfelsine]
gb|AAY34142.1|  Nop58p                                                  275   3e-86    Physarum polycephalum
ref|XP_001416562.1|  predicted protein                                  274   8e-86    Ostreococcus lucimarinus CCE9901
ref|XP_007512606.1|  predicted protein                                  273   1e-85    Bathycoccus prasinos
ref|XP_009496003.1|  hypothetical protein H696_03867                    270   7e-85    Fonticula alba
ref|XP_006681446.1|  hypothetical protein BATDEDRAFT_33621              272   9e-85    Batrachochytrium dendrobatidis JAM81
emb|CAJ82550.1|  nucleolar protein 5                                    270   3e-84    Xenopus tropicalis [western clawed frog]
ref|NP_989298.1|  NOP58 ribonucleoprotein                               270   9e-84    Xenopus tropicalis [western clawed frog]
gb|AAH77204.1|  MGC78950 protein                                        270   2e-83    Xenopus laevis [clawed frog]
ref|NP_001086628.1|  NOP58 ribonucleoprotein                            270   2e-83    Xenopus laevis [clawed frog]
gb|AAI30064.1|  LOC398558 protein                                       267   3e-83    Xenopus laevis [clawed frog]
gb|AAH44082.1|  LOC398558 protein                                       267   3e-83    Xenopus laevis [clawed frog]
gb|AAI06292.1|  LOC398558 protein                                       267   1e-82    Xenopus laevis [clawed frog]
ref|XP_002166198.2|  PREDICTED: nucleolar protein 58-like               261   2e-82    
ref|XP_005995463.1|  PREDICTED: nucleolar protein 58 isoform X2         266   3e-82    Latimeria chalumnae
ref|XP_005995462.1|  PREDICTED: nucleolar protein 58 isoform X1         266   3e-82    Latimeria chalumnae
ref|XP_005777664.1|  hypothetical protein EMIHUDRAFT_206438             260   9e-82    Emiliania huxleyi CCMP1516
ref|XP_005771074.1|  hypothetical protein EMIHUDRAFT_75659              260   2e-81    Emiliania huxleyi CCMP1516
gb|KDD76960.1|  putative snoRNA binding domain-containing protein       262   2e-81    Helicosporidium sp. ATCC 50920
tpg|DAA42144.1|  TPA: hypothetical protein ZEAMMB73_016967              258   3e-81    
gb|KHN07217.1|  Putative nucleolar protein 5-2                          252   3e-81    Glycine soja [wild soybean]
emb|CDS04923.1|  hypothetical protein LRAMOSA07453                      262   3e-81    Lichtheimia ramosa
emb|CDH51673.1|  loc398558 protein                                      262   4e-81    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001690352.1|  nucleolar protein, component of C/D snoRNPs        262   6e-81    Chlamydomonas reinhardtii
ref|XP_006567771.1|  PREDICTED: nucleolar protein 58-like               264   7e-81    Apis mellifera [bee]
ref|XP_011399356.1|  putative nucleolar protein 5-2                     261   9e-81    Auxenochlorella protothecoides
ref|XP_006618628.1|  PREDICTED: nucleolar protein 58-like               263   1e-80    Apis dorsata [rock honeybee]
ref|XP_003230376.2|  PREDICTED: nucleolar protein 58-like               262   1e-80    Anolis carolinensis [Carolina anole]
ref|XP_007501981.1|  PREDICTED: nucleolar protein 58 isoform X4         262   2e-80    Monodelphis domestica
ref|XP_007501980.1|  PREDICTED: nucleolar protein 58 isoform X3         262   2e-80    Monodelphis domestica
ref|XP_007501979.1|  PREDICTED: nucleolar protein 58 isoform X2         261   2e-80    Monodelphis domestica
ref|XP_001371978.1|  PREDICTED: nucleolar protein 58 isoform X1         261   2e-80    Monodelphis domestica
ref|XP_003056558.1|  nucleolar RNA binding protein                      259   4e-80    Micromonas pusilla CCMP1545
ref|XP_003491528.1|  PREDICTED: nucleolar protein 58-like               261   8e-80    Bombus impatiens
ref|XP_001750802.1|  hypothetical protein                               258   2e-79    Monosiga brevicollis MX1
ref|XP_002598583.1|  hypothetical protein BRAFLDRAFT_113716             258   3e-79    Branchiostoma floridae
gb|EFX84998.1|  hypothetical protein DAPPUDRAFT_300779                  258   3e-79    Daphnia pulex
ref|XP_009054674.1|  hypothetical protein LOTGIDRAFT_144966             256   6e-79    Lottia gigantea
gb|EIE91295.1|  hypothetical protein RO3G_16006                         255   2e-78    Rhizopus delemar RA 99-880
ref|XP_008618047.1|  hypothetical protein SDRG_13728                    255   2e-78    Saprolegnia diclina VS20
ref|XP_011064344.1|  PREDICTED: nucleolar protein 58-like               259   2e-78    Acromyrmex echinatior
gb|KDO24106.1|  hypothetical protein SPRG_10894                         255   2e-78    Saprolegnia parasitica CBS 223.65
emb|CEP14638.1|  hypothetical protein                                   255   2e-78    Parasitella parasitica
ref|XP_008113176.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    253   4e-78    Anolis carolinensis [Carolina anole]
gb|EIE85756.1|  hypothetical protein RO3G_10466                         254   4e-78    Rhizopus delemar RA 99-880
ref|XP_011267939.1|  PREDICTED: nucleolar protein 58                    259   4e-78    Camponotus floridanus
ref|XP_011341650.1|  PREDICTED: nucleolar protein 58                    258   5e-78    Ooceraea biroi
dbj|GAN04212.1|  nop-domain-containing protein                          253   2e-77    Mucor ambiguus
gb|EPB89396.1|  hypothetical protein HMPREF1544_03765                   253   2e-77    Mucor circinelloides f. circinelloides 1006PhL
emb|CEI87149.1|  Putative U3 snoRNP protein Nop58                       248   4e-77    Rhizopus microsporus
ref|XP_009086324.1|  PREDICTED: nucleolar protein 58                    251   1e-76    Serinus canaria [canary]
gb|EMC81163.1|  Nucleolar protein 58                                    249   1e-76    
ref|XP_007422082.1|  PREDICTED: nucleolar protein 58                    251   1e-76    Python bivittatus
ref|XP_005519952.1|  PREDICTED: nucleolar protein 58                    251   2e-76    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006273562.1|  PREDICTED: nucleolar protein 58                    251   2e-76    Alligator mississippiensis
ref|XP_005049217.1|  PREDICTED: nucleolar protein 58                    251   2e-76    Ficedula albicollis
ref|XP_006017720.1|  PREDICTED: nucleolar protein 58                    251   2e-76    Alligator sinensis
ref|XP_010563240.1|  PREDICTED: nucleolar protein 58 isoform X2         249   3e-76    Haliaeetus leucocephalus
ref|XP_421942.1|  PREDICTED: nucleolar protein 58                       251   3e-76    Gallus gallus [bantam]
emb|CEI96131.1|  Putative Nucleolar protein 58                          249   3e-76    Rhizopus microsporus
emb|CCA22673.1|  nucleolar protein NOP5 putative                        249   3e-76    Albugo laibachii Nc14
emb|CEG70655.1|  Putative Nucleolar protein 58                          249   4e-76    Rhizopus microsporus
ref|XP_010711773.1|  PREDICTED: nucleolar protein 58                    250   4e-76    Meleagris gallopavo [common turkey]
ref|XP_005837542.1|  hypothetical protein GUITHDRAFT_66997              249   6e-76    Guillardia theta CCMP2712
ref|XP_004378293.1|  PREDICTED: nucleolar protein 58                    250   6e-76    Trichechus manatus latirostris
ref|XP_005306283.1|  PREDICTED: nucleolar protein 58 isoform X1         249   6e-76    Chrysemys picta bellii
gb|EGW06124.1|  Nucleolar protein 58                                    240   6e-76    Cricetulus griseus [Chinese hamsters]
ref|XP_010563232.1|  PREDICTED: nucleolar protein 58 isoform X1         249   7e-76    Haliaeetus leucocephalus
ref|XP_005511378.1|  PREDICTED: nucleolar protein 58                    249   8e-76    
ref|XP_005144700.1|  PREDICTED: nucleolar protein 58                    249   8e-76    Melopsittacus undulatus
ref|XP_009836884.1|  hypothetical protein H257_11594                    249   9e-76    Aphanomyces astaci
ref|XP_002189225.1|  PREDICTED: nucleolar protein 58                    249   1e-75    Taeniopygia guttata
ref|XP_008872332.1|  hypothetical protein H310_08394                    248   2e-75    Aphanomyces invadans
ref|XP_004367446.1|  matrix attachment region binding protein           248   2e-75    Acanthamoeba castellanii str. Neff
ref|XP_002903084.1|  nucleolar protein NOP5                             248   2e-75    Phytophthora infestans T30-4
gb|ETL31667.1|  hypothetical protein L916_15560                         247   4e-75    Phytophthora parasitica
emb|CBJ32359.1|  conserved unknown protein                              248   4e-75    Ectocarpus siliculosus
ref|XP_008911207.1|  hypothetical protein PPTG_15671                    246   4e-75    Phytophthora parasitica INRA-310
gb|ETI38018.1|  hypothetical protein F443_16119                         246   5e-75    Phytophthora parasitica P1569
ref|XP_003743589.1|  PREDICTED: nucleolar protein 58                    248   5e-75    Galendromus occidentalis
ref|XP_008187145.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    246   6e-75    
ref|XP_009530825.1|  hypothetical protein PHYSODRAFT_246404             245   1e-74    Phytophthora sojae
gb|ESA16249.1|  hypothetical protein GLOINDRAFT_158776                  243   1e-74    
ref|XP_011308274.1|  PREDICTED: nucleolar protein 58                    246   3e-74    Fopius arisanus
dbj|BAJ91724.1|  predicted protein                                      247   3e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003907873.1|  PREDICTED: nucleolar protein 58 isoform X1         242   3e-74    
ref|XP_001641027.1|  predicted protein                                  244   4e-74    Nematostella vectensis
gb|AAH87637.1|  Nol5 protein                                            243   5e-74    Rattus norvegicus [brown rat]
ref|XP_002407966.1|  ribosome biogenesis protein - Nop58p/Nop5p, ...    244   5e-74    Ixodes scapularis [blacklegged tick]
ref|XP_005574023.1|  PREDICTED: nucleolar protein 58 isoform X4         242   5e-74    
ref|XP_006636806.1|  PREDICTED: nucleolar protein 58-like               244   6e-74    
ref|XP_007190607.1|  PREDICTED: nucleolar protein 58 isoform X6         241   7e-74    Balaenoptera acutorostrata scammoni
ref|XP_003701979.1|  PREDICTED: nucleolar protein 58-like               246   7e-74    Megachile rotundata
gb|AAC23535.1|  unknown                                                 242   8e-74    Rattus sp. [rats]
dbj|BAE21954.1|  unnamed protein product                                242   1e-73    Mus musculus [mouse]
ref|XP_008556600.1|  PREDICTED: nucleolar protein 58                    246   1e-73    
emb|CAH91951.1|  hypothetical protein                                   242   1e-73    Pongo abelii [orang utan]
ref|XP_005574021.1|  PREDICTED: nucleolar protein 58 isoform X2         242   2e-73    Macaca fascicularis [crab eating macaque]
ref|XP_002874404.1|  hypothetical protein ARALYDRAFT_326985             241   2e-73    
gb|KFH64217.1|  hypothetical protein MVEG_10042                         242   2e-73    Mortierella verticillata NRRL 6337
dbj|BAE22082.1|  unnamed protein product                                242   3e-73    Mus musculus [mouse]
ref|XP_004701594.1|  PREDICTED: nucleolar protein 58                    243   3e-73    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007520557.1|  PREDICTED: nucleolar protein 58                    243   3e-73    Erinaceus europaeus [common hedgehog]
ref|XP_009236281.1|  PREDICTED: nucleolar protein 58                    242   3e-73    
ref|XP_003483763.1|  PREDICTED: nucleolar protein 58                    243   3e-73    
gb|AAH09306.1|  NOP58 protein                                           242   4e-73    Homo sapiens [man]
ref|XP_005366385.1|  PREDICTED: nucleolar protein 58 isoform X2         242   4e-73    
ref|XP_006153110.1|  PREDICTED: nucleolar protein 58-like isoform X1    242   4e-73    Tupaia chinensis
ref|XP_004601337.1|  PREDICTED: nucleolar protein 58                    242   5e-73    Sorex araneus [Eurasian shrew]
ref|XP_005858297.1|  PREDICTED: nucleolar protein 58 isoform X1         242   5e-73    Myotis brandtii
ref|XP_004426861.1|  PREDICTED: nucleolar protein 58                    242   5e-73    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004393512.1|  PREDICTED: nucleolar protein 58 isoform 2          242   5e-73    Odobenus rosmarus divergens
ref|XP_008144676.1|  PREDICTED: nucleolar protein 58                    242   5e-73    Eptesicus fuscus
ref|XP_006921426.1|  PREDICTED: nucleolar protein 58 isoform X1         242   5e-73    Pteropus alecto
ref|NP_057018.1|  nucleolar protein 58                                  242   5e-73    Homo sapiens [man]
ref|XP_003406179.1|  PREDICTED: nucleolar protein 58 isoform X1         242   5e-73    Loxodonta africana [African bush elephant]
ref|XP_003820813.1|  PREDICTED: nucleolar protein 58 isoform X1         242   5e-73    Pan paniscus [bonobo]
ref|XP_516036.2|  PREDICTED: nucleolar protein 58 isoform X1            242   5e-73    Pan troglodytes
ref|XP_005366384.1|  PREDICTED: nucleolar protein 58 isoform X1         242   5e-73    Microtus ochrogaster [prairie voles]
ref|XP_003785079.1|  PREDICTED: nucleolar protein 58                    242   5e-73    Otolemur garnettii
ref|NP_001248115.1|  nucleolar protein 58                               242   5e-73    Macaca mulatta [rhesus macaque]
ref|XP_006862038.1|  PREDICTED: nucleolar protein 58                    242   5e-73    Chrysochloris asiatica
ref|XP_008063382.1|  PREDICTED: nucleolar protein 58                    242   6e-73    Carlito syrichta
ref|XP_003254003.1|  PREDICTED: nucleolar protein 58                    242   6e-73    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004764235.1|  PREDICTED: nucleolar protein 58 isoform X2         242   6e-73    
ref|XP_007964075.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    Chlorocebus sabaeus
ref|XP_005640604.1|  PREDICTED: nucleolar protein 58 isoform X2         242   6e-73    
ref|XP_006756294.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    Myotis davidii
ref|XP_005858298.1|  PREDICTED: nucleolar protein 58 isoform X2         242   6e-73    
ref|XP_004904636.1|  PREDICTED: nucleolar protein 58                    242   6e-73    
ref|XP_005397115.1|  PREDICTED: nucleolar protein 58                    242   6e-73    Chinchilla lanigera
ref|XP_008833672.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    Nannospalax galili
gb|ERE81087.1|  nucleolar protein 58                                    242   6e-73    Cricetulus griseus [Chinese hamsters]
ref|NP_061356.2|  nucleolar protein 58                                  242   6e-73    Mus musculus [mouse]
ref|XP_011223162.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    
ref|XP_006734634.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    
ref|XP_004393511.1|  PREDICTED: nucleolar protein 58 isoform 1          242   6e-73    
ref|XP_004764234.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    
ref|XP_005640603.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    
ref|XP_010614435.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    
ref|XP_002712586.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    
ref|NP_068522.1|  nucleolar protein 58                                  242   6e-73    
ref|XP_008685594.1|  PREDICTED: nucleolar protein 58 isoform X1         242   6e-73    
ref|XP_006935540.1|  PREDICTED: nucleolar protein 58 isoform X1         242   7e-73    
ref|XP_002749695.1|  PREDICTED: nucleolar protein 58 isoform X1         242   7e-73    
dbj|BAC31822.1|  unnamed protein product                                242   7e-73    
ref|XP_006734635.1|  PREDICTED: nucleolar protein 58 isoform X2         242   7e-73    
ref|XP_006975091.1|  PREDICTED: nucleolar protein 58 isoform X1         242   7e-73    
ref|XP_007090043.1|  PREDICTED: nucleolar protein 58 isoform X1         242   7e-73    
gb|EWM24974.1|  nucleolar protein expressed                             242   7e-73    
ref|XP_001601436.1|  PREDICTED: nucleolar protein 58                    243   7e-73    
ref|XP_003497458.1|  PREDICTED: nucleolar protein 58 isoform X1         242   8e-73    
ref|XP_004262889.1|  PREDICTED: nucleolar protein 58 isoform 2          241   9e-73    
ref|XP_003966575.1|  PREDICTED: nucleolar protein 58-like               241   9e-73    
ref|XP_007469243.1|  PREDICTED: nucleolar protein 58 isoform X2         241   9e-73    
ref|XP_007190602.1|  PREDICTED: nucleolar protein 58 isoform X1         241   9e-73    
ref|XP_005070655.1|  PREDICTED: nucleolar protein 58 isoform X2         241   1e-72    
ref|XP_004262888.1|  PREDICTED: nucleolar protein 58 isoform 1          241   1e-72    
ref|XP_007469242.1|  PREDICTED: nucleolar protein 58 isoform X1         241   1e-72    
ref|XP_005070654.1|  PREDICTED: nucleolar protein 58 isoform X1         241   1e-72    
ref|XP_010141276.1|  PREDICTED: nucleolar protein 58                    240   1e-72    
ref|XP_011154526.1|  PREDICTED: nucleolar protein 58                    244   1e-72    
