BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050B05

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757253.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   4e-44   Nicotiana sylvestris
ref|XP_009611007.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   1e-43   Nicotiana tomentosiformis
ref|XP_007139882.1|  hypothetical protein PHAVU_008G066400g             135   2e-42   Phaseolus vulgaris [French bean]
emb|CBI40324.3|  unnamed protein product                                135   3e-42   Vitis vinifera
ref|XP_010273108.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   4e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002270379.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   5e-42   Vitis vinifera
ref|XP_010255444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   5e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010671975.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   7e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010053686.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   7e-42   Eucalyptus grandis [rose gum]
ref|XP_007051860.1|  DEAD-box ATP-dependent RNA helicase 8 isoform 3    135   9e-42   
ref|XP_004492712.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-41   Cicer arietinum [garbanzo]
ref|XP_007051859.1|  RNAhelicase-like 8 isoform 2                       135   1e-41   
ref|XP_007051858.1|  RNAhelicase-like 8 isoform 1                       135   1e-41   
gb|KJB41289.1|  hypothetical protein B456_007G097600                    135   1e-41   Gossypium raimondii
gb|KJB41290.1|  hypothetical protein B456_007G097600                    135   1e-41   Gossypium raimondii
gb|KJB41288.1|  hypothetical protein B456_007G097600                    135   1e-41   Gossypium raimondii
ref|XP_009794054.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   2e-41   Nicotiana sylvestris
ref|XP_009340166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_007220665.1|  hypothetical protein PRUPE_ppa004633mg             135   3e-41   Prunus persica
ref|XP_008347150.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    135   3e-41   
ref|XP_009794053.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-41   Nicotiana sylvestris
gb|KGN56528.1|  Dead box ATP-dependent RNA helicase                     135   4e-41   Cucumis sativus [cucumbers]
ref|XP_004133869.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   4e-41   Cucumis sativus [cucumbers]
ref|XP_008438061.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   4e-41   Cucumis melo [Oriental melon]
gb|KHG18488.1|  DEAD-box ATP-dependent RNA helicase 8 -like protein     135   4e-41   Gossypium arboreum [tree cotton]
gb|KJB22343.1|  hypothetical protein B456_004G042200                    135   5e-41   Gossypium raimondii
emb|CBI34696.3|  unnamed protein product                                135   6e-41   Vitis vinifera
gb|KJB09834.1|  hypothetical protein B456_001G169800                    135   7e-41   Gossypium raimondii
ref|XP_002271357.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   9e-41   Vitis vinifera
ref|XP_002511831.1|  dead box ATP-dependent RNA helicase, putative      135   1e-40   Ricinus communis
ref|XP_006341720.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   1e-40   Solanum tuberosum [potatoes]
ref|XP_003528862.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-40   Glycine max [soybeans]
gb|KHG12667.1|  DEAD-box ATP-dependent RNA helicase 8 -like protein     135   1e-40   Gossypium arboreum [tree cotton]
ref|XP_004248580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   1e-40   Solanum lycopersicum
ref|XP_003528863.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-40   Glycine max [soybeans]
gb|KHG21932.1|  DEAD-box ATP-dependent RNA helicase 8                   135   1e-40   Gossypium arboreum [tree cotton]
gb|KHG21931.1|  DEAD-box ATP-dependent RNA helicase 8                   135   1e-40   Gossypium arboreum [tree cotton]
ref|XP_002301349.1|  DEAD/DEAH box helicase family protein              133   1e-40   
ref|XP_011023369.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   2e-40   Populus euphratica
emb|CDP09769.1|  unnamed protein product                                134   2e-40   Coffea canephora [robusta coffee]
gb|KDP28654.1|  hypothetical protein JCGZ_14425                         135   2e-40   Jatropha curcas
emb|CDP08841.1|  unnamed protein product                                134   2e-40   Coffea canephora [robusta coffee]
gb|KHF99913.1|  DEAD-box ATP-dependent RNA helicase 8                   135   2e-40   Gossypium arboreum [tree cotton]
gb|EYU29737.1|  hypothetical protein MIMGU_mgv1a005117mg                134   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_006576348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   3e-40   
ref|XP_006576347.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   4e-40   Glycine max [soybeans]
ref|XP_010540276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   4e-40   
ref|XP_008794179.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   4e-40   
gb|KHN04659.1|  DEAD-box ATP-dependent RNA helicase 8                   135   5e-40   Glycine soja [wild soybean]
gb|KHN04661.1|  DEAD-box ATP-dependent RNA helicase 8                   135   5e-40   Glycine soja [wild soybean]
gb|KJB14857.1|  hypothetical protein B456_002G146500                    136   5e-40   Gossypium raimondii
ref|XP_003521117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   6e-40   Glycine max [soybeans]
gb|KJB14858.1|  hypothetical protein B456_002G146500                    135   6e-40   Gossypium raimondii
ref|XP_006339542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   8e-40   Solanum tuberosum [potatoes]
ref|XP_006396262.1|  hypothetical protein EUTSA_v10028588mg             133   8e-40   Eutrema salsugineum [saltwater cress]
gb|EYU32082.1|  hypothetical protein MIMGU_mgv1a005052mg                134   8e-40   Erythranthe guttata [common monkey flower]
gb|KDO86092.1|  hypothetical protein CISIN_1g011065mg                   134   1e-39   Citrus sinensis [apfelsine]
emb|CAA09199.1|  RNA helicase                                           133   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191975.2|  DEAD-box ATP-dependent RNA helicase 8                 133   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAC13628.1|  similar to ATP-dependent RNA helicases                  132   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14859.1|  hypothetical protein B456_002G146500                    135   1e-39   Gossypium raimondii
ref|XP_010544383.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_006445089.1|  hypothetical protein CICLE_v10019858mg             133   1e-39   Citrus clementina [clementine]
ref|XP_008353991.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-39   
ref|XP_004306806.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   2e-39   Fragaria vesca subsp. vesca
ref|XP_004229903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   2e-39   Solanum lycopersicum
gb|KJB70004.1|  hypothetical protein B456_011G052700                    135   2e-39   Gossypium raimondii
ref|XP_004510805.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    136   3e-39   Cicer arietinum [garbanzo]
gb|KHN27313.1|  DEAD-box ATP-dependent RNA helicase 8                   135   3e-39   Glycine soja [wild soybean]
ref|XP_008778709.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-39   Phoenix dactylifera
gb|KJB70003.1|  hypothetical protein B456_011G052700                    134   4e-39   Gossypium raimondii
ref|XP_006287568.1|  hypothetical protein CARUB_v10000779mg             132   5e-39   Capsella rubella
ref|XP_006587858.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   6e-39   
ref|XP_002875020.1|  hypothetical protein ARALYDRAFT_490504             132   7e-39   
gb|ABG66173.1|  ATP-dependent RNA helicase ste13, putative, expre...    134   8e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006587857.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   8e-39   Glycine max [soybeans]
gb|EEC67267.1|  hypothetical protein OsI_34232                          134   9e-39   Oryza sativa Indica Group [Indian rice]
sp|Q109G2.2|RH12_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    134   9e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065000.2|  Os10g0503700                                       134   9e-39   
ref|XP_010424044.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   1e-38   Camelina sativa [gold-of-pleasure]
tpg|DAA49387.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    134   1e-38   
ref|XP_011091933.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    131   1e-38   Sesamum indicum [beniseed]
ref|XP_006848084.1|  hypothetical protein AMTR_s00029p00205680          135   1e-38   Amborella trichopoda
ref|NP_001140760.1|  putative DEAD-box ATP-dependent RNA helicase...    134   1e-38   Zea mays [maize]
gb|AES80120.2|  DEAD-box ATP-dependent RNA helicase-like protein        131   1e-38   Medicago truncatula
gb|AAX95709.1|  DEAD/DEAH box helicase, putative                        134   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010466626.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   1e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001150170.1|  ATP-dependent RNA helicase dhh1                    134   1e-38   
gb|EPS57204.1|  hypothetical protein M569_17616                         135   1e-38   Genlisea aurea