gb|AAH44394.1|  Nop58 protein                                           241   2e-72    
ref|XP_006205258.1|  PREDICTED: nucleolar protein 58 isoform X3         241   2e-72    
ref|XP_006189993.1|  PREDICTED: nucleolar protein 58 isoform X3         241   2e-72    
ref|XP_006189992.1|  PREDICTED: nucleolar protein 58 isoform X2         241   2e-72    
ref|XP_007908792.1|  PREDICTED: nucleolar protein 58                    241   2e-72    
ref|XP_006205257.1|  PREDICTED: nucleolar protein 58 isoform X2         241   2e-72    
ref|XP_006205256.1|  PREDICTED: nucleolar protein 58 isoform X1         241   2e-72    
ref|XP_006189991.1|  PREDICTED: nucleolar protein 58 isoform X1         241   2e-72    
ref|XP_005338975.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    241   2e-72    
gb|EXX52337.1|  Nop58p                                                  244   2e-72    
gb|AAI51726.1|  NOP58 protein                                           241   2e-72    
ref|XP_002946402.1|  hypothetical protein VOLCADRAFT_102990             240   2e-72    
ref|XP_005676439.1|  PREDICTED: nucleolar protein 58 isoform X2         240   2e-72    
ref|XP_004004885.1|  PREDICTED: nucleolar protein 58                    240   2e-72    
ref|XP_007117841.1|  PREDICTED: nucleolar protein 58 isoform X1         241   2e-72    
ref|XP_005904317.1|  PREDICTED: nucleolar protein 58                    240   2e-72    
ref|NP_001179886.1|  nucleolar protein 58                               240   2e-72    
ref|XP_005202669.1|  PREDICTED: nucleolar protein 58 isoform X1         241   2e-72    
gb|AAI55195.1|  Nop58 protein                                           241   3e-72    
gb|AAI51885.1|  Nop58 protein                                           241   3e-72    
ref|XP_005980258.1|  PREDICTED: nucleolar protein 58 isoform X2         240   3e-72    
ref|NP_001009889.1|  nucleolar protein 58                               240   3e-72    
ref|XP_005676438.1|  PREDICTED: nucleolar protein 58 isoform X1         240   3e-72    
ref|XP_005165784.1|  PREDICTED: nucleolar protein 58 isoform X1         241   3e-72    
ref|XP_004458928.1|  PREDICTED: nucleolar protein 58 isoform 1          240   3e-72    
emb|CAB55989.2|  hypothetical protein                                   238   3e-72    
ref|XP_005980257.1|  PREDICTED: nucleolar protein 58 isoform X1         240   4e-72    
ref|XP_011171488.1|  PREDICTED: nucleolar protein 58                    243   5e-72    
ref|XP_006889153.1|  PREDICTED: nucleolar protein 58                    239   6e-72    
ref|XP_007248939.1|  PREDICTED: nucleolar protein 58-like               240   7e-72    
emb|CCI10534.1|  unnamed protein product                                238   8e-72    
emb|CBK23082.2|  unnamed protein product                                239   1e-71    
gb|KFB40543.1|  AGAP002171-PA-like protein                              238   4e-71    
ref|XP_004524214.1|  PREDICTED: nucleolar protein 58-like               236   4e-71    
ref|XP_008323109.1|  PREDICTED: nucleolar protein 58                    238   6e-71    
ref|XP_006082477.1|  PREDICTED: nucleolar protein 58                    237   7e-71    
gb|KHN70664.1|  Nucleolar protein 58                                    237   7e-71    
gb|ERE81088.1|  nucleolar protein 58                                    236   1e-70    
ref|XP_004929127.1|  PREDICTED: nucleolar protein 58-like isoform X3    235   2e-70    
ref|XP_004929126.1|  PREDICTED: nucleolar protein 58-like isoform X2    235   3e-70    
ref|XP_004929125.1|  PREDICTED: nucleolar protein 58-like isoform X1    235   3e-70    
ref|XP_002052488.1|  GJ17567                                            234   4e-70    
ref|XP_003384738.1|  PREDICTED: nucleolar protein 58-like               234   4e-70    
ref|XP_011484149.1|  PREDICTED: nucleolar protein 58                    230   7e-70    
ref|XP_004350742.1|  MAR-binding protein                                235   9e-70    
gb|KFP49456.1|  Nucleolar protein 58                                    229   9e-70    
ref|XP_308017.5|  AGAP002171-PA                                         233   9e-70    
gb|KDR23571.1|  Nucleolar protein 58                                    234   1e-69    
ref|XP_003766066.1|  PREDICTED: nucleolar protein 58                    235   1e-69    
gb|KFV47252.1|  Nucleolar protein 58                                    230   1e-69    
ref|XP_009962135.1|  PREDICTED: nucleolar protein 58                    230   2e-69    
ref|XP_002116484.1|  hypothetical protein TRIADDRAFT_30778              231   2e-69    
ref|XP_001864867.1|  nucleolar protein NOP5                             233   2e-69    
ref|NP_001133496.1|  Nucleolar protein 5                                233   2e-69    
ref|XP_010885076.1|  PREDICTED: nucleolar protein 58                    233   3e-69    
emb|CEI90787.1|  Putative NOSIC domain-containing protein               222   3e-69    
dbj|BAN20575.1|  hypothetical protein                                   233   3e-69    
gb|ENN72260.1|  hypothetical protein YQE_11121                          231   8e-69    
gb|ETN58428.1|  nucleolar protein NOP5                                  231   9e-69    
gb|AAY34140.1|  Nop58p                                                  226   1e-68    
gb|KFV52995.1|  Nucleolar protein 58                                    228   1e-68    
gb|EFA85918.1|  MAR-binding protein                                     233   1e-68    
ref|XP_007071996.1|  PREDICTED: nucleolar protein 58                    231   1e-68    
gb|KFV18563.1|  Nucleolar protein 58                                    230   2e-68    
ref|XP_003611091.1|  SAR DNA-binding protein-1                          220   2e-68    
ref|XP_005808115.1|  PREDICTED: nucleolar protein 58-like               230   2e-68    
ref|XP_973420.1|  PREDICTED: nucleolar protein 58                       231   2e-68    
gb|KFO12035.1|  Nucleolar protein 58                                    230   2e-68    
gb|KFR14872.1|  Nucleolar protein 58                                    228   2e-68    
ref|XP_008283621.1|  PREDICTED: nucleolar protein 58 isoform X2         230   3e-68    
ref|XP_008283620.1|  PREDICTED: nucleolar protein 58 isoform X1         230   3e-68    
ref|XP_009985382.1|  PREDICTED: nucleolar protein 58                    230   3e-68    
ref|XP_005484291.1|  PREDICTED: nucleolar protein 58                    229   4e-68    
ref|XP_004990291.1|  nucleolar protein 5                                229   4e-68    
ref|XP_010738555.1|  PREDICTED: nucleolar protein 58                    229   4e-68    
ref|XP_005097537.1|  PREDICTED: nucleolar protein 58-like               229   5e-68    
gb|KFP02491.1|  Nucleolar protein 58                                    227   6e-68    
gb|KFV10796.1|  Nucleolar protein 58                                    228   6e-68    
gb|KFQ17268.1|  Nucleolar protein 58                                    228   7e-68    
ref|XP_668690.1|  snoRNA binding domain                                 227   7e-68    
gb|KFQ12269.1|  Nucleolar protein 58                                    228   8e-68    
gb|KGL97403.1|  Nucleolar protein 58                                    228   9e-68    
gb|KFP26270.1|  Nucleolar protein 58                                    228   9e-68    
gb|KFO75339.1|  Nucleolar protein 58                                    228   1e-67    
gb|KFQ45269.1|  Nucleolar protein 58                                    228   1e-67    
gb|KFP42804.1|  Nucleolar protein 58                                    228   1e-67    
ref|XP_006809619.1|  PREDICTED: nucleolar protein 58-like               228   1e-67    
ref|XP_004570504.1|  PREDICTED: nucleolar protein 58-like isoform X2    228   1e-67    
ref|XP_005943428.1|  PREDICTED: nucleolar protein 58-like isoform X1    228   1e-67    
ref|XP_004570503.1|  PREDICTED: nucleolar protein 58-like isoform X1    228   1e-67    
ref|XP_005943429.1|  PREDICTED: nucleolar protein 58-like isoform X2    228   1e-67    
ref|XP_005416180.1|  PREDICTED: nucleolar protein 58                    228   1e-67    
gb|KFQ00730.1|  Nucleolar protein 58                                    228   1e-67    
ref|XP_002430815.1|  Nucleolar protein NOP5, putative                   229   1e-67    
ref|XP_008423022.1|  PREDICTED: nucleolar protein 58                    228   1e-67    
ref|XP_003696631.1|  PREDICTED: nucleolar protein 58-like               233   1e-67    
gb|ETE66100.1|  Nucleolar protein 58                                    228   2e-67    
ref|XP_010076307.1|  PREDICTED: nucleolar protein 58                    228   2e-67    
gb|KFQ94812.1|  Nucleolar protein 58                                    227   2e-67    
ref|XP_005016922.1|  PREDICTED: nucleolar protein 58 isoform X2         227   2e-67    
gb|KFP88851.1|  Nucleolar protein 58                                    227   2e-67    
ref|XP_005016921.1|  PREDICTED: nucleolar protein 58 isoform X1         227   2e-67    
gb|KFZ49164.1|  Nucleolar protein 58                                    227   2e-67    
ref|XP_005237133.1|  PREDICTED: nucleolar protein 58                    228   2e-67    
ref|XP_002088107.1|  GE18393                                            227   2e-67    
gb|EOB03329.1|  Nucleolar protein 5                                     225   2e-67    
gb|KFQ40527.1|  Nucleolar protein 58                                    227   2e-67    
gb|KFV64288.1|  Nucleolar protein 58                                    227   3e-67    
ref|XP_011432893.1|  PREDICTED: nucleolar protein 58-like               226   3e-67    
gb|KFO59877.1|  Nucleolar protein 58                                    227   3e-67    
ref|XP_005465917.1|  PREDICTED: nucleolar protein 58                    227   3e-67    
gb|KFW02653.1|  Nucleolar protein 58                                    226   3e-67    
ref|XP_005434610.1|  PREDICTED: nucleolar protein 58                    228   3e-67    
ref|XP_009938133.1|  PREDICTED: nucleolar protein 58                    226   3e-67    
gb|KFQ74083.1|  Nucleolar protein 58                                    226   3e-67    
gb|KFW89632.1|  Nucleolar protein 58                                    226   3e-67    
ref|XP_010202697.1|  PREDICTED: nucleolar protein 58                    226   3e-67    
gb|KFW61788.1|  Nucleolar protein 58                                    226   3e-67    
ref|XP_008947581.1|  PREDICTED: nucleolar protein 58                    228   3e-67    
gb|KFM11174.1|  Nucleolar protein 58                                    226   4e-67    
gb|KFP19825.1|  Nucleolar protein 58                                    226   4e-67    
ref|XP_010120485.1|  PREDICTED: nucleolar protein 58                    226   4e-67    
ref|XP_008633036.1|  PREDICTED: nucleolar protein 58                    227   4e-67    
gb|EJW86153.1|  hypothetical protein WUBG_02934                         225   4e-67    
gb|KFV86118.1|  Nucleolar protein 58                                    226   4e-67    
gb|KFU84958.1|  Nucleolar protein 58                                    226   4e-67    
ref|XP_006130811.1|  PREDICTED: nucleolar protein 58                    226   5e-67    
gb|KGL80295.1|  Nucleolar protein 58                                    226   5e-67    
ref|XP_781458.2|  PREDICTED: nucleolar protein 58                       226   6e-67    
ref|XP_007565433.1|  PREDICTED: nucleolar protein 58 isoform X2         226   6e-67    
gb|KFZ53794.1|  Nucleolar protein 58                                    226   7e-67    
ref|XP_626779.1|  nucleolar protein NOP5/NOP58-like pre-mRNA spli...    224   7e-67    
ref|XP_009331224.1|  PREDICTED: nucleolar protein 58                    226   7e-67    
gb|KFP67783.1|  Nucleolar protein 58                                    225   8e-67    
ref|XP_010784446.1|  PREDICTED: nucleolar protein 58 isoform X2         226   8e-67    
ref|XP_010784445.1|  PREDICTED: nucleolar protein 58 isoform X1         226   9e-67    
ref|XP_010217344.1|  PREDICTED: nucleolar protein 58                    226   9e-67    
ref|XP_009912989.1|  PREDICTED: nucleolar protein 58                    225   9e-67    
ref|XP_010405578.1|  PREDICTED: nucleolar protein 58                    226   1e-66    
gb|KFQ66314.1|  Nucleolar protein 58                                    225   1e-66    
ref|XP_009682520.1|  PREDICTED: nucleolar protein 58                    225   1e-66    
ref|XP_010150930.1|  PREDICTED: nucleolar protein 58                    225   1e-66    
ref|XP_009894776.1|  PREDICTED: nucleolar protein 58                    225   1e-66    
ref|XP_009489427.1|  PREDICTED: nucleolar protein 58                    225   1e-66    
ref|XP_009867823.1|  PREDICTED: nucleolar protein 58                    224   2e-66    
ref|XP_009704053.1|  PREDICTED: nucleolar protein 58                    224   2e-66    
ref|XP_009558103.1|  PREDICTED: nucleolar protein 58                    224   2e-66    
gb|EHJ76702.1|  hypothetical protein KGM_05763                          225   2e-66    
ref|XP_010005686.1|  PREDICTED: nucleolar protein 58                    226   2e-66    
ref|XP_010161415.1|  PREDICTED: nucleolar protein 58                    225   2e-66    
gb|KFQ83091.1|  Nucleolar protein 58                                    224   2e-66    
ref|XP_009460634.1|  PREDICTED: nucleolar protein 58                    226   3e-66    
gb|EJY83562.1|  Nop multi-domain protein                                222   4e-66    
ref|XP_008494188.1|  PREDICTED: nucleolar protein 58                    226   4e-66    
emb|CCA71243.1|  probable NOP58-required for pre-18S rRNA processing    225   5e-66    
ref|XP_009019750.1|  hypothetical protein HELRODRAFT_94516              228   6e-66    
ref|XP_009888542.1|  PREDICTED: nucleolar protein 58                    224   6e-66    
gb|KFP74755.1|  Nucleolar protein 58                                    223   7e-66    
ref|XP_009641816.1|  PREDICTED: nucleolar protein 58                    224   7e-66    
ref|XP_011495780.1|  PREDICTED: nucleolar protein 58                    224   7e-66    
ref|XP_009809548.1|  PREDICTED: nucleolar protein 58                    221   7e-66    
ref|XP_006897028.1|  PREDICTED: nucleolar protein 58-like               214   7e-66    
ref|XP_009282980.1|  PREDICTED: nucleolar protein 58                    226   8e-66    
ref|XP_007364391.1|  Nop-domain-containing protein                      224   8e-66    
ref|XP_002737742.1|  PREDICTED: nucleolar protein 58-like               224   8e-66    
ref|XP_008035630.1|  Nop-domain-containing protein                      224   9e-66    
emb|CCL99180.1|  predicted protein                                      224   9e-66    
gb|EPQ02705.1|  Nucleolar protein 58                                    223   2e-65    
ref|XP_009067494.1|  PREDICTED: nucleolar protein 58                    222   2e-65    
ref|XP_007338313.1|  Nop-domain-containing protein                      224   2e-65    
ref|XP_009267103.1|  Nucleolar protein 58                               222   2e-65    
gb|EMD41003.1|  hypothetical protein CERSUDRAFT_71225                   220   2e-65    
emb|CDW76614.1|  UNKNOWN                                                220   2e-65    
ref|XP_002671988.1|  predicted protein                                  220   4e-65    
ref|XP_011213731.1|  PREDICTED: nucleolar protein 58                    221   4e-65    
gb|EFB14929.1|  hypothetical protein PANDA_007776                       219   4e-65    
gb|ELW62707.1|  Nucleolar protein 58                                    221   5e-65    
gb|EPT03090.1|  hypothetical protein FOMPIDRAFT_1159146                 222   6e-65    
ref|XP_011190691.1|  PREDICTED: nucleolar protein 58                    220   6e-65    
ref|XP_003286800.1|  hypothetical protein DICPUDRAFT_31443              221   7e-65    
ref|XP_005601801.1|  PREDICTED: nucleolar protein 58                    221   7e-65    
ref|XP_007862590.1|  Nop domain-containing protein                      221   1e-64    
dbj|GAM26411.1|  hypothetical protein SAMD00019534_095860               223   1e-64    
ref|XP_007381782.1|  Nop-domain-containing protein                      220   2e-64    
ref|XP_002141621.1|  nucleolar protein 5                                218   2e-64    
gb|KDQ65010.1|  hypothetical protein JAAARDRAFT_167849                  219   5e-64    
gb|KDQ20622.1|  hypothetical protein BOTBODRAFT_124315                  219   5e-64    
ref|XP_008471019.1|  PREDICTED: nucleolar protein 58                    218   5e-64    
ref|XP_008515601.1|  PREDICTED: nucleolar protein 58 isoform X2         218   5e-64    
gb|EGU11242.1|  Nucleolar protein 58                                    219   6e-64    
ref|XP_001752003.1|  predicted protein                                  212   6e-64    
gb|EMS19643.1|  nucleolar protein NOP58                                 219   6e-64    
ref|XP_001970090.1|  GG23571                                            217   9e-64    