ref|XP_010456256.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003623900.1|  DEAD-box ATP-dependent RNA helicase                131   1e-38   Medicago truncatula
ref|XP_002464412.1|  hypothetical protein SORBIDRAFT_01g017760          134   2e-38   
ref|XP_009111462.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   2e-38   Brassica rapa
ref|XP_004982679.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    134   2e-38   
gb|EYU35077.1|  hypothetical protein MIMGU_mgv1a005045mg                133   4e-38   Erythranthe guttata [common monkey flower]
emb|CDY51147.1|  BnaA09g51820D                                          133   5e-38   Brassica napus [oilseed rape]
ref|XP_010234885.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   9e-38   Brachypodium distachyon [annual false brome]
ref|XP_009400273.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940461.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   1e-37   Elaeis guineensis
ref|XP_008681228.1|  PREDICTED: uncharacterized protein LOC100194...    135   1e-37   
dbj|BAJ95381.1|  predicted protein                                      134   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS59803.1|  DEAD-box ATP-dependent RNA helicase 12                  134   3e-37   Triticum urartu
ref|XP_002464413.1|  hypothetical protein SORBIDRAFT_01g017770          134   3e-37   Sorghum bicolor [broomcorn]
emb|CDY07205.1|  BnaCnng02200D                                          132   3e-37   
gb|EAY94957.1|  hypothetical protein OsI_16765                          135   3e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_011093152.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    125   5e-37   
ref|NP_001053408.1|  Os04g0533000                                       134   5e-37   
ref|XP_009384494.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   7e-37   
ref|XP_006662493.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   7e-37   
gb|EPS67203.1|  hypothetical protein M569_07571                         135   8e-37   Genlisea aurea
ref|XP_009408278.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   8e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-36   Setaria italica
ref|XP_003623903.1|  DEAD-box ATP-dependent RNA helicase                131   1e-36   Medicago truncatula
sp|Q6H7S2.2|RH8_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA h...    135   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676491.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006652567.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    135   2e-36   Oryza brachyantha
ref|XP_008391229.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   2e-36   
ref|XP_009389244.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT21677.1|  DEAD-box ATP-dependent RNA helicase 12                  135   2e-36   
ref|XP_003580213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   2e-36   Brachypodium distachyon [annual false brome]
ref|NP_001047552.1|  Os02g0641800                                       134   2e-36   
gb|ACG29146.1|  ATP-dependent RNA helicase dhh1                         135   3e-36   Zea mays [maize]
ref|NP_001148960.1|  ATP-dependent RNA helicase dhh1                    135   3e-36   
ref|XP_004976343.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-36   Setaria italica
ref|XP_009134538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   5e-36   Brassica rapa
emb|CDX74342.1|  BnaA03g27050D                                          132   5e-36   
dbj|BAJ90747.1|  predicted protein                                      134   8e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX91901.1|  BnaC03g32030D                                          133   1e-35   
gb|KHN27312.1|  DEAD-box ATP-dependent RNA helicase 8                   136   2e-35   Glycine soja [wild soybean]
gb|ABR16163.1|  unknown                                                 135   2e-35   Picea sitchensis
ref|XP_008681227.1|  PREDICTED: uncharacterized protein LOC100194...    135   5e-35   
ref|XP_006827696.1|  hypothetical protein AMTR_s00009p00258110          135   5e-35   Amborella trichopoda
gb|KJB24710.1|  hypothetical protein B456_004G1574001                   134   1e-34   Gossypium raimondii
dbj|BAJ94923.1|  predicted protein                                      135   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT23815.1|  DEAD-box ATP-dependent RNA helicase 6                   135   2e-34   
ref|XP_001765911.1|  predicted protein                                  135   2e-34   
ref|XP_010908425.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   3e-34   Elaeis guineensis
ref|XP_010908424.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   4e-34   Elaeis guineensis
ref|XP_006583310.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   4e-34   
ref|XP_007135054.1|  hypothetical protein PHAVU_010G0977000g            135   5e-34   Phaseolus vulgaris [French bean]
gb|KHN14047.1|  DEAD-box ATP-dependent RNA helicase 8                   134   7e-34   Glycine soja [wild soybean]
ref|XP_001766771.1|  predicted protein                                  134   8e-34   
ref|XP_010105971.1|  DEAD-box ATP-dependent RNA helicase 8              135   1e-33   
gb|KJB24711.1|  hypothetical protein B456_004G1574001                   134   2e-33   Gossypium raimondii
ref|XP_010905111.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-33   Elaeis guineensis
ref|XP_008794547.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-33   Phoenix dactylifera
gb|EMS61023.1|  DEAD-box ATP-dependent RNA helicase 8                   133   3e-33   Triticum urartu
gb|EMS53111.1|  DEAD-box ATP-dependent RNA helicase 8                   133   3e-33   Triticum urartu
ref|XP_002320116.2|  hypothetical protein POPTR_0014s07690g             134   4e-33   
gb|EMT21717.1|  DEAD-box ATP-dependent RNA helicase 8                   132   5e-33   
ref|XP_004240107.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   7e-33   Solanum lycopersicum
ref|XP_010413440.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010469048.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010512458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    126   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002880201.1|  hypothetical protein ARALYDRAFT_483719             127   9e-33   
ref|XP_006345594.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   9e-33   Solanum tuberosum [potatoes]
ref|XP_010413439.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    126   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003623902.1|  DEAD-box ATP-dependent RNA helicase                134   1e-32   
ref|XP_002876600.1|  hypothetical protein ARALYDRAFT_486601             127   1e-32   
ref|NP_182105.1|  DEAD-box ATP-dependent RNA helicase 6                 127   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290970.1|  hypothetical protein CARUB_v10017085mg             126   1e-32   Capsella rubella
ref|XP_006397769.1|  hypothetical protein EUTSA_v10001405mg             127   2e-32   
ref|XP_010518223.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006397770.1|  hypothetical protein EUTSA_v10001405mg             127   3e-32   
ref|XP_011035912.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   3e-32   Populus euphratica
ref|XP_006397771.1|  hypothetical protein EUTSA_v10001405mg             127   3e-32   
ref|XP_010506559.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009142369.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   4e-32   Brassica rapa
emb|CDY37067.1|  BnaA04g26450D                                          127   4e-32   Brassica napus [oilseed rape]
ref|XP_009116788.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   5e-32   
gb|AAK63966.1|  At2g45810/F4I18.21                                      125   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508105.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006294022.1|  hypothetical protein CARUB_v10023015mg             127   8e-32   Capsella rubella
ref|NP_191683.1|  DEAD-box ATP-dependent RNA helicase 12                127   8e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48935.1|  BnaA09g39020D                                          127   8e-32   Brassica napus [oilseed rape]
ref|XP_006402503.1|  hypothetical protein EUTSA_v10005922mg             127   1e-31   Eutrema salsugineum [saltwater cress]
emb|CDY27357.1|  BnaC04g50480D                                          127   1e-31   Brassica napus [oilseed rape]
ref|XP_005849570.1|  hypothetical protein CHLNCDRAFT_56077              129   2e-31   Chlorella variabilis
ref|XP_009587318.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   2e-31   
emb|CDY58787.1|  BnaA07g38020D                                          126   3e-31   Brassica napus [oilseed rape]
ref|XP_002951166.1|  DEAD-box RNA helicase, ATP-dependent, cytopl...    128   3e-31   Volvox carteri f. nagariensis
gb|KIZ02033.1|  ATP-dependent RNA helicase DDX6/DHH1                    125   4e-31   Monoraphidium neglectum
emb|CDX71756.1|  BnaC08g31180D                                          127   5e-31   
ref|XP_001418212.1|  predicted protein                                  128   5e-31   Ostreococcus lucimarinus CCE9901
ref|XP_006397768.1|  hypothetical protein EUTSA_v10001405mg             127   6e-31   
ref|XP_009104295.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   6e-31   Brassica rapa
ref|XP_010544718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   6e-31   Tarenaya hassleriana [spider flower]
ref|XP_003079824.1|  putative RNA helicase (ISS)                        127   7e-31   Ostreococcus tauri
ref|XP_002508100.1|  DEAD/DEAH box helicase                             127   1e-30   Micromonas commoda
emb|CAA09203.1|  RNA helicase                                           125   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KHN28121.1|  DEAD-box ATP-dependent RNA helicase 8                   125   1e-30   Glycine soja [wild soybean]
ref|XP_001692202.1|  cytoplasmic DExD/H-box RNA helicase                126   2e-30   Chlamydomonas reinhardtii
gb|KIY97689.1|  ATP-dependent RNA helicase DDX6/DHH1                    125   2e-30   Monoraphidium neglectum
ref|XP_006681354.1|  hypothetical protein BATDEDRAFT_20569              125   3e-30   Batrachochytrium dendrobatidis JAM81
gb|ETW32647.1|  DEAD-box ATP-dependent RNA helicase 12                  119   3e-30   Plasmodium falciparum Tanzania (2000708)
gb|ESA01456.1|  hypothetical protein GLOINDRAFT_333744                  125   4e-30   
dbj|GAN04011.1|  eukaryotic translation initiation factor 4A-like...    125   7e-30   Mucor ambiguus
gb|EPB84122.1|  ATP-dependent RNA helicase DHH1                         125   8e-30   Mucor circinelloides f. circinelloides 1006PhL
emb|CEP17217.1|  hypothetical protein                                   125   8e-30   Parasitella parasitica
dbj|GAN00930.1|  conserved hypothetical protein                         124   9e-30   Mucor ambiguus
emb|CDS12947.1|  Putative ATP-dependent RNA helicase DHH1               124   1e-29   Lichtheimia ramosa
gb|EPB90373.1|  ATP-dependent RNA helicase dhh1                         124   1e-29   Mucor circinelloides f. circinelloides 1006PhL
emb|CDH55774.1|  atp-dependent rna helicase dhh1                        124   1e-29   Lichtheimia corymbifera JMRC:FSU:9682
gb|KFH64831.1|  ATP-dependent RNA helicase dhh1                         124   1e-29   Mortierella verticillata NRRL 6337
gb|KFH66615.1|  ATP-dependent RNA helicase dhh1                         124   1e-29   Mortierella verticillata NRRL 6337
emb|CDS11083.1|  Putative ATP-dependent RNA helicase DHH1               124   2e-29   Lichtheimia ramosa
emb|CDH58577.1|  atp-dependent rna helicase dhh1                        124   2e-29   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEP14076.1|  hypothetical protein                                   123   2e-29   Parasitella parasitica
gb|EPZ36415.1|  putative ATP-dependent RNA helicase ddx6                123   2e-29   Rozella allomycis CSF55
ref|XP_005646927.1|  cytoplasmic DExD/H-box RNA helicase                123   2e-29   Coccomyxa subellipsoidea C-169
gb|KDE02539.1|  ATP-dependent RNA helicase dhh1                         124   3e-29   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|EGU12280.1|  ATP-dependent RNA helicase dhh1                         124   3e-29   Rhodotorula toruloides ATCC 204091
gb|EMS22443.1|  ATP-dependent rna helicase dhh1                         124   3e-29   Rhodotorula toruloides NP11
gb|EWC90657.1|  histone H2A                                             120   3e-29   Plasmodium falciparum NF54
emb|CDR46917.1|  RHTO0S13e03356g1_1                                     123   4e-29   Rhodotorula toruloides
ref|XP_005777763.1|  hypothetical protein EMIHUDRAFT_457595             121   5e-29   Emiliania huxleyi CCMP1516
gb|EIE82813.1|  ATP-dependent RNA helicase dhh1                         122   5e-29   Rhizopus delemar RA 99-880
emb|CEI85652.1|  Putative DEAD/DEAH box helicase                        122   7e-29   Rhizopus microsporus
emb|CEJ02025.1|  Putative ATP-dependent RNA helicase DHH1               122   7e-29   Rhizopus microsporus
ref|XP_002769151.1|  DEAD box ATP-dependent RNA helicase, putative      118   7e-29   Perkinsus marinus ATCC 50983
emb|CEG81286.1|  Putative Atp-dependent rna helicase dhh1               122   7e-29   Rhizopus microsporus
emb|CEG82997.1|  Putative ATP-dependent RNA helicase DHH1               122   7e-29   Rhizopus microsporus
emb|CEG71520.1|  Putative ATP-dependent RNA helicase DHH1               122   7e-29   Rhizopus microsporus
ref|XP_009690645.1|  ATP-dependent RNA helicase                         121   8e-29   Theileria orientalis strain Shintoku
emb|CEI93304.1|  Putative ATP-dependent RNA helicase DHH1               122   8e-29   Rhizopus microsporus
emb|CCF74289.1|  unnamed protein product                                122   8e-29   
emb|CEG63343.1|  Putative Atp-dependent rna helicase dhh1               122   8e-29   Rhizopus microsporus
emb|CEI99706.1|  Putative DEAD/DEAH box helicase                        122   8e-29   Rhizopus microsporus
ref|XP_765179.1|  ATP-dependent RNA helicase                            121   9e-29   Theileria parva strain Muguga
ref|XP_004829238.1|  DEAD box ATP-dependent RNA helicase family m...    121   1e-28   Theileria equi strain WA
ref|XP_005780551.1|  hypothetical protein EMIHUDRAFT_73141              121   1e-28   Emiliania huxleyi CCMP1516
ref|XP_001388425.1|  ATP-dependent RNA helicase                         121   1e-28   Cryptosporidium parvum Iowa II
ref|XP_002139920.1|  ATP-dependent RNA helicase                         121   1e-28   Cryptosporidium muris RN66
ref|XP_004336605.1|  atpdependent rna helicase ddx6, putative           120   2e-28   Acanthamoeba castellanii str. Neff
ref|XP_952098.1|  ATP-dependent RNA helicase                            120   2e-28   Theileria annulata
ref|XP_007875348.1|  hypothetical protein PNEG_03276                    121   2e-28   Pneumocystis murina B123
ref|XP_007875349.1|  hypothetical protein, variant                      120   2e-28   
emb|CCJ28577.1|  unnamed protein product                                123   2e-28   Pneumocystis jirovecii
emb|CCJ28576.1|  unnamed protein product                                120   2e-28   Pneumocystis jirovecii
gb|ETW32270.1|  DEAD-box ATP-dependent RNA helicase 8                   121   3e-28   Plasmodium falciparum FCH/4
gb|EIE81845.1|  ATP-dependent RNA helicase DHH1                         120   3e-28   Rhizopus delemar RA 99-880
gb|EIE83902.1|  ATP-dependent RNA helicase DHH1                         120   3e-28   Rhizopus delemar RA 99-880
emb|CCU99198.1|  unnamed protein product                                120   3e-28   Malassezia sympodialis ATCC 42132
emb|CDO62632.1|  ATP-dependent RNA helicase DDX6, putative              119   6e-28   Plasmodium reichenowi
ref|XP_001351278.1|  ATP-dependent RNA Helicase, putative               119   6e-28   Plasmodium falciparum 3D7
gb|KIY70674.1|  DEAD-domain-containing protein                          119   6e-28   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_001610166.1|  ATP-dependent RNA helicase                         119   7e-28   Babesia bovis T2Bo
ref|XP_008623418.1|  ATP-dependent RNA helicase ddx6                    119   7e-28   Plasmodium vinckei vinckei
ref|XP_742509.1|  ATP-dependent RNA helicase                            119   7e-28   
ref|XP_001614505.1|  ATP-dependent RNA helicase                         119   8e-28   Plasmodium vivax
ref|XP_008815898.1|  ATP-dependent RNA helicase ddx6                    119   8e-28   Plasmodium inui San Antonio 1
emb|CBQ73743.1|  probable ATP-dependent RNA helicase DHH1               119   8e-28   Sporisorium reilianum SRZ2
dbj|GAC75080.1|  ATP-dependent RNA helicase                             119   8e-28   Moesziomyces antarcticus T-34
ref|XP_004222076.1|  ATP-dependent RNA helicase                         119   8e-28   Plasmodium cynomolgi strain B
gb|ETS59938.1|  hypothetical protein PaG_05919                          119   9e-28   Moesziomyces aphidis DSM 70725
ref|XP_002258841.1|  ATP-dependent RNA helicase                         119   9e-28   Plasmodium knowlesi strain H
dbj|GAK64657.1|  eukaryotic translation initiation factor 4A-like...    119   9e-28   Moesziomyces antarcticus
gb|EST04933.1|  ATP-dependent RNA helicase                              119   9e-28   Kalmanozyma brasiliensis GHG001
ref|XP_011389806.1|  putative DExD/H-box ATP-dependent RNA helica...    119   9e-28   Ustilago maydis 521
ref|XP_729699.1|  ATP-dependent RNA Helicase                            119   9e-28   
emb|CDI54154.1|  probable ATP-dependent RNA helicase DHH1               119   9e-28   Melanopsichium pennsylvanicum 4
emb|CCF52042.1|  probable ATP-dependent RNA helicase DHH1               119   1e-27   Ustilago hordei
ref|XP_001632003.1|  predicted protein                                  117   2e-27   Nematostella vectensis
ref|NP_596324.1|  ATP-dependent RNA helicase Ste13                      117   3e-27   Schizosaccharomyces pombe
gb|EPX72399.1|  ATP-dependent RNA helicase Ste13                        117   3e-27   Schizosaccharomyces octosporus yFS286
ref|XP_007882290.1|  hypothetical protein PFL1_06556                    117   3e-27   Anthracocystis flocculosa PF-1
gb|EPY54028.1|  ATP-dependent RNA helicase Ste13                        117   3e-27   Schizosaccharomyces cryophilus OY26
gb|AAH39826.1|  DDX6 protein                                            113   3e-27   Homo sapiens [man]
ref|XP_002787325.1|  RNA helicase, putative                             117   4e-27   Perkinsus marinus ATCC 50983
ref|XP_005704518.1|  ATP-dependent RNA helicase                         117   4e-27   Galdieria sulphuraria