>dbj|BAB41076.1| MAR-binding protein [Nicotiana tabacum]
Length=555

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_009769588.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana sylvestris]
Length=559

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_009591833.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana tomentosiformis]
Length=559

 Score =   382 bits (982),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CAN73717.1| hypothetical protein VITISV_038844 [Vitis vinifera]
Length=472

 Score =   376 bits (966),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARQVVKLKAFSKFENTTEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_004247627.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=547

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_006362168.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006362169.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Solanum 
tuberosum]
Length=548

 Score =   377 bits (969),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HCDG+TLAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CBI34244.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   375 bits (962),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CDP04715.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   372 bits (954),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML LFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARK+VKLKAFSKF+NTSEALSAA
Sbjct  1    MLALFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKIVKLKAFSKFDNTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GL  QDL+PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDD+DKELNTYAMR
Sbjct  121  LSELISGLAAQDLSPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDIDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_002273273.2| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
 ref|XP_010659961.1| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
Length=573

 Score =   375 bits (964),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_010243588.1| PREDICTED: probable nucleolar protein 5-1 [Nelumbo nucifera]
Length=577

 Score =   375 bits (963),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARK+VKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKMVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+TVMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNTVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_009382561.1| PREDICTED: probable nucleolar protein 5-2 [Musa acuminata subsp. 
malaccensis]
Length=585

 Score =   375 bits (964),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFK+LDEGKL KVEDLWKEF+T+++ARK+VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKILDEGKLDKVEDLWKEFATSESARKIVKLKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRTHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_004239682.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
 ref|XP_010321330.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=513

 Score =   373 bits (957),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HCDG+TL +ADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGIADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_006345813.1| PREDICTED: probable nucleolar protein 5-2-like [Solanum tuberosum]
Length=541

 Score =   373 bits (958),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008799299.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
 ref|XP_008799300.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
Length=497

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTAEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+H++ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHSNAVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>tpg|DAA45361.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=450

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_010904781.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=588

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT++ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTTDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELGKI  195



>ref|XP_010241493.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_010097360.1| hypothetical protein L484_010238 [Morus notabilis]
 gb|EXB67670.1| hypothetical protein L484_010238 [Morus notabilis]
Length=514

 Score =   371 bits (952),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDEGKLSKVEDLW+EFSTAD+AR+VVKLKAFSKFENTSEAL A 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWREFSTADSARQVVKLKAFSKFENTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGN IKEKLQ++CVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNIIKEKLQVECVHNNAVMELMRGVRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008655653.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008655660.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 tpg|DAA45362.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=564

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_008671899.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=425

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TMIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_010938712.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=600

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEFST+++ARKVVKLKAFSKFENTSEALS A
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID KPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008660157.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008660158.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 gb|AFW88396.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88397.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88398.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=562

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_008649917.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleolar protein 5-2 
[Zea mays]
Length=329

 Score =   362 bits (928),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDT+I+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTIIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYG HFPEL ++
Sbjct  181  VREWYGXHFPELTKI  195



>ref|XP_009411704.1| PREDICTED: probable nucleolar protein 5-1 [Musa acuminata subsp. 
malaccensis]
Length=588

 Score =   370 bits (951),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG ALFKVLDEGKL KVEDLWKEF+T+++AR++VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGLALFKVLDEGKLDKVEDLWKEFATSESARQIVKLKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL+++
Sbjct  181  VREWYGWHFPELSKI  195



>ref|XP_002456868.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
 gb|EES01988.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
Length=568

 Score =   370 bits (949),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGN+IKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNSIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_011099778.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099779.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099780.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=585

 Score =   370 bits (949),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF+T D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFATPDSARQVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_003557835.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLD+GKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDQGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCVHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_008796213.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Phoenix 
dactylifera]
Length=583

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008796212.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Phoenix 
dactylifera]
Length=564

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008666415.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=420

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +2

Query  74   EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  253
            EMLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  21   EMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  80

Query  254  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL+IDC+HNS VMELMRGLRN
Sbjct  81   ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRN  140

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  141  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  200

Query  614  RVREWYGWHFPELARL  661
            RVREWYGWHFPEL ++
Sbjct  201  RVREWYGWHFPELTKI  216



>ref|NP_001050112.1| Os03g0350100 [Oryza sativa Japonica Group]
 dbj|BAF12026.1| Os03g0350100, partial [Oryza sativa Japonica Group]
Length=556

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_011099781.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=583

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF++ D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFASPDSARQVVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_010687356.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_004984388.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=567

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>gb|ABF95925.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95926.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95927.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY89998.1| hypothetical protein OsI_11565 [Oryza sativa Indica Group]
 dbj|BAG94281.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_006650080.1| PREDICTED: probable nucleolar protein 5-2-like [Oryza brachyantha]
Length=565

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|NP_001050113.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|ABF95928.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12027.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|EAZ26910.1| hypothetical protein OsJ_10837 [Oryza sativa Japonica Group]
 dbj|BAG93321.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_007208461.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
 gb|EMJ09660.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
Length=539

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>dbj|BAN15014.1| SAR DNA binding protein [Bromus inermis]
Length=539

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVL+EGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKP+KGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGL+NQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCVHNSVVMELMRGLKNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_010241470.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241474.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241483.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   367 bits (943),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 190/199 (95%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVE----DLWKEFSTADTARKVVKLKAFSKFENTSEA  244
            ML+LFETPAGFALFKVLDEGKLSKVE    DLWKEFST+++ARKVVKLKAFSKFENTSEA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVESGLQDLWKEFSTSESARKVVKLKAFSKFENTSEA  60

Query  245  LSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            LSAATLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG
Sbjct  61   LSAATLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R+QLTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT
Sbjct  121  VRSQLTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMRVREWYGWHFPELA++
Sbjct  181  YAMRVREWYGWHFPELAKI  199



>ref|XP_008218165.1| PREDICTED: probable nucleolar protein 5-2 [Prunus mume]
Length=538

 Score =   366 bits (939),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CAK22424.1| matrix attachment region binding protein [Beta vulgaris]
Length=572

 Score =   367 bits (941),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL+++
Sbjct  181  VREWYGWHFPELSKI  195



>gb|EEC75255.1| hypothetical protein OsI_11566 [Oryza sativa Indica Group]
Length=657

 Score =   369 bits (948),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   R*AEEMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSE  241
            R   EMLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+
Sbjct  85   RAVREMLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSD  144

Query  242  ALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            ALSAATL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR
Sbjct  145  ALSAATLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMR  204

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            GLRNQLTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELN
Sbjct  205  GLRNQLTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELN  264

Query  602  TYAMRVREWYGWHFPELARL  661
            TYAMRVREWYGWHFPEL ++
Sbjct  265  TYAMRVREWYGWHFPELTKI  284



>ref|XP_010025094.1| PREDICTED: probable nucleolar protein 5-2 [Eucalyptus grandis]
 gb|KCW61686.1| hypothetical protein EUGRSUZ_H04416 [Eucalyptus grandis]
Length=579

 Score =   367 bits (942),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGK+SKVEDLW+EFS+A++A+KVVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKVSKVEDLWQEFSSAESAKKVVKLKAFSKFENTAEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T LI+SKP KGLRKFLR+HCDG++LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TCLIESKPYKGLRKFLRAHCDGESLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>dbj|BAA31260.1| SAR DNA binding protein [Oryza sativa]
Length=485

 Score =   364 bits (934),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR LRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRRLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_004984387.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=568

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_002533223.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF29163.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score =   365 bits (936),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+ AD+ARKVVKLKAFSKFENTS+AL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFANADSARKVVKLKAFSKFENTSKALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L+DS PSKGLRKFL+SHCDG+TLAVADSKLGNAIK+KL+IDCVHN+ VMELMRGLR+Q
Sbjct  61   TKLLDSAPSKGLRKFLKSHCDGETLAVADSKLGNAIKDKLKIDCVHNNAVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LT+LI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTDLISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|EYU23804.1| hypothetical protein MIMGU_mgv1a003941mg [Erythranthe guttata]
Length=553

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDE KLSK EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEAKLSKAEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCDDDILAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|EYU23803.1| hypothetical protein MIMGU_mgv1a003693mg [Erythranthe guttata]
Length=569

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDE K+SK+EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  27   MLLLFETPAGFALFKVLDERKVSKIEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  86

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  87   TLLIDSKPSKGLRKFLRSHCDDDVLAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  146

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  147  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  206