dbj|GAC99235.1|  hypothetical protein PHSY_006835                       120   4e-27   Pseudozyma hubeiensis SY62
dbj|BAH19526.1|  AT4G00660                                              116   5e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDR94055.1|  ATP-dependent RNA helicase, putative                   116   5e-27   Babesia bigemina
ref|XP_001730716.1|  hypothetical protein MGL_2170                      117   5e-27   Malassezia globosa CBS 7966
ref|XP_002174323.1|  ATP-dependent RNA helicase Ste13                   117   6e-27   Schizosaccharomyces japonicus yFS275
ref|XP_002771414.1|  RNA helicase, putative                             116   6e-27   Perkinsus marinus ATCC 50983
ref|XP_002771413.1|  RNA helicase, putative                             116   6e-27   Perkinsus marinus ATCC 50983
ref|XP_002769153.1|  RNA helicase, putative                             116   6e-27   Perkinsus marinus ATCC 50983
gb|AAR10184.1|  similar to Drosophila melanogaster me31B                111   6e-27   Drosophila yakuba
ref|XP_002767329.1|  RNA helicase, putative                             116   7e-27   
ref|XP_002164714.2|  PREDICTED: probable ATP-dependent RNA helica...    116   7e-27   
emb|CDJ58680.1|  ATP-dependent RNA helicase, putative                   116   8e-27   
gb|KFQ65694.1|  putative ATP-dependent RNA helicase DDX6                114   8e-27   
ref|XP_007672754.1|  hypothetical protein BAUCODRAFT_371348             116   9e-27   
ref|XP_007931640.1|  hypothetical protein MYCFIDRAFT_205331             116   9e-27   
ref|XP_009488731.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-26   
ref|XP_005831668.1|  hypothetical protein GUITHDRAFT_71963              115   1e-26   
gb|KDQ31787.1|  hypothetical protein PLEOSDRAFT_22618                   115   1e-26   
emb|CDI86265.1|  ATP-dependent RNA helicase, putative                   115   1e-26   
ref|XP_007392761.1|  hypothetical protein PHACADRAFT_53058              111   1e-26   
ref|XP_002909411.1|  DEAD/DEAH box RNA helicase, putative               115   1e-26   
ref|XP_008913632.1|  DEAD-box ATP-dependent RNA helicase 8              115   1e-26   
ref|XP_009514016.1|  hypothetical protein PHYSODRAFT_283996             115   2e-26   
emb|CDJ30776.1|  ATP-dependent RNA helicase, putative                   115   2e-26   
gb|EER42775.1|  ATP-dependent RNA helicase dhh1                         114   2e-26   
ref|XP_007710410.1|  hypothetical protein COCCADRAFT_91103              115   2e-26   
ref|XP_007696390.1|  hypothetical protein COCSADRAFT_277961             115   3e-26   
gb|KEQ83372.1|  DEAD-domain-containing protein                          115   3e-26   
ref|XP_007687115.1|  hypothetical protein COCMIDRAFT_93013              115   3e-26   
sp|Q0U7S9.1|DHH1_PHANO  RecName: Full=ATP-dependent RNA helicase ...    115   3e-26   
gb|KEQ91251.1|  hypothetical protein AUEXF2481DRAFT_70100               115   3e-26   
ref|XP_004075319.1|  PREDICTED: probable ATP-dependent RNA helica...    114   3e-26   
gb|KEQ69618.1|  DEAD-domain-containing protein                          115   3e-26   
ref|XP_003841790.1|  similar to ATP-dependent RNA helicase dhh1         115   3e-26   
gb|KEQ62464.1|  DEAD-domain-containing protein                          115   3e-26   
ref|XP_003667597.1|  hypothetical protein NDAI_0A01960                  115   4e-26   
ref|XP_001802414.1|  hypothetical protein SNOG_12185                    114   4e-26   
ref|XP_001270568.1|  ATP dependent RNA helicase (Dhh1), putative        114   4e-26   
emb|CDI79150.1|  ATP-dependent RNA helicase, putative                   113   4e-26   
ref|XP_001824396.1|  ATP-dependent RNA helicase dhh1                    114   4e-26   
ref|XP_001263902.1|  ATP dependent RNA helicase (Dhh1), putative        114   5e-26   
ref|XP_002620701.1|  ATP-dependent RNA helicase DHH1                    114   5e-26   
ref|XP_001395078.1|  ATP-dependent RNA helicase dhh1                    114   5e-26   
ref|XP_001646418.1|  hypothetical protein Kpol_2001p67                  114   5e-26   
tpe|CBF82660.1|  TPA: ATP-dependent RNA helicase (Eurofung)             114   5e-26   
ref|XP_001217579.1|  hypothetical protein ATEG_08993                    114   5e-26   
ref|XP_755058.1|  DEAD-box RNA helicase Dhh1/Vad1                       114   5e-26   
gb|EEH07818.1|  ATP-dependent RNA helicase DHH1                         114   5e-26   
ref|XP_003065260.1|  ATP-dependent RNA helicase, putative               114   5e-26   
ref|XP_008042303.1|  DEAD-domain-containing protein                     114   5e-26   
ref|XP_010761262.1|  ATP-dependent RNA helicase DHH1                    114   5e-26   
ref|XP_009046927.1|  hypothetical protein LOTGIDRAFT_199739             111   6e-26   
gb|EER42776.1|  ATP-dependent RNA helicase DHH1                         114   6e-26   
ref|XP_001248331.1|  conserved hypothetical protein                     114   6e-26   
gb|KDO28289.1|  DEAD-box ATP-dependent RNA helicase 8                   113   6e-26   
ref|XP_008605548.1|  DEAD-box ATP-dependent RNA helicase 8              113   6e-26   
dbj|GAD99861.1|  ATP-dependent RNA helicase DHH1                        114   6e-26   
ref|XP_007384334.1|  DEAD-domain-containing protein                     114   6e-26   
ref|XP_007756258.1|  ATP-dependent RNA helicase DHH1                    114   6e-26   
gb|EFW16869.1|  ATP-dependent RNA helicase dhh1                         114   6e-26   
ref|XP_684923.1|  PREDICTED: probable ATP-dependent RNA helicase ...    114   6e-26   
gb|KIW69375.1|  ATP-dependent RNA helicase DHH1                         114   6e-26   
ref|XP_009158872.1|  ATP-dependent RNA helicase dhh1                    114   6e-26   
gb|KIJ15927.1|  hypothetical protein PAXINDRAFT_168904                  114   6e-26   
ref|NP_001166415.1|  probable ATP-dependent RNA helicase DDX6           114   6e-26   
ref|XP_008873462.1|  DEAD-box ATP-dependent RNA helicase 6              113   6e-26   
ref|XP_009829781.1|  DEAD-box ATP-dependent RNA helicase 8              113   6e-26   
ref|XP_002789230.1|  ATP-dependent RNA helicase DHH1                    114   6e-26   
gb|KIW87364.1|  ATP-dependent RNA helicase dhh1                         114   6e-26   
ref|XP_008727205.1|  ATP-dependent RNA helicase DHH1                    114   6e-26   
gb|KIJ61858.1|  hypothetical protein HYDPIDRAFT_137104                  114   6e-26   
ref|XP_002414143.1|  ribosomal DEAD box protein, putative               112   6e-26   
gb|KIW61171.1|  ATP-dependent RNA helicase dhh1                         114   6e-26   
gb|EPS26561.1|  hypothetical protein PDE_01498                          114   6e-26   
gb|KIK99181.1|  hypothetical protein PAXRUDRAFT_23846                   114   7e-26   
gb|EKG16907.1|  RNA helicase ATP-dependent DEAD-box conserved site      114   7e-26   
gb|ELT97926.1|  hypothetical protein CAPTEDRAFT_155246                  113   7e-26   
gb|EYE96312.1|  putative ATP dependent RNA helicase                     114   7e-26   
ref|XP_007584628.1|  putative atp-dependent rna helicase dhh1 pro...    114   7e-26   
emb|CDJ48750.1|  ATP-dependent RNA helicase, putative                   113   7e-26   
ref|XP_007741840.1|  ATP-dependent RNA helicase DHH1                    114   7e-26   
ref|XP_008022433.1|  hypothetical protein SETTUDRAFT_26261              114   7e-26   
ref|XP_007259595.1|  PREDICTED: probable ATP-dependent RNA helica...    114   7e-26   
ref|XP_007731184.1|  ATP-dependent RNA helicase DHH1                    114   7e-26   
ref|XP_003885240.1|  Eukaryotic initiation factor, related              114   7e-26   
ref|XP_007367461.1|  eukaryotic translation initiation factor 4A-...    114   7e-26   
ref|XP_002843312.1|  ATP-dependent RNA helicase DHH1                    113   7e-26   
ref|XP_005796898.1|  PREDICTED: probable ATP-dependent RNA helica...    113   7e-26   
ref|XP_002584013.1|  hypothetical protein UREG_06980                    114   7e-26   
ref|NP_001083721.1|  ATP-dependent RNA helicase ddx6                    113   8e-26   
emb|CDM32408.1|  ATP-dependent RNA helicase dhh1                        114   8e-26   
ref|XP_002152684.1|  DEAD-box RNA helicase Dhh1/Vad1, putative          114   8e-26   
ref|XP_007782284.1|  ATP-dependent RNA helicase DHH1                    114   8e-26   
gb|EWM20640.1|  RNA helicase,ATP-dependent, DEAD-box type               113   8e-26   
ref|XP_010771038.1|  PREDICTED: probable ATP-dependent RNA helica...    113   8e-26   
gb|KGO65462.1|  Helicase, C-terminal                                    114   8e-26   
gb|EGE02714.1|  ATP-dependent RNA helicase DHH1                         113   8e-26   
ref|XP_002486388.1|  DEAD-box RNA helicase Dhh1/Vad1, putative          114   8e-26   
emb|CCI48817.1|  unnamed protein product                                113   8e-26   
ref|XP_002563374.1|  Pc20g08510                                         114   8e-26   
ref|XP_001933723.1|  ATP-dependent RNA helicase DHH1                    114   8e-26   
dbj|GAM43589.1|  ATP-dependent RNA helicase                             113   8e-26   
emb|CAG09056.1|  unnamed protein product                                113   9e-26   
ref|XP_010738007.1|  PREDICTED: probable ATP-dependent RNA helica...    113   9e-26   
ref|XP_008424655.1|  PREDICTED: probable ATP-dependent RNA helica...    113   9e-26   
gb|KGO36130.1|  Helicase, C-terminal                                    114   9e-26   
ref|XP_003303815.1|  hypothetical protein PTT_16176                     114   9e-26   
ref|XP_006642205.1|  PREDICTED: probable ATP-dependent RNA helica...    113   9e-26   
ref|XP_008307229.1|  PREDICTED: probable ATP-dependent RNA helica...    113   9e-26   
ref|XP_003968632.1|  PREDICTED: probable ATP-dependent RNA helica...    113   9e-26   
ref|XP_007258341.1|  PREDICTED: probable ATP-dependent RNA helica...    113   9e-26   
ref|XP_007552379.1|  PREDICTED: probable ATP-dependent RNA helica...    113   9e-26   
gb|EKV16720.1|  hypothetical protein PDIG_19090                         114   9e-26   
gb|KFP50442.1|  putative ATP-dependent RNA helicase DDX6                113   9e-26   
gb|EDL25605.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, isoform...    113   9e-26   
emb|CCA22119.1|  predicted protein putative                             112   1e-25   
ref|XP_003450212.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
emb|CDO74578.1|  hypothetical protein BN946_scf184583.g5                113   1e-25   
ref|XP_001340860.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_010899583.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
gb|KIV81870.1|  ATP-dependent RNA helicase dhh1                         113   1e-25   
ref|XP_008287986.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_004856787.1|  PREDICTED: probable ATP-dependent RNA helica...    112   1e-25   
ref|XP_007909384.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
gb|EKV21927.1|  hypothetical protein PDIP_01520                         114   1e-25   
ref|XP_007560107.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_001881258.1|  predicted protein                                  112   1e-25   
ref|XP_008284012.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_004560553.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_004074359.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_008061110.1|  PREDICTED: probable ATP-dependent RNA helica...    112   1e-25   
ref|XP_005735978.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_007909383.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
ref|XP_003674344.1|  hypothetical protein NCAS_0A14060                  113   1e-25   
emb|CAF90961.1|  unnamed protein product                                113   1e-25   
ref|XP_005999191.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
dbj|BAJ93616.1|  predicted protein                                      112   1e-25   
ref|XP_007424313.1|  PREDICTED: probable ATP-dependent RNA helica...    113   1e-25   
gb|KFV74826.1|  putative ATP-dependent RNA helicase DDX6                113   1e-25   
ref|XP_009906613.1|  PREDICTED: probable ATP-dependent RNA helica...    112   1e-25   
gb|EPY88048.1|  putative ATP-dependent RNA helicase DDX6                112   1e-25   
ref|XP_008421203.1|  PREDICTED: probable ATP-dependent RNA helica...    112   1e-25   
ref|XP_004456392.1|  PREDICTED: probable ATP-dependent RNA helica...    112   1e-25   
gb|AAA28603.1|  RNA helicase                                            112   1e-25   
gb|EPQ01790.1|  Putative ATP-dependent RNA helicase DDX6                112   1e-25   
ref|XP_003173227.1|  ATP-dependent RNA helicase DHH1                    113   1e-25   
emb|CDQ63692.1|  unnamed protein product                                112   1e-25   
ref|XP_005069498.1|  PREDICTED: probable ATP-dependent RNA helica...    112   1e-25   
ref|XP_006120991.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_005328395.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|NP_004388.2|  probable ATP-dependent RNA helicase DDX6              112   2e-25   
gb|KIW14976.1|  ATP-dependent RNA helicase DHH1                         113   2e-25   
ref|XP_006890900.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
dbj|BAA04482.1|  RCK                                                    112   2e-25   
ref|XP_009321665.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_008936029.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_004016131.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|AAB94769.1|  putative RNA helicase RCK                               112   2e-25   
ref|XP_009096029.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|KFW66637.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
gb|KFQ27323.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
gb|KFP05525.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
ref|NP_001137339.1|  probable ATP-dependent RNA helicase DDX6           112   2e-25   
ref|XP_005299846.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_004385709.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_003129962.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_010073394.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_010007187.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_008576061.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_008498097.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_007062450.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_005058611.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_004427303.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_004175753.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    112   2e-25   
gb|KFV08299.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
ref|NP_001006319.2|  probable ATP-dependent RNA helicase DDX6           112   2e-25   
ref|XP_006993424.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_003418301.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|KFW07901.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
gb|KFO81891.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
ref|XP_006152352.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_004636497.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|EMC78306.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
ref|NP_001268976.1|  probable ATP-dependent RNA helicase DDX6 iso...    112   2e-25   
ref|XP_005271475.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_009579459.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_007523665.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_006037671.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_004667445.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|NP_001128971.1|  probable ATP-dependent RNA helicase DDX6           112   2e-25   
ref|XP_849975.1|  PREDICTED: probable ATP-dependent RNA helicase ...    112   2e-25   
ref|NP_001102762.1|  probable ATP-dependent RNA helicase DDX6           112   2e-25   
ref|XP_005500759.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_004585195.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_007802948.1|  ATP-dependent RNA helicase DHH1                    113   2e-25   
ref|XP_005142703.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_008824161.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_003237974.1|  ATP-dependent RNA helicase DHH1                    113   2e-25   
ref|XP_004052289.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_009566929.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_005856840.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_006794545.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_009917607.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|KFQ45799.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
gb|KFP96604.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
ref|XP_002722747.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_010007469.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_010627615.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_002497696.1|  ZYRO0F11440p                                       113   2e-25   
gb|EMP33396.1|  Putative ATP-dependent RNA helicase DDX6                112   2e-25   
gb|KIW28326.1|  ATP-dependent RNA helicase dhh1                         113   2e-25   
gb|KDB22915.1|  ATP-dependent RNA helicase dhh1                         112   2e-25   
ref|XP_004712835.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|NP_031867.1|  probable ATP-dependent RNA helicase DDX6              112   2e-25   
gb|EDL25604.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, isoform...    112   2e-25   
ref|XP_008302149.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_006912638.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|KFR01415.1|  putative ATP-dependent RNA helicase DDX6                112   2e-25   
ref|XP_009467328.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|KIW74968.1|  ATP-dependent RNA helicase dhh1                         113   2e-25   
gb|EZF29913.1|  ATP-dependent RNA helicase dhh1                         112   2e-25   
ref|XP_007654732.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
gb|EHH23489.1|  hypothetical protein EGK_06964                          112   2e-25   
ref|XP_003848580.1|  hypothetical protein MYCGRDRAFT_101609             112   2e-25   
ref|XP_006833954.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
ref|XP_005026670.1|  PREDICTED: probable ATP-dependent RNA helica...    112   2e-25   
emb|CDQ56649.1|  unnamed protein product                                112   2e-25   
ref|NP_001072584.1|  probable ATP-dependent RNA helicase ddx6           112   2e-25   
gb|EMF09064.1|  ATP-dependent RNA helicase DHH1                         112   2e-25   
gb|EHA20131.1|  hypothetical protein ASPNIDRAFT_209198                  115   2e-25   