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  207  VREWYGWHFPELAKI  221



>gb|KDP23603.1| hypothetical protein JCGZ_23436 [Jatropha curcas]
Length=577

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +I+   SKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+I+CVHN+ +MELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCEGEILAVADSKLGNAIKEKLKIECVHNNAIMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT+AMR
Sbjct  121  LTELITGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTFAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|EMS65034.1| hypothetical protein TRIUR3_04158 [Triticum urartu]
Length=560

 Score =   361 bits (927),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLS VEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSSVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKLQIDC+HNS VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLQIDCLHNSAVMELMRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_009342020.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=552

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008388628.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=552

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_002512277.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF49729.1| nucleolar protein nop56, putative [Ricinus communis]
Length=575

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +I+   SKGLRKFLR+HCDG+ L VADSKLGNAIKEKL+I+CVH++ VMELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCDGEILGVADSKLGNAIKEKLKIECVHSNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_009364569.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=550

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSNADKARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008370662.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=553

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNXVMELMRGVRAQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_003537858.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
 gb|KHN39811.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=551

 Score =   359 bits (921),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>gb|KDP35364.1| hypothetical protein JCGZ_10348 [Jatropha curcas]
Length=565

 Score =   359 bits (921),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF++ADTARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTSADTARKVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L+DS  SKGLRKFL+SHCDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRGLR Q
Sbjct  61   TKLLDSTTSKGLRKFLKSHCDGEILAVADSKLGNAIKDKLKIECVHNNAVMELMRGLRAQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLHAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL+++
Sbjct  181  VREWYGWHFPELSKI  195



>gb|KHN25404.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=553

 Score =   358 bits (920),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_003540996.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
Length=556

 Score =   358 bits (920),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_007131795.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
 gb|ESW03789.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
Length=556

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLW  FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWTNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCVHNNAVMELMRGVRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>gb|KJB26511.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=450

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL R+
Sbjct  181  IREWYGWHFPELTRI  195



>ref|XP_003562489.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDC H+S VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCRHDSAVMELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_008455669.1| PREDICTED: probable nucleolar protein 5-2 [Cucumis melo]
 gb|ADN33903.1| MAR-binding protein [Cucumis melo subsp. melo]
Length=554

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_004139213.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156444.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 gb|KGN60839.1| hypothetical protein Csa_2G012710 [Cucumis sativus]
Length=544

 Score =   354 bits (908),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|EPS70798.1| hypothetical protein M569_03961, partial [Genlisea aurea]
Length=392

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFST +++R+VVKLKAFSKFENT+EAL+AA
Sbjct  4    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSTPESSRQVVKLKAFSKFENTAEALTAA  63

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLI+SKPSKGLRKFLRSHC+G+ L VADSKLG++IKEKLQI+CVHN+ V ELMRG+R+Q
Sbjct  64   TLLIESKPSKGLRKFLRSHCEGEILGVADSKLGSSIKEKLQIECVHNNVVSELMRGIRSQ  123

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL +QDLAPMSLGLSHSLSRYKLKF+PDK+DTMI+Q I+LLDDLDKELN Y MR
Sbjct  124  LTELISGLALQDLAPMSLGLSHSLSRYKLKFTPDKIDTMIIQGIALLDDLDKELNIYVMR  183

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  184  VREWYGWHFPELAKI  198



>gb|KJB82563.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=416

 Score =   349 bits (895),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>gb|KJB45049.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=414

 Score =   349 bits (895),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL ++
Sbjct  181  IREWYGWHFPELTKI  195



>ref|XP_006838803.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
 gb|ERN01372.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
Length=591

 Score =   355 bits (910),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFK+LDEGKL KV+DLWKEF+T D A+K+VKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKLLDEGKLDKVDDLWKEFTTVDNAKKIVKLKAFSKFENTAEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSKPSKGLRKFLR+HCD + LAVADSKLG+ IK+KLQI+C+HN+ V ELMR LR Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDNEILAVADSKLGSVIKDKLQIECIHNNAVTELMRCLRAQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIVGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            V+EWYGWHFPELA++
Sbjct  181  VKEWYGWHFPELAKI  195



>gb|KJB26509.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=567

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL R+
Sbjct  181  IREWYGWHFPELTRI  195



>ref|XP_004139212.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156443.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
Length=566

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  68   AEEMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEAL  247
            A  MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL
Sbjct  20   AVNMLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEAL  79

Query  248  SAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
             A TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGL
Sbjct  80   EATTLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGL  139

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQL ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTY
Sbjct  140  RNQLNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTY  199

Query  608  AMRVREWYGWHFPELARL  661
            AMRVREWYGWHFPELA++
Sbjct  200  AMRVREWYGWHFPELAKI  217



>ref|XP_006491841.1| PREDICTED: probable nucleolar protein 5-1-like [Citrus sinensis]
Length=551

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_007030688.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
 gb|EOY11190.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
Length=443

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL ++
Sbjct  181  IREWYGWHFPELTKI  195



>ref|XP_006432265.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
 gb|ESR45505.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
Length=551

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_004507477.1| PREDICTED: probable nucleolar protein 5-1-like [Cicer arietinum]
Length=553

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFA+FKVLDEGKLSKVEDL  EF+TAD ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFAIFKVLDEGKLSKVEDLSNEFATADAARKVVKLKAFSKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID K SKGLRKFLR+HCD +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDGKASKGLRKFLRAHCDNETLGVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_010674932.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   352 bits (902),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLS++EDLWKEF+  D+A+KVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETCAGFALFKVLDEGKLSQIEDLWKEFADVDSAKKVVKLKAFDKFENTAEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLL +SKPSKGLRKFL++HC GDTLAVADSKLG+AIKEKLQIDC+HN+ VMELMRG+R+Q
Sbjct  61   TLLSESKPSKGLRKFLKAHCKGDTLAVADSKLGSAIKEKLQIDCLHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTY MR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYGMR  180

Query  617  VREWYGWHFPELARL  661
             +EWYGWHFPELA++
Sbjct  181  GQEWYGWHFPELAKI  195



>gb|KJB82560.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82561.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82562.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82564.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82565.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82566.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=564

 Score =   351 bits (901),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>gb|KJB45047.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
 gb|KJB45048.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=567

 Score =   351 bits (901),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL ++
Sbjct  181  IREWYGWHFPELTKI  195



>gb|KHG01423.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=567

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL ++
Sbjct  181  IREWYGWHFPELTKI  195



>gb|KHG00213.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
 gb|KHG00214.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=562

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_002319598.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
 gb|EEE95521.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
Length=561

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +I+S  SKGLRKFLR++CDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_011013586.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011013588.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_011032532.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032533.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032534.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_006382714.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 ref|XP_006382715.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60511.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60512.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
Length=562

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNGVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_008650437.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=451

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 181/195 (93%), Gaps = 5/195 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPA F LFKVLD     KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPARFTLFKVLD-----KVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  55

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  56   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  115

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAMR
Sbjct  116  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAMR  175

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  176  VREWYGWHFPELTKI  190



>gb|KHG01259.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=548

 Score =   348 bits (894),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFE PAGFALFKVLDEGKL+ VEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFEIPAGFALFKVLDEGKLNNVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNTYVMELLRGVRTQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL R+
Sbjct  181  IREWYGWHFPELTRI  195



>ref|XP_011003824.1| PREDICTED: probable nucleolar protein 5-2 [Populus euphratica]
Length=563

 Score =   348 bits (894),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +I+S  SKGLRKFLR++CDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGEMLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_007030686.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
 gb|EOY11188.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
Length=565

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            +REWYGWHFPEL ++
Sbjct  181  IREWYGWHFPELTKI  195



>ref|XP_007030689.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
 gb|EOY11191.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
Length=388

 Score =   342 bits (878),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = +2

Query  86   LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  265
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  266  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  445
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  446  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVRE  625
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+RE
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRIRE  180

Query  626  WYGWHFPELARL  661
            WYGWHFPEL ++
Sbjct  181  WYGWHFPELTKI  192



>ref|XP_003611088.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES94046.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=590

 Score =   345 bits (884),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVL+EGKLS+V+DLWKEFS+AD ARKVVKLK F KFEN SEA  AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLWKEFSSADAARKVVKLKGFQKFENISEATEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            +LLID K SKGLRKFLR+HCD +TLAVAD+KLG  IKEKL+IDCVH++ VME+MRG+R Q
Sbjct  61   SLLIDGKASKGLRKFLRAHCDNETLAVADTKLGTIIKEKLKIDCVHSNAVMEIMRGIRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELITGL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_010546633.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=563

 Score =   343 bits (881),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDL  EF TAD+ARKVVKLKAF+KF+NTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGNEFLTADSARKVVKLKAFNKFDNTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+ LAVADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNAIKEKLKIDCVHNTAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|AAC16330.1| SAR DNA-binding protein-1 [Pisum sativum]
Length=560

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVL+EGKLS+V+DL  +FSTAD ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLSLDFSTADAARKVVKLKAFSKFENTAEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            + LID K SKGLRKFLR+HCD + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   SCLIDGKTSKGLRKFLRAHCDDEILAVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_010550954.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
 ref|XP_010550955.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=539

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVEDL  +F TAD+ARKVVKLKAF+KFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGTDFLTADSARKVVKLKAFNKFENTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+I+CVHNS VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNVIKEKLKIECVHNSAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL  QDLAPMSLGLSHSL+RYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLADQDLAPMSLGLSHSLARYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_003606983.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES89180.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=553

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI GL VQD+APMSLGLSHSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLSHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_007030687.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11189.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
Length=536

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = +2

Query  86   LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  265
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  266  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  445
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  446  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVRE  625
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+RE
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRIRE  180

Query  626  WYGWHFPELARL  661
            WYGWHFPEL ++
Sbjct  181  WYGWHFPELTKI  192



>tpg|DAA47456.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=309

 Score =   332 bits (850),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 175/196 (89%), Gaps = 12/196 (6%)
 Frame = +2

Query  74   EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  253
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  254  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  614  RVREWYGWHFPELARL  661
            RVREWYGWHFPEL ++
Sbjct  262  RVREWYGWHFPELTKI  277



>ref|XP_006468094.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Citrus 
sinensis]
Length=549

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>gb|ACJ85748.1| unknown [Medicago truncatula]
 gb|AFK40384.1| unknown [Medicago truncatula]
 gb|AFK49114.1| unknown [Medicago truncatula]
Length=553

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI GL VQD+APMSLGL HSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLPHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_006468095.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Citrus 
sinensis]
Length=573

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_006468096.1| PREDICTED: probable nucleolar protein 5-2-like isoform X3 [Citrus 
sinensis]
Length=565

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_006468097.1| PREDICTED: probable nucleolar protein 5-2-like isoform X4 [Citrus 
sinensis]
Length=588

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_006436388.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
 gb|ESR49628.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
Length=552

 Score =   338 bits (868),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKLSK E L +EF+  D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNRPDSARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>tpg|DAA47457.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=469

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 175/196 (89%), Gaps = 12/196 (6%)
 Frame = +2

Query  74   EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  253
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  254  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  614  RVREWYGWHFPELARL  661
            RVREWYGWHFPEL ++
Sbjct  262  RVREWYGWHFPELTKI  277



>ref|XP_006408115.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
 gb|ESQ49568.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
Length=541

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETP GFALFKVLDEG+LS VEDL KEF++ D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGRLSNVEDLGKEFASPDSARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CDX80674.1| BnaC07g27700D [Brassica napus]
Length=536

 Score =   333 bits (853),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADSARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_009151230.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
 emb|CDX86179.1| BnaA06g28960D [Brassica napus]
Length=537

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADAARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CDY19706.1| BnaA09g03590D [Brassica napus]
Length=535

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_009111930.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
Length=536

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CDY00004.1| BnaC09g02970D [Brassica napus]
Length=536

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_010421656.1| PREDICTED: probable nucleolar protein 5-1 isoform X2 [Camelina 
sativa]
Length=529

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETP GFALFKVL EGKLS  EDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNAEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L+D  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_010455156.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=529

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|AAC16331.1| SAR DNA-binding protein-2 [Pisum sativum]
Length=550

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFET AGFALFKVLDEGKLSKVEDL + FS+ADTARKVVKLKAFSKFENTSEAL +A
Sbjct  1    MLLLFETAAGFALFKVLDEGKLSKVEDLQQSFSSADTARKVVKLKAFSKFENTSEALKSA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
             LLID K SK LRKFL  HC  +TL VAD+KL + IKEKLQIDCVHN  VMELMRG+R Q
Sbjct  61   NLLIDGKASKDLRKFLSVHCQNETLGVADTKLASIIKEKLQIDCVHNVGVMELMRGVRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_010494044.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=531

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTEL++GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELLSGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|AFW84118.1| hypothetical protein ZEAMMB73_870642 [Zea mays]
Length=586

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 184/200 (92%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            +LVL ETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  8    LLVLLETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  67

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TL+IDSKPSKGL KFL+ HC G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  68   TLIIDSKPSKGLHKFLQKHCQGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  127

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK-----VDTMIVQAISLLDDLDKELN  601
            LTELITG G QDL PMSLGLSHSLSRYKLKFSP+K     VDTMI+QAI LLDDLDK+LN
Sbjct  128  LTELITGFGAQDLGPMSLGLSHSLSRYKLKFSPEKACLISVDTMIIQAIGLLDDLDKDLN  187

Query  602  TYAMRVREWYGWHFPELARL  661
            T+AMRVREWYGWHFPEL ++
Sbjct  188  TFAMRVREWYGWHFPELTKI  207



>gb|KFK37913.1| hypothetical protein AALP_AA3G046300 [Arabis alpina]
Length=529

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCQGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_006394992.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
 gb|ESQ32278.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
Length=536

 Score =   327 bits (839),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLS VEDL   FS+A +ARK+VKL+AF KF+NTSEAL A 
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSNVEDLGNLFSSAASARKMVKLQAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGEALAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>emb|CDY52494.1| BnaAnng11410D [Brassica napus]
Length=531

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETP GFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPGGFAIFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C  +TLAVADSKLGN IKEKL IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLVEGTPSKGLRKFLKANCKDETLAVADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGEQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_002884489.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60748.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  182  VREWYGWHFPELAKI  196