>ref|XP_009757253.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nicotiana 
sylvestris]
Length=504

 Score =   134 bits (338),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  122  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  181

Query  634  AAFCI  648
            AAFCI
Sbjct  182  AAFCI  186


 Score = 70.9 bits (172),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN   A S+SS +EV KT+QSE +D SSQDWKARLNIPAPDTRYRT
Sbjct  73   WLRRNQQLATSDSSIDEVEKTVQSEALDQSSQDWKARLNIPAPDTRYRT  121



>ref|XP_009611007.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nicotiana 
tomentosiformis]
Length=504

 Score =   134 bits (338),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  122  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  181

Query  634  AAFCI  648
            AAFCI
Sbjct  182  AAFCI  186


 Score = 68.9 bits (167),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+   AAS+SS +EV KT+QSE +D SSQDWKARLNIPAPDTRYRT
Sbjct  73   WLRRSQQLAASDSSIDEVEKTVQSEALDQSSQDWKARLNIPAPDTRYRT  121



>ref|XP_007139882.1| hypothetical protein PHAVU_008G066400g [Phaseolus vulgaris]
 gb|ESW11876.1| hypothetical protein PHAVU_008G066400g [Phaseolus vulgaris]
Length=512

 Score =   135 bits (341),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  130  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  189

Query  634  AAFCI  648
            AAFCI
Sbjct  190  AAFCI  194


 Score = 63.9 bits (154),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaases-ssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN     +++    EV KT+QSE +D SSQDWKARLNIPAPDTRY+T
Sbjct  80   WLRRNQLGGGTDTNVVEEVEKTVQSEAVDPSSQDWKARLNIPAPDTRYKT  129



>emb|CBI40324.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   135 bits (339),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  90   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  149

Query  634  AAFCI  648
            AAFCI
Sbjct  150  AAFCI  154


 Score = 63.9 bits (154),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN   A ++S+ +EV KT+QSE +DSSSQDWKARL IP PDTRYRT
Sbjct  43   WLRRN--QAGADSAVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYRT  89



>ref|XP_010273108.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Nelumbo nucifera]
Length=483

 Score =   134 bits (337),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  101  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  160

Query  634  AAFCI  648
            AAFC+
Sbjct  161  AAFCV  165


 Score = 64.7 bits (156),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRNP    S S  NEV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  54   WLRRNPMGTESGS--NEVEKTVQSEAVDSSSQDWKARLKIPPTDTRYKT  100



>ref|XP_002270379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 ref|XP_010661748.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 ref|XP_010661749.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 emb|CAN75439.1| hypothetical protein VITISV_000835 [Vitis vinifera]
Length=491

 Score =   134 bits (338),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  109  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  168