>ref|NP_187157.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|Q9MAB3.1|NOP5B_ARATH RecName: Full=Probable nucleolar protein 5-2; AltName: Full=MAR-binding 
NOP56/58 homolog 2; AltName: Full=Nucleolar protein 
58-2 [Arabidopsis thaliana]
 gb|AAF27012.1|AC009177_2 putative SAR DNA-binding protein-1 [Arabidopsis thaliana]
 gb|AAG40837.1|AF302491_1 NOP58-like protein [Arabidopsis thaliana]
 gb|AAL06533.1|AF412080_1 AT3g05060/T12H1_2 [Arabidopsis thaliana]
 gb|AEE74181.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  182  VREWYGWHFPELAKI  196



>ref|XP_010485906.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
 ref|XP_010485908.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=535

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            M+VL ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIVLVETPAGFALFKVKDEGKLANLEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_010422824.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=554

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            M++L ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIILVETPAGFALFKVKDEGKLANIEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|AAN72071.1| SAR DNA-binding protein - like [Arabidopsis thaliana]
Length=423

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREW+GWHFPELA++
Sbjct  181  VREWFGWHFPELAKI  195



>ref|XP_001756465.1| predicted protein [Physcomitrella patens]
 gb|EDQ78861.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADAARKMVKLKAFDKFENTTDALNAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            + L+DSK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVDSKLPKGLRKFLKKQCQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|AAB61073.1| similar to S. cerevisiae SIK1P (PID:g984964) [Arabidopsis thaliana]
Length=439

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREW+GWHFPELA++
Sbjct  181  VREWFGWHFPELAKI  195



>emb|CAE45597.1| SAR DNA-binding protein-like protein [Lotus japonicus]
Length=537

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 169/195 (87%), Gaps = 14/195 (7%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVE              VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVE--------------VVKLKAFSKFENTSEALEAA  46

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            TLLID K SKGLRKFLR+HC+ + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  47   TLLIDGKASKGLRKFLRAHCEDEMLAVADSKLGNMIKEKLKIDCVHNNAVMELMRGVRNQ  106

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTM+VQAI LLDDLDKELNTYAMR
Sbjct  107  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMVVQAIGLLDDLDKELNTYAMR  166

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  167  VREWYGWHFPELTKI  181



>ref|NP_198064.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|O04658.2|NOP5A_ARATH RecName: Full=Probable nucleolar protein 5-1; AltName: Full=MAR-binding 
NOP56/58 homolog 1; AltName: Full=NOP58-like protein 
F108; AltName: Full=Nucleolar protein 58-1 [Arabidopsis 
thaliana]
 gb|AAG40836.1|AF302490_1 NOP58-like protein F108 [Arabidopsis thaliana]
 gb|AAL66978.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AAM20318.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AED93652.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREW+GWHFPELA++
Sbjct  181  VREWFGWHFPELAKI  195



>ref|XP_010464014.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=553

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+L ETPAGFA+FK+ DEGKL+ +EDL KEF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLILVETPAGFAVFKLKDEGKLANIEDLAKEFETAESARKIVKLKAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
             TEL++GLG  D+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDHDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_001753892.1| predicted protein [Physcomitrella patens]
 gb|EDQ81214.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADLARKMVKLKAFEKFENTTDALNAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            + L++SK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVESKLPKGLRKFLKKECQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_002874406.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50665.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            M +LFETP GFA+FKVLDEGKLS VED+  EF TA +ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MHILFETPGGFAIFKVLDEGKLSNVEDIGNEFLTAKSARKMVKLVAFDKFDNTAEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ELI+GLG +DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDKDLAPMSLGLSHSLARYKLKFSTDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_011457678.1| PREDICTED: probable nucleolar protein 5-2 [Fragaria vesca subsp. 
vesca]
Length=548

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 175/198 (88%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVL-DEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEAL  247
            ML+LFE P GF LFKVL D+GK +K E  D+ KEF T ++ARKVVKLKAFSKFEN SEAL
Sbjct  1    MLLLFENPGGFMLFKVLKDDGKFTKAEAHDIAKEFETGESARKVVKLKAFSKFENMSEAL  60

Query  248  SAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
             AAT+LIDSKP+K LRKFL+ HC+G+ L VADSKLGN IKEKL+I+CVH++ VMELMRG+
Sbjct  61   EAATMLIDSKPTKDLRKFLKKHCEGEILGVADSKLGNIIKEKLKIECVHDNAVMELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+QL +++TGL +QD+APMSLGLSHSLSRYKLKFS DKVDTM++QAI LLDDLDKELNTY
Sbjct  121  RSQLNDVVTGLQLQDMAPMSLGLSHSLSRYKLKFSADKVDTMVIQAIGLLDDLDKELNTY  180

Query  608  AMRVREWYGWHFPELARL  661
            AMRVREWYGWHFPELA++
Sbjct  181  AMRVREWYGWHFPELAKI  198



>gb|KFK23538.1| hypothetical protein AALP_AAs63573U000200 [Arabis alpina]
Length=483

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 174/211 (82%), Gaps = 16/211 (8%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IK+KL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGSPSKGLRKFLKANCQGETLAVADSKLGNVIKDKLKIDCVHNNAVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK----------------VDTMIVQAI  568
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DK                VDTMI+QAI
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSVDKGYLTSVPTSYVGLFYLVDTMIIQAI  180

Query  569  SLLDDLDKELNTYAMRVREWYGWHFPELARL  661
             LLDDLDKELNTYAMRVREWYGWH+PELA++
Sbjct  181  GLLDDLDKELNTYAMRVREWYGWHYPELAKI  211



>ref|XP_006297275.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
 gb|EOA30173.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
Length=593

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +2

Query  74   EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  253
            +M++L ETPAGF LFKV D GKLS VEDL KEF T D+ARK+VKL AF KF+NTSEAL A
Sbjct  35   KMILLVETPAGFGLFKVKDVGKLSNVEDLGKEFDTPDSARKMVKLLAFDKFDNTSEALEA  94

Query  254  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
               L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+I+CVHN+ VMEL+RG+R+
Sbjct  95   VAKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIECVHNNAVMELLRGVRS  154

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            Q TELI+GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  155  QFTELISGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  214

Query  614  RVREWYGWHFPELARL  661
            RVREWYGWHFPELA++
Sbjct  215  RVREWYGWHFPELAKI  230



>ref|XP_006287421.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
 gb|EOA20319.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
Length=551

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = +2

Query  74   EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  253
            +ML LFETP GFALFKVL EGKLS VEDL  EF TA++ARK+V+LKAF KF+NTS+AL A
Sbjct  20   KMLALFETPGGFALFKVLKEGKLSNVEDLGNEFLTAESARKMVQLKAFDKFDNTSDALEA  79

Query  254  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
               L +   SK LRKFL+S+CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+
Sbjct  80   VAKLREGTASKSLRKFLKSNCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRS  139

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            Q TELI+GLG  DLAPMSLGLSHSL+RY LKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  140  QFTELISGLGDNDLAPMSLGLSHSLARYTLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  199

Query  614  RVREWYGWHFPELARL  661
            RVREWYGWHFPELA++
Sbjct  200  RVREWYGWHFPELAKI  215



>ref|XP_002970093.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
 gb|EFJ29217.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
Length=575

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 169/195 (87%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +++SK SKGL+KFL++ C G TLA+ADSKLG  I EKL+I C+HN+ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQTLAIADSKLGRIITEKLEISCIHNNGVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>gb|EEE59058.1| hypothetical protein OsJ_10836 [Oryza sativa Japonica Group]
Length=525

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 162/189 (86%), Gaps = 17/189 (9%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF             
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAF-------------  47

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
                ++KP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  48   ----NNKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  103

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKE N YAMR
Sbjct  104  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKEFNIYAMR  163

Query  617  VREWYGWHF  643
              EWYGW+F
Sbjct  164  FSEWYGWYF  172



>ref|XP_002985284.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
 gb|EFJ13778.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
Length=576

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +++SK SKGL+KFL++ C G  LA+ADSKLG  I EKL+I C+H++ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQILAIADSKLGRIITEKLEISCIHSNGVMELLRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPELA++
Sbjct  181  VREWYGWHFPELAKI  195



>ref|XP_005850162.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
 gb|EFN58060.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
Length=1332

 Score =   313 bits (803),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 170/197 (86%), Gaps = 2/197 (1%)
 Frame = +2

Query  77    MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  250
             ML+LFE+ AGFALFKVLDEGKL + E  D+W +F T + A+KVVKLKAFSKFENT+EAL 
Sbjct  918   MLLLFESSAGFALFKVLDEGKLREAETKDVWSDFETPEAAKKVVKLKAFSKFENTTEALQ  977

Query  251   AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
             AA  L+DSK SKGL+KFL+ H +GDTLAV D+KLGN IKEKL I+C+++S VMEL RG+R
Sbjct  978   AAASLVDSKISKGLKKFLKKHAEGDTLAVLDAKLGNVIKEKLGINCLYSSGVMELTRGIR  1037

Query  431   NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
             NQLT L+ GL  QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYA
Sbjct  1038  NQLTNLVGGLSAQDLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYA  1097

Query  611   MRVREWYGWHFPELARL  661
             MRVREWYGWHFPE+ ++
Sbjct  1098  MRVREWYGWHFPEMTKI  1114



>ref|XP_005650009.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25465.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=554

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFET AGFALFKVL E K+ + EDLW++F T D A+KVVKLKAFSKFE+T +AL+AA
Sbjct  1    MLLLFETAAGFALFKVLQENKIQETEDLWQDFQTLDAAQKVVKLKAFSKFESTIDALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L DSK SK L+KFL+ + DG TL VAD+KLG+ IKEKL I C++++ V EL RG+R+Q
Sbjct  61   TALGDSKLSKDLKKFLKKNADGKTLGVADAKLGSIIKEKLGIPCIYSNGVQELTRGVRSQ  120

Query  437  LTELITGL-GVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            +  LI+GL G QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  IEGLISGLAGGQDLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  614  RVREWYGWHFPELARL  661
            RVREWYGWHFPE+ ++
Sbjct  181  RVREWYGWHFPEMTKI  196



>gb|KJB26512.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=531

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  194  KVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEK  373
            KVV LKAFSKFENT+EAL AAT L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEK
Sbjct  4    KVVSLKAFSKFENTAEALEAATKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEK  63

Query  374  LQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTM  553
            L+IDC+HN++VMEL+RG+R QLTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTM
Sbjct  64   LKIDCIHNTSVMELLRGVRTQLTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTM  123

Query  554  IVQAISLLDDLDKELNTYAMRVREWYGWHFPELARL  661
            IVQAI LLDDLDKELNTYAMR+REWYGWHFPEL R+
Sbjct  124  IVQAIGLLDDLDKELNTYAMRIREWYGWHFPELTRI  159



>gb|KIY95194.1| putative nucleolar protein NOP5-2 [Monoraphidium neglectum]
Length=313

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML LFET AG+ALFKV+ EGKL K EDL+K+F T D A+KVVKLKAFSKF+NT+EAL+AA
Sbjct  1    MLFLFETAAGYALFKVVKEGKLEKSEDLYKDFETLDAAQKVVKLKAFSKFQNTTEALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L+DSK  KGL+KFL+ +  G+TLAV D+KLG+ IK+KL I CV++  V EL RG+R Q
Sbjct  61   TALVDSKLDKGLKKFLKKNATGETLAVLDAKLGSLIKDKLDIPCVYSGAVQELARGVRAQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L+ LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSGLISGLAGADLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPE+ ++
Sbjct  181  VREWYGWHFPEMTKI  195



>gb|AAZ31075.2| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPE+ ++
Sbjct  182  VREWYGWHFPEMTKI  196



>gb|ACA96503.1| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPE+ ++
Sbjct  182  VREWYGWHFPEMTKI  196



>emb|CDY50583.1| BnaC02g39570D [Brassica napus]
Length=525

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  334
            DL   FS+ ++ARK+VKLKAF KF+NTS+AL A   L++  PSKGLRKFL+++C G+TLA
Sbjct  17   DLGNVFSSPESARKMVKLKAFDKFDNTSDALEAVAKLVEGTPSKGLRKFLKANCKGETLA  76

Query  335  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  514
            VADSKLGN IKEKL IDCVHN+ VMEL+RG+R+QL+ELITGLG QDLAPMSLGLSHSL+R
Sbjct  77   VADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQLSELITGLGEQDLAPMSLGLSHSLAR  136

Query  515  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVREWYGWHFPELARL  661
            YKLKFS DKVDTMI+QAI LLDDLDKELNTYAMRVREWYGWHFPELA++
Sbjct  137  YKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMRVREWYGWHFPELAKI  185



>emb|CEF96991.1| NOSIC [Ostreococcus tauri]
Length=476

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAG++LFKV DE KL  VE L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEKKLGDVEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKSLKKFLTKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_002507734.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
 gb|ACO68992.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
Length=471

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAG+ALFKV DEG L  VE   K FS+++ A+ +V L AFSKF+NTS+AL+A 
Sbjct  1    MLLLFETPAGYALFKVKDEGILENVE---KAFSSSEKAQNIVSLAAFSKFDNTSDALAAT  57

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              ++DSK  K L+KFL+ H  G+TLA+AD+KLG  IK+KL I C+ NS +MELMRG+R Q
Sbjct  58   AAMVDSKIGKDLKKFLKKHAIGETLALADAKLGGLIKDKLGISCISNSGIMELMRGVRRQ  117

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            + ELI GL   D+APM+LGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  118  VNELIGGLTDADVAPMALGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  177

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  178  VREWYGWHFPELTKI  192



>gb|KDO50620.1| hypothetical protein CISIN_1g0088522mg, partial [Citrus sinensis]
Length=155

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK  541
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DK
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADK  155



>gb|AAY34142.1| Nop58p [Physarum polycephalum]
Length=474

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AGFALFKVLDEGKL + +D+WKEF T   A K+V LK+FSKF+NT++AL++A
Sbjct  1    MLVLFETAAGFALFKVLDEGKLKQTDDIWKEFETPSKAGKMVSLKSFSKFDNTADALASA  60

Query  257  TLLIDSKPSKGLRKFL-RSHCDG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T L++SK SK L+KFL ++  D    +TLAVAD  LG+AIK+KL I CV+++ V EL+RG
Sbjct  61   TALVESKVSKDLKKFLTKNIVDAGAKETLAVADKLLGSAIKDKLNIKCVYDTAVQELIRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R QL+ L+ G+   D+  M+LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDD+DKELN 
Sbjct  121  IRQQLSNLVAGMTESDVTTMALGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDMDKELNI  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMRVREWYGWHFPEL ++
Sbjct  181  YAMRVREWYGWHFPELGKI  199



>ref|XP_001416562.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94855.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=474

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAG++LFKV  E KL   E L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKAEKKLQDAEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKNLKKFLSKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_007512606.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17206.1| predicted protein [Bathycoccus prasinos]
Length=482

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAG++LFKV DE KL  ++ L K FS+A++A+KVV +KAF KFENT++AL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEDKLKDIDALAKSFSSAESAKKVVSMKAFGKFENTTDALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              +++SK  K L+ FL+ H   +TLA+ADSKLG AIKEKL I+CV+++ VMELMRG+R+Q
Sbjct  61   ATMVESKVGKSLKTFLKKHVKDETLAIADSKLGVAIKEKLGIECVYSNNVMELMRGVRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L ELI GL   D+APM+LGLSHSLSRYKLKFSP+KVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNELIGGLTDADIAPMALGLSHSLSRYKLKFSPEKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPEL ++
Sbjct  181  VREWYGWHFPELTKI  195



>ref|XP_009496003.1| hypothetical protein H696_03867 [Fonticula alba]
 gb|KCV69438.1| hypothetical protein H696_03867 [Fonticula alba]
Length=447

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 158/199 (79%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+ALF V +E KL+  + +WKEF TAD A K+VKL+AF KF+NT+EALSAA
Sbjct  1    MLVLFETSAGYALFSVKNESKLADTDSIWKEFETADKANKLVKLQAFGKFQNTTEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T L+D+K  K L+ FL+S        D LAVAD+KLG  IKEKL I C HN  + ELMRG
Sbjct  61   TALLDNKVPKELKNFLKSEVLKKNLTDELAVADAKLGGVIKEKLGIACKHNDAINELMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R+Q + L++GL  ++L  M LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT
Sbjct  121  IRSQFSSLMSGLPEEELVAMQLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMR++EWYGWHFPE+ ++
Sbjct  181  YAMRIKEWYGWHFPEMGKV  199



>ref|XP_006681446.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77866.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
Length=518

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 158/199 (79%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+ALFK+LD+GK+S  +D+++ F T+  A K VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLFETPAGYALFKLLDDGKMSAPDDIYQSFETSQAANKTVKLKAFSKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T L++ K SK L+ FL     G    DTLAV DSKLG AI +KL I  V ++ V EL RG
Sbjct  61   TALVEGKISKNLKSFLSKEIAGKDLSDTLAVGDSKLGAAIAKKLNIKVVSDNAVNELFRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R+QL+ LITGL   D+  M LGLSHSLSRYKLKFSPDKVDTMI+QAI+LLDDLDKELNT
Sbjct  121  IRSQLSSLITGLAESDMNAMVLGLSHSLSRYKLKFSPDKVDTMIIQAIALLDDLDKELNT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMR +EWYGWHFPELA++
Sbjct  181  YAMRAKEWYGWHFPELAKI  199



>emb|CAJ82550.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=482

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K LR     +    LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|NP_989298.1| NOP58 ribonucleoprotein [Xenopus (Silurana) tropicalis]
 gb|AAH64169.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=533

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K LR     +    LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>gb|AAH77204.1| MGC78950 protein [Xenopus laevis]
Length=533

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKV  198



>ref|NP_001086628.1| NOP58 ribonucleoprotein [Xenopus laevis]
 gb|AAI22513.1| MGC78950 protein [Xenopus laevis]
Length=534

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKV  198



>gb|AAI30064.1| LOC398558 protein [Xenopus laevis]
 gb|AAI60690.1| LOC398558 protein [Xenopus laevis]
Length=488

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>gb|AAH44082.1| LOC398558 protein, partial [Xenopus laevis]
Length=489

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>gb|AAI06292.1| LOC398558 protein, partial [Xenopus laevis]
Length=526

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_002166198.2| PREDICTED: nucleolar protein 58-like, partial [Hydra vulgaris]
Length=358

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KLS+V+DL+K+F T + A K+VKLK F KFE+T+EALSA 
Sbjct  1    MLVLFETPAGYAIFKLLDEKKLSQVDDLFKDFETPELASKIVKLKHFKKFEDTTEALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T  I+ K SK L+K ++     +    LAVAD+K+GN IK+K  I+CV ++ V ELMRG+
Sbjct  61   TASIEGKMSKSLKKIMKKVASKEMHEELAVADAKIGNLIKDKFDINCVCSTAVNELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q+  LITG+  ++   MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMNGLITGITDKEFTAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005995463.1| PREDICTED: nucleolar protein 58 isoform X2 [Latimeria chalumnae]
Length=530

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SKGL+K L+     +    LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005995462.1| PREDICTED: nucleolar protein 58 isoform X1 [Latimeria chalumnae]
Length=531

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SKGL+K L+     +    LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005777664.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
 gb|EOD25235.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
Length=368

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMR++EWYGWHFPE+ ++
Sbjct  181  YAMRLKEWYGWHFPEMGKI  199



>ref|XP_005771074.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
 gb|EOD18645.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
Length=390

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMR++EWYGWHFPE+ ++
Sbjct  181  YAMRLKEWYGWHFPEMGKI  199



>gb|KDD76960.1| putative snoRNA binding domain-containing protein [Helicosporidium 
sp. ATCC 50920]
Length=481

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKL--SKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALS  250
            +LVLFE+PAG ALFKVL EGKL  ++ ED+W  F T + A+KVVKLKAFS+FE+T+EAL 
Sbjct  2    VLVLFESPAGLALFKVLKEGKLKEAETEDVWSNFETLEAAQKVVKLKAFSRFESTAEALQ  61

Query  251  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            +A  L++SK SKGL+K L+ H  G+TLAV D+KLG+ IKEKL I CV ++ V EL RG+R
Sbjct  62   SAASLVESKVSKGLKKLLKKHAAGETLAVLDAKLGSVIKEKLDIPCVFSAGVGELSRGIR  121

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +Q+  L+ GL   +L PMSLGL+HSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTYA
Sbjct  122  HQMEGLLGGLSSAELRPMSLGLAHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYA  181

Query  611  MRVREWYGWHFPELARL  661
            MRVREWYGWHFPE+ ++
Sbjct  182  MRVREWYGWHFPEMTKI  198



>tpg|DAA42144.1| TPA: hypothetical protein ZEAMMB73_016967 [Zea mays]
Length=343

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  260  LLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQL  439
            ++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQL
Sbjct  1    MIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQL  60

Query  440  TELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  619
            TELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMRV
Sbjct  61   TELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMRV  120

Query  620  REWYGWHFPELARL  661
            REWYGWHFPEL ++
Sbjct  121  REWYGWHFPELTKI  134



>gb|KHN07217.1| Putative nucleolar protein 5-2, partial [Glycine soja]
Length=190

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 14/169 (8%)
 Frame = +2

Query  155  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  334
            DLWK FS  DTAR+VVKLKAFSKFENT EAL AATLLID K SKGLRKFLR +C+ +TL 
Sbjct  1    DLWKNFSCVDTARQVVKLKAFSKFENTLEALEAATLLIDGKASKGLRKFLRVYCENETLG  60

Query  335  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  514
                          +IDC+HN+ +M LMRG+RNQLTELI+GL VQD+APMSLGLSHSLSR
Sbjct  61   --------------KIDCIHNNAIMNLMRGVRNQLTELISGLPVQDMAPMSLGLSHSLSR  106

Query  515  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVREWYGWHFPELARL  661
            YKLKF+ +KVDTMIVQAI LLDDL KELNTYAMRV EWYGWHFPEL ++
Sbjct  107  YKLKFTREKVDTMIVQAIDLLDDLGKELNTYAMRVLEWYGWHFPELTKI  155



>emb|CDS04923.1| hypothetical protein LRAMOSA07453 [Absidia idahoensis var. thermophila]
Length=496

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 156/200 (78%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  602  TYAMRVREWYGWHFPELARL  661
            TY+MRV+EWYGWHFPE+ ++
Sbjct  181  TYSMRVKEWYGWHFPEMGKI  200



>emb|CDH51673.1| loc398558 protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=497

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 156/200 (78%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  602  TYAMRVREWYGWHFPELARL  661
            TY+MRV+EWYGWHFPE+ ++
Sbjct  181  TYSMRVKEWYGWHFPEMGKI  200



>ref|XP_001690352.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
 gb|EDP05611.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
Length=508

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 165/196 (84%), Gaps = 1/196 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFET AGFALFKVL E KL + EDL  +F+T + A+KVVKLKAFSKFENT+EAL+AA
Sbjct  1    MLLLFETAAGFALFKVLKEKKLEEAEDLASDFATLEAAQKVVKLKAFSKFENTTEALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGD-TLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
            T L+DSK SKGL+KFL+ H D D  LA+ D KLG+ ++EKL ++ + ++ V+EL RG+R+
Sbjct  61   TALVDSKLSKGLKKFLKKHVDEDEKLALLDKKLGSIVQEKLGLNVLWSNQVLELSRGIRS  120

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            QLT LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  QLTGLISGLAGADLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  614  RVREWYGWHFPELARL  661
            RVREWYGWHFPE+ ++
Sbjct  181  RVREWYGWHFPEMTKI  196



>ref|XP_006567771.1| PREDICTED: nucleolar protein 58-like [Apis mellifera]
Length=578

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 156/197 (79%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  611  MRVREWYGWHFPELARL  661
            MR REWYGWHFPEL ++
Sbjct  181  MRCREWYGWHFPELGKI  197



>ref|XP_011399356.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
 gb|KFM26424.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
Length=496

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  250
            +L+LFE+ AGFALFKVLDEGKL + E  D+W  F T D A+KVVKLKAFSKFENT++AL 
Sbjct  2    VLLLFESAAGFALFKVLDEGKLKEAETQDVWSSFETLDAAKKVVKLKAFSKFENTADALQ  61

Query  251  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            AA  L+DSK SK L+KFL+ H   DTLAV D+KLGN IKEKL+I CV+++ V EL RG+R
Sbjct  62   AAASLVDSKVSKSLKKFLKKHAGSDTLAVLDAKLGNVIKEKLEIPCVYSTGVSELTRGVR  121

Query  431  NQLTELITGLGVQ-DLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            NQL  L+ GLG + DL PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTY
Sbjct  122  NQLGGLLAGLGHEADLRPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTY  181

Query  608  AMRVREWYGWHFPELARL  661
            AMRVREWYGWHFPE+ ++
Sbjct  182  AMRVREWYGWHFPEMTKI  199



>ref|XP_006618628.1| PREDICTED: nucleolar protein 58-like [Apis dorsata]
Length=578

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 156/197 (79%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  611  MRVREWYGWHFPELARL  661
            MR REWYGWHFPEL ++
Sbjct  181  MRCREWYGWHFPELGKI  197



>ref|XP_003230376.2| PREDICTED: nucleolar protein 58-like [Anolis carolinensis]
Length=539

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK  +K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNFKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_007501981.1| PREDICTED: nucleolar protein 58 isoform X4 [Monodelphis domestica]
Length=533

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_007501980.1| PREDICTED: nucleolar protein 58 isoform X3 [Monodelphis domestica]
Length=534

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_007501979.1| PREDICTED: nucleolar protein 58 isoform X2 [Monodelphis domestica]
Length=535

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_001371978.1| PREDICTED: nucleolar protein 58 isoform X1 [Monodelphis domestica]
Length=540

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_003056558.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
 gb|EEH59934.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
Length=469

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+LFETPAG++LFK+ DE  +   E +    +T + A+ +V LKAFSKF+NT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKIKDERNIDDAEAIENALNTTEGAKNLVSLKAFSKFDNTAEALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
              L+DSK  K L+KFL+ + +G+ LAVAD+KLG  IKEKL I C++++ VMELMRG+R+Q
Sbjct  61   ASLVDSKLGKDLKKFLKKNAEGEILAVADAKLGGHIKEKLGIACIYSANVMELMRGVRHQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            L +LI GL   D+APMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNDLIGGLDDIDVAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  617  VREWYGWHFPELARL  661
            VREWYGWHFPE+ ++
Sbjct  181  VREWYGWHFPEMTKV  195



>ref|XP_003491528.1| PREDICTED: nucleolar protein 58-like [Bombus impatiens]
Length=588

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDEDKLTEVENLYHDFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQMDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  611  MRVREWYGWHFPELARL  661
            MR REWYGWHFPEL ++
Sbjct  181  MRCREWYGWHFPELGKI  197



>ref|XP_001750802.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84401.1| predicted protein [Monosiga brevicollis MX1]
Length=492

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 155/199 (78%), Gaps = 5/199 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+ALFKV    KLS+  DL   F+T D A + VKLK F KFE+T EAL+AA
Sbjct  1    MLVLFETPAGYALFKVKKGVKLSEA-DLADVFATPDAANEAVKLKGFHKFEDTVEALTAA  59

Query  257  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T L + K SKGL+ FL+ +       DTLAV ++KLG  IKEKL I CV++S V ELMRG
Sbjct  60   TALTEGKLSKGLKSFLKDNIISKEVQDTLAVPEAKLGTVIKEKLGIQCVYDSGVQELMRG  119

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R+QL+ +I+GL   DL  M+LGL+HSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNT
Sbjct  120  IRSQLSAVISGLRESDLTAMTLGLAHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNT  179

Query  605  YAMRVREWYGWHFPELARL  661
            Y MRVREWYGWHFPEL ++
Sbjct  180  YTMRVREWYGWHFPELGKI  198



>ref|XP_002598583.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
 gb|EEN54595.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
Length=517

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 160/198 (81%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+L+E KL + E+L+K+F T + A K+VKLK F KF++T+EALSAA
Sbjct  1    MLVLFETPAGYAIFKLLNEKKLQETEELFKDFETPEKASKIVKLKHFQKFDDTTEALSAA  60

Query  257  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T  ++ K SK ++K L+   +    + LAVAD+KLGNAIK+KL + CVHN+ + ELMR +
Sbjct  61   TAAVEGKMSKTMKKMLKKIVAKEAHEELAVADAKLGNAIKDKLDLQCVHNTAIAELMRCI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            ++Q+  LITGL  +++A M+LGL+H LSRYKLKFSPDKVDTMI+QAI LLDDLDKELN Y
Sbjct  121  KSQVNNLITGLPNKEMAAMALGLAHGLSRYKLKFSPDKVDTMIIQAICLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR +EWYGWHFPEL+++
Sbjct  181  IMRCKEWYGWHFPELSKV  198



>gb|EFX84998.1| hypothetical protein DAPPUDRAFT_300779 [Daphnia pulex]
Length=515

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL + ++L+++F T + A KVVKLK F KF +T+EALSA 
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLQQTDNLFQDFQTPEGASKVVKLKHFKKFTDTTEALSAT  60