Query  634  AAFCI  648
            AAFCI
Sbjct  169  AAFCI  173


 Score = 63.9 bits (154),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN   A ++S+ +EV KT+QSE +DSSSQDWKARL IP PDTRYRT
Sbjct  62   WLRRN--QAGADSAVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYRT  108



>ref|XP_010255444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nelumbo 
nucifera]
 ref|XP_010255445.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nelumbo 
nucifera]
Length=481

 Score =   135 bits (339),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  99   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  158

Query  634  AAFCI  648
            AAFCI
Sbjct  159  AAFCI  163


 Score = 63.5 bits (153),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRNP    S S  NEV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  52   WLRRNPMGTDSSS--NEVEKTVQSEAVDSSSQDWKARLKIPPRDTRYKT  98



>ref|XP_010671975.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671984.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=519

 Score =   134 bits (337),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  137  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  196

Query  634  AAFCI  648
            AAFC+
Sbjct  197  AAFCV  201


 Score = 63.5 bits (153),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN S   +ESS +EV KT+QSE ID+SSQDWKARL +P  DTRYRT
Sbjct  88   WLRRNQSGGTTESSVDEVEKTVQSEAIDTSSQDWKARLKLPPQDTRYRT  136



>ref|XP_010053686.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Eucalyptus 
grandis]
 gb|KCW78046.1| hypothetical protein EUGRSUZ_D02270 [Eucalyptus grandis]
Length=514

 Score =   135 bits (340),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  132  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  191

Query  634  AAFCI  648
            AAFC+
Sbjct  192  AAFCV  196


 Score = 62.4 bits (150),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR     +++S+ +EV KT+QSE IDSSSQDWKARL IP PDTRYRT
Sbjct  84   WLRRT-QLGSADSTVDEVEKTVQSEAIDSSSQDWKARLKIPPPDTRYRT  131



>ref|XP_007051860.1| DEAD-box ATP-dependent RNA helicase 8 isoform 3, partial [Theobroma 
cacao]
 gb|EOX96017.1| DEAD-box ATP-dependent RNA helicase 8 isoform 3, partial [Theobroma 
cacao]
Length=363

 Score =   135 bits (341),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  60   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  119

Query  634  AAFCI  648
            AAFCI
Sbjct  120  AAFCI  124


 Score = 62.0 bits (149),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KT+QSE +DSSSQDWKARL IP PDTRY+T
Sbjct  10   WLRRNLLPGGNDSSVVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYKT  59



>ref|XP_004492712.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cicer 
arietinum]
Length=499

 Score =   135 bits (339),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 62.8 bits (151),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN       +   EV KT+QSE  D SSQDWKARL IP PDTRYRT
Sbjct  68   WLRRNQLGGTDTNVVEEVEKTVQSEAADPSSQDWKARLKIPPPDTRYRT  116



>ref|XP_007051859.1| RNAhelicase-like 8 isoform 2, partial [Theobroma cacao]
 gb|EOX96016.1| RNAhelicase-like 8 isoform 2, partial [Theobroma cacao]
Length=356

 Score =   135 bits (341),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  72   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  131

Query  634  AAFCI  648
            AAFCI
Sbjct  132  AAFCI  136


 Score = 61.6 bits (148),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KT+QSE +DSSSQDWKARL IP PDTRY+T
Sbjct  22   WLRRNLLPGGNDSSVVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYKT  71



>ref|XP_007051858.1| RNAhelicase-like 8 isoform 1 [Theobroma cacao]
 gb|EOX96015.1| RNAhelicase-like 8 isoform 1 [Theobroma cacao]
Length=501

 Score =   135 bits (341),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  119  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  178

Query  634  AAFCI  648
            AAFCI
Sbjct  179  AAFCI  183


 Score = 61.6 bits (148),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KT+QSE +DSSSQDWKARL IP PDTRY+T
Sbjct  69   WLRRNLLPGGNDSSVVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYKT  118



>gb|KJB41289.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
 gb|KJB41292.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
Length=469

 Score =   135 bits (340),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  112  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  171

Query  634  AAFCI  648
            AAFCI
Sbjct  172  AAFCI  176


 Score = 62.0 bits (149),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+        S  +EV KT+QSE +DSSSQDWKARLN+P PDTRY+T
Sbjct  62   WLRRDQLPGGNDSSVVDEVEKTVQSEAVDSSSQDWKARLNVPPPDTRYKT  111



>gb|KJB41290.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
Length=468

 Score =   135 bits (340),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  112  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  171

Query  634  AAFCI  648
            AAFCI
Sbjct  172  AAFCI  176


 Score = 61.6 bits (148),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+        S  +EV KT+QSE +DSSSQDWKARLN+P PDTRY+T
Sbjct  62   WLRRDQLPGGNDSSVVDEVEKTVQSEAVDSSSQDWKARLNVPPPDTRYKT  111



>gb|KJB41288.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
 gb|KJB41291.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
Length=494

 Score =   135 bits (340),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  112  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  171

Query  634  AAFCI  648
            AAFCI
Sbjct  172  AAFCI  176


 Score = 61.6 bits (148),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+        S  +EV KT+QSE +DSSSQDWKARLN+P PDTRY+T
Sbjct  62   WLRRDQLPGGNDSSVVDEVEKTVQSEAVDSSSQDWKARLNVPPPDTRYKT  111



>ref|XP_009794054.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Nicotiana sylvestris]
Length=420

 Score =   135 bits (339),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  111  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  170

Query  634  AAFCI  648
            AAFCI
Sbjct  171  AAFCI  175


 Score = 61.2 bits (147),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN  + +++S+ +EV KT+Q+E +D SSQDWKA+L IP+PDTRYRT
Sbjct  63   WLRRN-QSPSADSTVDEVEKTVQAEAVDQSSQDWKAKLKIPSPDTRYRT  110



>ref|XP_009340166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Pyrus x bretschneideri]
Length=510

 Score =   135 bits (340),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  128  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  187

Query  634  AAFCI  648
            AAFCI
Sbjct  188  AAFCI  192


 Score = 60.5 bits (145),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPs--aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR     + +++S+ +EV KT+QSE +D SSQDWKARL IPAPDTR+RT
Sbjct  77   WLRRGQLGGSTSADSAVDEVEKTVQSEAVDPSSQDWKARLKIPAPDTRFRT  127



>ref|XP_007220665.1| hypothetical protein PRUPE_ppa004633mg [Prunus persica]
 ref|XP_008232788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Prunus mume]
 gb|EMJ21864.1| hypothetical protein PRUPE_ppa004633mg [Prunus persica]
Length=499

 Score =   135 bits (339),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 60.8 bits (146),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRN--PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR     + +++S+ +EV KT+QSE +D SS DWKARLNIPAPDTR+RT
Sbjct  66   WLRRGQLGGSTSADSAVDEVEKTVQSEAVDPSSHDWKARLNIPAPDTRFRT  116



>ref|XP_008347150.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
8-like [Malus domestica]
Length=449

 Score =   135 bits (339),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  121  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  180

Query  634  AAFCI  648
            AAFCI
Sbjct  181  AAFCI  185


 Score = 60.8 bits (146),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPs--aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR     + +++S+ +EV KT+QSE +D SSQDWKARL IPAPDTR+RT
Sbjct  70   WLRRGQLGGSTSADSAVDEVEKTVQSEAVDPSSQDWKARLKIPAPDTRFRT  120



>ref|XP_009794053.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Nicotiana sylvestris]
Length=493

 Score =   134 bits (338),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  111  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  170

Query  634  AAFCI  648
            AAFCI
Sbjct  171  AAFCI  175


 Score = 61.2 bits (147),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN  + +++S+ +EV KT+Q+E +D SSQDWKA+L IP+PDTRYRT
Sbjct  63   WLRRN-QSPSADSTVDEVEKTVQAEAVDQSSQDWKAKLKIPSPDTRYRT  110