Query  257  TLLIDSKPSKGLRKFLRS---HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T  I+ K SK LRK L+S       + LAVAD+KLG+AIKEKLQI+C+ NS + ELMR +
Sbjct  61   TAAIEGKLSKTLRKTLKSLFAEEAHEALAVADAKLGSAIKEKLQINCLSNSAIQELMRCI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q   L+ GL  Q++  M+LGL+HSLSRYKLKFSPDK+DTMIVQA+SLLDDLDKELN Y
Sbjct  121  RSQADSLMGGLPKQEMMAMALGLAHSLSRYKLKFSPDKIDTMIVQAVSLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPE+ ++
Sbjct  181  VMRCREWYGWHFPEMGKI  198



>ref|XP_009054674.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
 gb|ESO94640.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
Length=471

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FK+L E KL K E+L+ +F + +TA KVVKLK F KF + +EALSAA
Sbjct  1    MLVLFETAAGYAVFKLLSEKKLQKAENLFNDFESPETASKVVKLKHFQKFGDMTEALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T  ++ K SK L+K ++     D    LAV+D+KLGN IKEK Q+ CV NS++ ELMR +
Sbjct  61   TAAVEGKMSKTLKKVMKKLVAADAQEELAVSDAKLGNIIKEKYQLPCVSNSSIQELMRCI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++  MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQVDSLITGLPQKEIMAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL +L
Sbjct  181  TMRAREWYGWHFPELGKL  198



>gb|EIE91295.1| hypothetical protein RO3G_16006 [Rhizopus delemar RA 99-880]
Length=493

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++ + KL+K E+++KEF  A+TA  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDSKLNKPEEIYKEFQDAETANNVVKLKAFEKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T +++ K  K L+KFL+S     + + L ++D KLG++I +KL I  + +STV EL RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLGSSISKKLGIKVLSDSTVQELYRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q   L+TGL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  608  AMRVREWYGWHFPELARL  661
            AMR +EWYGWHFPE+ ++
Sbjct  181  AMRCKEWYGWHFPEMNKI  198



>ref|XP_008618047.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
 gb|EQC28399.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
Length=492

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  ++ LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMSSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMRVREW+GWHFPE+ ++
Sbjct  181  YAMRVREWFGWHFPEMGKI  199



>ref|XP_011064344.1| PREDICTED: nucleolar protein 58-like [Acromyrmex echinatior]
 gb|EGI59331.1| Nucleolar protein 58 [Acromyrmex echinatior]
Length=644

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 157/197 (80%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL++ EDL K+F T + A +++KL  F KFE+T+EAL AA
Sbjct  1    MLVLFETSAGYAIFKVLNENKLAQSEDLHKDFETPEAASRLLKLTYFHKFEDTTEALCAA  60

Query  257  TLLIDSKPSKGLRKFLRSHC--DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T L++SK SK L+K LR+ C    + LAVAD+KLG AIK+KLQ+ CV N+ V ELMR +R
Sbjct  61   TALVNSKLSKSLKKTLRNCCIEAHEQLAVADAKLGCAIKDKLQLSCVSNTAVQELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +QL  LI+G+  ++   M+LGL+HSLSRYKLKFSPDKVDTM++QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLISGVTEKERTAMTLGLAHSLSRYKLKFSPDKVDTMVIQAVCLLDDLDKELNNYI  180

Query  611  MRVREWYGWHFPELARL  661
            MR REWYGWHFPEL ++
Sbjct  181  MRAREWYGWHFPELGKI  197



>gb|KDO24106.1| hypothetical protein SPRG_10894 [Saprolegnia parasitica CBS 223.65]
Length=492

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMRVREW+GWHFPE+ ++
Sbjct  181  YAMRVREWFGWHFPEMGKI  199



>emb|CEP14638.1| hypothetical protein [Parasitella parasitica]
Length=494

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++D+GK+ K ++++KEF + D A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPDEIYKEFESVDKANQAVKLKAFKKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T +++ K  K L+KFL S         + L ++D KLG+++ +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLESEISEKEMKKEKLVISDPKLGSSVNKKLGINVLSDSTVQDLYR  120

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  602  TYAMRVREWYGWHFPELARL  661
            TYAMRV+EWYGWHFPE+ ++
Sbjct  181  TYAMRVKEWYGWHFPEMTKI  200



>ref|XP_008113176.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Anolis 
carolinensis]
Length=424

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 156/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>gb|EIE85756.1| hypothetical protein RO3G_10466 [Rhizopus delemar RA 99-880]
Length=467

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++ + KL+K E+++KEF  A+TA  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDSKLNKPEEIYKEFQDAETANNVVKLKAFEKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T +++ K  K L+KFL++     + + L ++D KLG++I +KL I  + +STV EL RG+
Sbjct  61   TGIVEGKMPKNLKKFLQAEIKDMNKEQLIISDPKLGSSISKKLGIKVLSDSTVQELCRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q   L+TGL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  608  AMRVREWYGWHFPELARL  661
            AMR +EWYGWHFPE+ ++
Sbjct  181  AMRCKEWYGWHFPEMNKI  198



>ref|XP_011267939.1| PREDICTED: nucleolar protein 58 [Camponotus floridanus]
 gb|EFN60271.1| Nucleolar protein 5 [Camponotus floridanus]
Length=675

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL+K E+L+K+F T + A K+VKL+ F KFE+ +EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTKSENLYKDFETPEDASKIVKLEHFHKFEDITEALAAT  60

Query  257  TLLIDSKPSKGLRKFLR-SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
            T L+++K  K L+K LR S  D   LAVAD +LG+AIK+KL + CV N+ + ELMR +RN
Sbjct  61   TALVENKVPKSLKKALRQSPIDHQKLAVADLRLGHAIKDKLDVSCVSNNAIQELMRCIRN  120

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            Q+  LIT +  ++++ M+LGL+HSLSRYKLKFSPDK+DTM++QA+ LLDD+DKELN Y M
Sbjct  121  QMDSLITDVTKKEMSAMALGLAHSLSRYKLKFSPDKIDTMVIQAVCLLDDIDKELNNYIM  180

Query  614  RVREWYGWHFPELARL  661
            R REWYGWHFPEL R+
Sbjct  181  RAREWYGWHFPELGRI  196



>ref|XP_011341650.1| PREDICTED: nucleolar protein 58 [Cerapachys biroi]
 gb|EZA52528.1| Nucleolar protein [Cerapachys biroi]
Length=667

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A KVVKLK F KFE+T+EAL+A+
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKSENLYLDFKTVEGANKVVKLKYFHKFEDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T +I+ K SK L+K L+S C    + LAVAD+KLGN+IK KLQ+ CV N+ + ELMR +R
Sbjct  61   TAIIEGKLSKSLKKTLKSCCSDLHEQLAVADAKLGNSIKNKLQVPCVSNTAIHELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +Q   L+T +  +D+  M+LGL+HSLSRYKLKFSPDKVD M++QA+ LLD+LDK+LN Y 
Sbjct  121  SQAESLVTEVNSKDMTAMALGLAHSLSRYKLKFSPDKVDIMVIQAVCLLDELDKQLNNYM  180

Query  611  MRVREWYGWHFPELARL  661
            M+ REWYGWHFPEL+++
Sbjct  181  MKTREWYGWHFPELSKI  197



>dbj|GAN04212.1| nop-domain-containing protein [Mucor ambiguus]
Length=499

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  602  TYAMRVREWYGWHFPELARL  661
            TYAMRV+EWYGWHFPE+ ++
Sbjct  181  TYAMRVKEWYGWHFPEMTKI  200



>gb|EPB89396.1| hypothetical protein HMPREF1544_03765 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=501

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  602  TYAMRVREWYGWHFPELARL  661
            TYAMRV+EWYGWHFPE+ ++
Sbjct  181  TYAMRVKEWYGWHFPEMTKI  200



>emb|CEI87149.1| Putative U3 snoRNP protein Nop58 [Rhizopus microsporus]
Length=377

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  608  AMRVREWYGWHFPELARL  661
            AMR +EWYGWHFPE+ ++
Sbjct  181  AMRCKEWYGWHFPEMNKI  198



>ref|XP_009086324.1| PREDICTED: nucleolar protein 58 [Serinus canaria]
Length=527

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>gb|EMC81163.1| Nucleolar protein 58, partial [Columba livia]
Length=468

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_007422082.1| PREDICTED: nucleolar protein 58 [Python bivittatus]
Length=538

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL ++++LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEIDNLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K  K L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKIGKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLISGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005519952.1| PREDICTED: nucleolar protein 58 [Pseudopodoces humilis]
Length=527

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_006273562.1| PREDICTED: nucleolar protein 58 [Alligator mississippiensis]
Length=525

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005049217.1| PREDICTED: nucleolar protein 58 [Ficedula albicollis]
Length=527

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_006017720.1| PREDICTED: nucleolar protein 58 [Alligator sinensis]
Length=525

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETGAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_010563240.1| PREDICTED: nucleolar protein 58 isoform X2 [Haliaeetus leucocephalus]
Length=485

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_421942.1| PREDICTED: nucleolar protein 58 [Gallus gallus]
Length=527

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>emb|CEI96131.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  608  AMRVREWYGWHFPELARL  661
            AMR +EWYGWHFPE+ ++
Sbjct  181  AMRCKEWYGWHFPEMNKI  198



>emb|CCA22673.1| nucleolar protein NOP5 putative [Albugo laibachii Nc14]
Length=497

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DE KL+KVE + K+F T D A +++KLK F  F++T++A++A 
Sbjct  1    MLVLFETAAGHALFKVQDESKLAKVETITKQFETIDQANQLIKLKGFHAFKDTTQAVAAV  60

Query  257  TLLIDSKPSKGLRKFLRSH-CDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
               +D+K  KGLRKFL+ +  DG  + LAV+D  LG+ IKEKL I CV+++ V ELMRG+
Sbjct  61   ADTLDAKIGKGLRKFLKKNISDGIKEKLAVSDKALGSMIKEKLGIPCVYDACVFELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R  +  LITGL ++DL  M+LGLSHSLSRYKLKFS DKVDTMI+QAI LLD+LDKE+N Y
Sbjct  121  RTHMNSLITGLEIEDLKSMTLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDELDKEINAY  180

Query  608  AMRVREWYGWHFPELARL  661
            +MRVREW+GWHFPE+ ++
Sbjct  181  SMRVREWFGWHFPEMGKI  198



>emb|CEG70655.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  608  AMRVREWYGWHFPELARL  661
            AMR +EWYGWHFPE+ ++
Sbjct  181  AMRCKEWYGWHFPEMNKI  198



>ref|XP_010711773.1| PREDICTED: nucleolar protein 58 [Meleagris gallopavo]
Length=528

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005837542.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
 gb|EKX50562.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
Length=501

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVL+ETPAG+ALFKV DE KL  V+D+ + F+  D A K +KLKAF KFE+TSEAL AA
Sbjct  1    MLVLYETPAGYALFKVTDEKKLKDVDDIQEVFADPDKASKAMKLKAFQKFEDTSEALVAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T +++S  SKGL+KFL  +       + LAV ++KLG  IKEKL++ C+++  V+E+MRG
Sbjct  61   TAMLESSLSKGLKKFLEKNIVKKGLNEELAVYETKLGKVIKEKLEVPCIYDDKVLEIMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  L  L+ G   QDL  M LGL+HSL R+KLKFSPDKVDTM+VQAI LLD+LDKELNT
Sbjct  121  VRANLEVLLGGTTEQDLKTMRLGLAHSLGRHKLKFSPDKVDTMVVQAIGLLDELDKELNT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMRVREWYGWHFPE+ ++
Sbjct  181  YAMRVREWYGWHFPEMGKI  199



>ref|XP_004378293.1| PREDICTED: nucleolar protein 58 [Trichechus manatus latirostris]
Length=533

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 155/200 (78%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFLR-----SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L++ L+     +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKRVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_005306283.1| PREDICTED: nucleolar protein 58 isoform X1 [Chrysemys picta bellii]
Length=526

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVLDE KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETAAGYAVFKVLDEKKLQEVDSLWREFETPEKANKIVKLKHFEKFQDTTEALAAC  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>gb|EGW06124.1| Nucleolar protein 58 [Cricetulus griseus]
Length=219

 Score =   240 bits (612),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_010563232.1| PREDICTED: nucleolar protein 58 isoform X1 [Haliaeetus leucocephalus]
Length=527

 Score =   249 bits (637),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005511378.1| PREDICTED: nucleolar protein 58 [Columba livia]
Length=527

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_005144700.1| PREDICTED: nucleolar protein 58 [Melopsittacus undulatus]
Length=528

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_009836884.1| hypothetical protein H257_11594 [Aphanomyces astaci]
 gb|ETV73458.1| hypothetical protein H257_11594 [Aphanomyces astaci]
Length=510

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+TAD A   VKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLTNVDDIHKHFATADKANSFVKLKAFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKSMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            Y+MRVREW+GWHFPE+ ++
Sbjct  181  YSMRVREWFGWHFPEMGKI  199



>ref|XP_002189225.1| PREDICTED: nucleolar protein 58 [Taeniopygia guttata]
Length=527

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            R+Q+  LI GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQVEGLIAGLPSREMAAMRLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_008872332.1| hypothetical protein H310_08394 [Aphanomyces invadans]
 gb|ETV98904.1| hypothetical protein H310_08394 [Aphanomyces invadans]
Length=494

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DEGKL+ V+D+ K+F+TAD A   +KLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKQFATADKANSFLKLKAFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            Y+MRVREW+GWHFPE+ ++
Sbjct  181  YSMRVREWFGWHFPEMGKI  199



>ref|XP_004367446.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20421.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
Length=525

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 158/195 (81%), Gaps = 1/195 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+ALFKV +EGKL +  ++ K+F+T + A+KVV LKAF KF NT+EAL+A 
Sbjct  1    MLVLFETPAGYALFKVHNEGKLQEA-NIAKDFATLEGAQKVVSLKAFQKFGNTTEALAAT  59

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T +++SK  K L+KFL+    G+ L V+D KL   IK+K+ + C+HNS V EL+RG+R Q
Sbjct  60   TAIVESKLGKDLKKFLKKQAKGEQLGVSDPKLAGIIKDKIGVQCLHNSMVNELLRGIRLQ  119

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
            +T+LITGLG  +L+ M LGLSHSL RYKLKFSPDKVD MI+QAI+LLDDLDKE NTYAMR
Sbjct  120  MTDLITGLGEGELSNMVLGLSHSLCRYKLKFSPDKVDHMIIQAIALLDDLDKESNTYAMR  179

Query  617  VREWYGWHFPELARL  661
            V+EWYGWHFPELA++
Sbjct  180  VKEWYGWHFPELAKV  194



>ref|XP_002903084.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
 gb|EEY55508.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
Length=519

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 154/199 (77%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DE KL+  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  24   MLVLFETAAGHALFKVQDEAKLANADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  83

Query  257  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T ++D K  K L+KFL+ +       D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  84   TDMVDGKMGKTLKKFLKKNVVDVGLKDKLAVSDKALGSLIKEKLSIACVNDSAVNEVMRG  143

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  144  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  203

Query  605  YAMRVREWYGWHFPELARL  661
            Y+MRVREW+GWHFPE+ ++
Sbjct  204  YSMRVREWFGWHFPEMGKI  222



>gb|ETL31667.1| hypothetical protein L916_15560 [Phytophthora parasitica]
 gb|ETL84897.1| hypothetical protein L917_15383 [Phytophthora parasitica]
Length=496

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            Y+MRVREW+GWHFPE+ ++
Sbjct  181  YSMRVREWFGWHFPEMGKI  199



>emb|CBJ32359.1| conserved unknown protein [Ectocarpus siliculosus]
Length=559

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+ALFK+ +E  L   + ++ EFST + A + VKLKAF  F +T++A++A+
Sbjct  1    MLVLFETPAGYALFKMTNESILKDADGIYDEFSTPEKAAESVKLKAFMTFADTADAVAAS  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T +IDSK  K L+KFL  +       D LAV+DSKL NAIK+KL I CV++S VMELMRG
Sbjct  61   TEMIDSKMGKSLKKFLTKNIVKKELKDKLAVSDSKLANAIKDKLSIKCVNDSGVMELMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R QL  L+T +G  +L  M LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRGQLDGLLTSVGDDNLKAMRLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            YAMRV+EW+GWHFPE+A++
Sbjct  181  YAMRVKEWFGWHFPEMAKI  199



>ref|XP_008911207.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
 gb|ETN03434.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
Length=496

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            Y+MRVREW+GWHFPE+ ++
Sbjct  181  YSMRVREWFGWHFPEMGKI  199



>gb|ETI38018.1| hypothetical protein F443_16119 [Phytophthora parasitica P1569]
 gb|ETK78232.1| hypothetical protein L915_15665 [Phytophthora parasitica]
 gb|ETM38080.1| hypothetical protein L914_15515 [Phytophthora parasitica]
 gb|ETO66787.1| hypothetical protein F444_16104 [Phytophthora parasitica P1976]
 gb|ETP07908.1| hypothetical protein F441_15948 [Phytophthora parasitica CJ01A1]
 gb|ETP35975.1| hypothetical protein F442_15972 [Phytophthora parasitica P10297]
Length=496

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            Y+MRVREW+GWHFPE+ ++
Sbjct  181  YSMRVREWFGWHFPEMGKI  199



>ref|XP_003743589.1| PREDICTED: nucleolar protein 58 [Metaseiulus occidentalis]
Length=545

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFE+PAGFA+FKVLDE K+ K E+L+KEF  A  A K++KLK F KFE+ ++ALSAA
Sbjct  1    MLVLFESPAGFAVFKVLDEKKIQKSENLFKEFEDASDASKILKLKHFQKFEDMTQALSAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  436
            T  I+ K +K L+K L+     +TLAVAD+KLGN IKEK+ I CV NS++ ELMR +R+Q
Sbjct  61   TGAIEGKLTKPLKKILKKLEATETLAVADAKLGNIIKEKMDISCVANSSIQELMRCIRSQ  120

Query  437  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  616
               LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKELN Y MR
Sbjct  121  QEALITGLSQKEVTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKELNNYVMR  180

Query  617  VREWYGWHFPELARL  661
             +EWYGWHFPE+ ++
Sbjct  181  CKEWYGWHFPEMGKV  195



>ref|XP_008187145.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Acyrthosiphon 
pisum]
Length=487

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATSKIIKLKHFQKFDDTTEALASA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  614  RVREWYGWHFPELARL  661
            R REWYGWHFPEL ++
Sbjct  181  RCREWYGWHFPELGKI  196



>ref|XP_009530825.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
 gb|EGZ13396.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
Length=489

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG ALFKV DE KL+  +D++K F+T + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKLANADDVFKHFATPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  424
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IK+KL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKDKLSISCVNDSAVNEVMRG  120

Query  425  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  604
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  605  YAMRVREWYGWHFPELARL  661
            Y+MRVREW+GWHFPE+ ++
Sbjct  181  YSMRVREWFGWHFPEMGKI  199



>gb|ESA16249.1| hypothetical protein GLOINDRAFT_158776 [Rhizophagus irregularis 
DAOM 181602]
Length=430

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 151/200 (76%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+ALF+VL EGKL + ++LWK+F T + A+K VKL  F KFEN SEA+++ 
Sbjct  1    MLVLFETAAGYALFEVLKEGKLREPDELWKDFETPEAAKKTVKLVDFQKFENMSEAVASV  60

Query  257  TLLIDSKPSKGLRKFLRS-----HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            + L++ K SK L+KFL+          + LAV + K+G  I +K  I  + N TV+EL R
Sbjct  61   SDLLEGKLSKDLKKFLKESFEKIEVSSEKLAVMEPKIGATISKKFGIQVISNETVVELYR  120

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G++ QL  LITG+   D++ MSLGLSHSLSR+KLKFSPDKVD MI+QAI LLDDLDKELN
Sbjct  121  GIKQQLDSLITGIKSDDISQMSLGLSHSLSRHKLKFSPDKVDNMIIQAIGLLDDLDKELN  180

Query  602  TYAMRVREWYGWHFPELARL  661
            TYAMRV+EWYGWHFPE++++
Sbjct  181  TYAMRVKEWYGWHFPEMSKI  200



>ref|XP_011308274.1| PREDICTED: nucleolar protein 58 [Fopius arisanus]
Length=568

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 156/197 (79%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A K++KLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKTENLYHDFETPEAASKLLKLKHFEKFADTTEALAAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+++ ELMR +R
Sbjct  61   TAAVEGKLCKSLKKMLKKHCSEVQEQLAVADAKLGNAIKDKLSLSCVSNTSIQELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +QL  L+ GL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVCLLDDLDKELNNYV  180

Query  611  MRVREWYGWHFPELARL  661
            MR REWYGWHFPEL +L
Sbjct  181  MRCREWYGWHFPELGKL  197



>dbj|BAJ91724.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATTKIIKLKHFQKFDDTTEALASA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  614  RVREWYGWHFPELARL  661
            R REWYGWHFPEL ++
Sbjct  181  RCREWYGWHFPELGKI  196



>ref|XP_003907873.1| PREDICTED: nucleolar protein 58 isoform X1 [Papio anubis]
Length=423

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 151/200 (76%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_001641027.1| predicted protein [Nematostella vectensis]
 gb|EDO48964.1| predicted protein [Nematostella vectensis]
Length=514

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 161/198 (81%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL  V+DL+K+F + D A KVVKLK F KFE+T+EAL+AA
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLKNVDDLYKDFESPDAASKVVKLKHFHKFEDTTEALAAA  60

Query  257  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T  I+ K SKGL+K L+     D    LAV+D+KLGN IKEKL ++CV ++ V ELMRG+
Sbjct  61   TAAIEGKMSKGLKKLLKKVVAKDAHEQLAVSDAKLGNIIKEKLSVNCVASTAVHELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMNNLITGLQDREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  VMRCREWYGWHFPELGKI  198



>gb|AAH87637.1| Nol5 protein [Rattus norvegicus]
Length=444

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 151/200 (76%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_002407966.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
 gb|EEC12380.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
Length=515

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 159/201 (79%), Gaps = 9/201 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFE+PAG+A+FKVLDE KL + ++L+K+F T D A +VVKLK F KFE+ ++AL+AA
Sbjct  1    MLVLFESPAGYAIFKVLDEKKLQQTDNLFKDFETPDKASRVVKLKHFEKFEDMTQALAAA  60

Query  257  TLLIDSKPSKGLRKFL------RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  418
            T  I+ K SK L+K L       +H   ++LAVAD+KLGN IK+K  I CV NS++ ELM
Sbjct  61   TSAIEGKMSKTLKKVLKKVVAKEAH---ESLAVADAKLGNVIKDKFDISCVANSSIQELM  117

Query  419  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  598
            R +R+Q+  LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKEL
Sbjct  118  RCIRSQVDGLITGLPRKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKEL  177

Query  599  NTYAMRVREWYGWHFPELARL  661
            N Y MR +EWYGWHFPEL+++
Sbjct  178  NNYIMRCKEWYGWHFPELSKI  198



>ref|XP_005574023.1| PREDICTED: nucleolar protein 58 isoform X4 [Macaca fascicularis]
Length=431

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_006636806.1| PREDICTED: nucleolar protein 58-like [Lepisosteus oculatus]
Length=527

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET AG+A+FKVL+E KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDKLWEEFQTPERANKIVKLKHFEKFQDTTEALAAA  60

Query  257  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  427
            T L++ K  K L+K L+   +    + LA++D+KLG  IK+KL + CVH+  V ELMRG+
Sbjct  61   TALVEGKIGKSLKKVLKRVVAKEAHEQLAISDAKLGGVIKDKLNLSCVHSPAVAELMRGI  120

Query  428  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  607
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPPREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  608  AMRVREWYGWHFPELARL  661
             MR REWYGWHFPEL ++
Sbjct  181  IMRCREWYGWHFPELGKI  198



>ref|XP_007190607.1| PREDICTED: nucleolar protein 58 isoform X6 [Balaenoptera acutorostrata 
scammoni]
Length=432

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPLVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_003701979.1| PREDICTED: nucleolar protein 58-like [Megachile rotundata]
Length=589

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A ++VKLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDEQKLAEVENLYHDFETPEAASQIVKLKHFEKFADTTEALAAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCSELQEQLAVADTKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  611  MRVREWYGWHFPELARL  661
            MR REWYGWHFPEL ++
Sbjct  181  MRCREWYGWHFPELGKI  197



>gb|AAC23535.1| unknown, partial [Rattus sp.]
Length=461

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>dbj|BAE21954.1| unnamed protein product [Mus musculus]
Length=455

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_008556600.1| PREDICTED: nucleolar protein 58 [Microplitis demolitor]
Length=600

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFETPAG+A+FK+LDE KL K ++L+++F T + A K++KLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLEKTDNLFRDFETPEAANKILKLKHFHKFADTTEALEAT  60

Query  257  TLLIDSKPSKGLRKFLRSHCDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  430
            T  ++ K SK L+K L+ H     D+LAVAD+KLGNAIKEKL + CV N+++ ELMR +R
Sbjct  61   TAAVEGKLSKTLKKTLKKHFGDLQDSLAVADAKLGNAIKEKLNLSCVSNTSIQELMRCIR  120

Query  431  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  610
            +Q+  L++GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMIVQA+ LLD+LDKELN Y 
Sbjct  121  SQMDSLLSGLPKREMTAMALGLAHSLSRYKLKFSPDKIDTMIVQAVGLLDELDKELNNYI  180

Query  611  MRVREWYGWHFPELARL  661
            MRVREWYGWHFPEL ++
Sbjct  181  MRVREWYGWHFPELGKI  197



>emb|CAH91951.1| hypothetical protein [Pongo abelii]
Length=472

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_005574021.1| PREDICTED: nucleolar protein 58 isoform X2 [Macaca fascicularis]
Length=471

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_002874404.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50663.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 144/196 (73%), Gaps = 26/196 (13%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  GFALFKVLDEGKLS VEDL  EFS+A++AR+                    
Sbjct  1    MLVLFETSGGFALFKVLDEGKLSNVEDLGDEFSSAESARR--------------------  40

Query  257  TLLIDSKPSKGLRKFLRSHC-DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  433
                    SKGLRKFL+++C DG+TLAVADS +GN I EKL + CVHN+ VMEL+RG+R+
Sbjct  41   -----GTSSKGLRKFLKNNCGDGETLAVADSNIGNIITEKLDVQCVHNNAVMELLRGVRS  95

Query  434  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  613
            QLTEL++GL   DLAPMSL LSH L+RYKLK + DKV+TMI+Q I LLDDLDKE NTYAM
Sbjct  96   QLTELLSGLDDNDLAPMSLELSHILARYKLKITSDKVETMIIQVIGLLDDLDKERNTYAM  155

Query  614  RVREWYGWHFPELARL  661
            RVRE YG HFPELA++
Sbjct  156  RVRELYGLHFPELAKI  171



>gb|KFH64217.1| hypothetical protein MVEG_10042 [Mortierella verticillata NRRL 
6337]
Length=507

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            ML+L+E+PAG+ALF +LD+GKL K + +WK+F T + A K VKL+AFSKFENT++ALSA 
Sbjct  1    MLILYESPAGYALFNLLDDGKLEKPDSIWKDFETPEQANKTVKLRAFSKFENTTDALSAV  60

Query  257  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K SK L++FL S         ++L V D+KLG AI +KL +  + +ST ++L R
Sbjct  61   TALVEGKLSKNLKEFLSSEISEKEMKKESLIVGDAKLGGAIAKKLNMKVISDSTTLDLYR  120

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R QL  L++GL   DL+ M LGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRTQLDSLLSGLSSSDLSAMVLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  602  TYAMRVREWYGWHFPELARL  661
            TYAMRV+EWYGWHFPE+ +L
Sbjct  181  TYAMRVKEWYGWHFPEMTKL  200



>dbj|BAE22082.1| unnamed protein product [Mus musculus]
Length=499

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_004701594.1| PREDICTED: nucleolar protein 58 [Echinops telfairi]
Length=530

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+QL  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQLDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_007520557.1| PREDICTED: nucleolar protein 58 [Erinaceus europaeus]
Length=531

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVSELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_009236281.1| PREDICTED: nucleolar protein 58 [Pongo abelii]
Length=495

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



>ref|XP_003483763.1| PREDICTED: nucleolar protein 58 [Sus scrofa]
Length=540

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 154/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  77   MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  256
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A KVVKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKVVKLKHFEKFQDTAEALAAF  60

Query  257  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  421
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  422  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  601
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  602  TYAMRVREWYGWHFPELARL  661
             Y MR REWYGWHFPEL ++
Sbjct  178  NYIMRCREWYGWHFPELGKI  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140