>gb|KGN56528.1| Dead box ATP-dependent RNA helicase [Cucumis sativus]
Length=558

 Score =   135 bits (339),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174


 Score = 60.5 bits (145),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaa-sesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WL+RN      ++S+ +EV KT+QSE +DSSSQDWKARL IP PDTRY+T
Sbjct  60   WLKRNQLGGGPADSNVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYKT  109



>ref|XP_004133869.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis 
sativus]
 ref|XP_004155819.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis 
sativus]
Length=492

 Score =   135 bits (339),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174


 Score = 60.5 bits (145),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaa-sesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WL+RN      ++S+ +EV KT+QSE +DSSSQDWKARL IP PDTRY+T
Sbjct  60   WLKRNQLGGGPADSNVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYKT  109



>ref|XP_008438061.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Cucumis melo]
 ref|XP_008438062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Cucumis melo]
Length=492

 Score =   135 bits (339),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174


 Score = 60.5 bits (145),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaa-sesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WL+RN      ++S+ +EV KT+QSE +DSSSQDWKARL IP PDTRY+T
Sbjct  60   WLKRNQLGGGPADSNVDEVEKTVQSEAVDSSSQDWKARLKIPPPDTRYKT  109



>gb|KHG18488.1| DEAD-box ATP-dependent RNA helicase 8 -like protein [Gossypium 
arboreum]
Length=435

 Score =   135 bits (340),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174


 Score = 60.1 bits (144),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KTIQSE  DSSSQDWKARL +P PDTRY+T
Sbjct  60   WLRRNQLPGTNDSSVVDEVEKTIQSEAFDSSSQDWKARLKMPPPDTRYKT  109



>gb|KJB22343.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
 gb|KJB22344.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
Length=490

 Score =   135 bits (339),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  108  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  167

Query  634  AAFCI  648
            AAFCI
Sbjct  168  AAFCI  172


 Score = 60.5 bits (145),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KTIQSE  DSSSQDWKARL +P PDTRY+T
Sbjct  58   WLRRNQLPGTNDSSVVDEVEKTIQSEAFDSSSQDWKARLKMPPPDTRYKT  107



>emb|CBI34696.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   135 bits (339),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  56   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  115

Query  634  AAFCI  648
            AAFCI
Sbjct  116  AAFCI  120


 Score = 60.1 bits (144),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR P A  S +  NEV KT+QSE +DSSSQDWKA+L +P PDTRY+T
Sbjct  9    WLRRIPIATDSPA--NEVEKTVQSEVVDSSSQDWKAQLRVPPPDTRYKT  55



>gb|KJB09834.1| hypothetical protein B456_001G169800 [Gossypium raimondii]
 gb|KJB09835.1| hypothetical protein B456_001G169800 [Gossypium raimondii]
Length=499

 Score =   135 bits (340),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 59.3 bits (142),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN   +    S  +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  67   WLRRNQLPSGNDSSVIDEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  116



>ref|XP_002271357.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
Length=480

 Score =   134 bits (338),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  98   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  157

Query  634  AAFCI  648
            AAFCI
Sbjct  158  AAFCI  162


 Score = 59.7 bits (143),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR P A  S +  NEV KT+QSE +DSSSQDWKA+L +P PDTRY+T
Sbjct  51   WLRRIPIATDSPA--NEVEKTVQSEVVDSSSQDWKAQLRVPPPDTRYKT  97



>ref|XP_002511831.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF50500.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=507

 Score =   135 bits (340),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  125  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  184

Query  634  AAFCI  648
            AAFCI
Sbjct  185  AAFCI  189


 Score = 58.5 bits (140),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+     ++SS +EV KT+QSE +DS+SQDWKARL IP PDTRY+T
Sbjct  77   WLRRS-QLPPADSSVDEVEKTVQSEAVDSTSQDWKARLKIPPPDTRYKT  124



>ref|XP_006341720.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341721.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Solanum tuberosum]
Length=488

 Score =   134 bits (338),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  106  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  165

Query  634  AAFCI  648
            AAFCI
Sbjct  166  AAFCI  170


 Score = 59.7 bits (143),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    AS+S+ +EV KT+QSE +D SSQDWKARL IP  DTRYRT
Sbjct  59   WLRRN--QLASDSTVDEVEKTVQSEAVDQSSQDWKARLKIPPADTRYRT  105



>ref|XP_003528862.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=503

 Score =   135 bits (341),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  121  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  180

Query  634  AAFCI  648
            AAFCI
Sbjct  181  AAFCI  185


 Score = 58.5 bits (140),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 6/49 (12%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ +A       +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  78   WLRRDANAV------DEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  120



>gb|KHG12667.1| DEAD-box ATP-dependent RNA helicase 8 -like protein [Gossypium 
arboreum]
Length=493

 Score =   135 bits (339),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  111  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  170

Query  634  AAFCI  648
            AAFCI
Sbjct  171  AAFCI  175


 Score = 58.9 bits (141),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  61   WLRRNHLPGGNDSSVIDEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  110



>ref|XP_004248580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
lycopersicum]
 ref|XP_010327321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
lycopersicum]
Length=491

 Score =   134 bits (337),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  109  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  168

Query  634  AAFCI  648
            AAFCI
Sbjct  169  AAFCI  173


 Score = 59.7 bits (143),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    AS+S+ +EV KT+QSE +D SSQDWKARL IP  DTRYRT
Sbjct  62   WLRRN--QLASDSTVDEVEKTVQSEAVDQSSQDWKARLKIPPADTRYRT  108



>ref|XP_003528863.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Glycine 
max]
Length=500

 Score =   135 bits (340),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  118  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  177

Query  634  AAFCI  648
            AAFCI
Sbjct  178  AAFCI  182


 Score = 58.5 bits (140),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 6/49 (12%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ +A       +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  75   WLRRDANAV------DEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  117



>gb|KHG21932.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=493

 Score =   135 bits (339),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  111  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  170

Query  634  AAFCI  648
            AAFCI
Sbjct  171  AAFCI  175


 Score = 58.9 bits (141),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  61   WLRRNHLPGGNDSSVIDEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  110



>gb|KHG21931.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=529

 Score =   135 bits (339),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  111  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  170

Query  634  AAFCI  648
            AAFCI
Sbjct  171  AAFCI  175


 Score = 58.9 bits (141),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        S  +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  61   WLRRNHLPGGNDSSVIDEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  110



>ref|XP_002301349.1| DEAD/DEAH box helicase family protein [Populus trichocarpa]
 gb|EEE80622.1| DEAD/DEAH box helicase family protein [Populus trichocarpa]
Length=499

 Score =   133 bits (335),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/65 (95%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGN+FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNDFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFC+
Sbjct  177  AAFCV  181


 Score = 60.5 bits (145),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    A++SS +EV KT+QSE +DSSSQDWKA+L IP  DTRYRT
Sbjct  69   WLRRN-QLTAADSSIDEVEKTVQSEAVDSSSQDWKAKLKIPPADTRYRT  116



>ref|XP_011023369.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Populus 
euphratica]
 ref|XP_011023370.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Populus 
euphratica]
Length=500

 Score =   133 bits (335),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/65 (95%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGN+FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  118  EDVTATKGNDFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  177

Query  634  AAFCI  648
            AAFC+
Sbjct  178  AAFCV  182


 Score = 60.1 bits (144),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    A++S+ +EV KT+QSE +DSSSQDWKA+L IP  DTRYRT
Sbjct  70   WLRRN-QLTAADSNVDEVEKTVQSEAVDSSSQDWKAKLKIPPADTRYRT  117



>emb|CDP09769.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   134 bits (338),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  122  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  181

Query  634  AAFCI  648
            AAFCI
Sbjct  182  AAFCI  186


 Score = 58.5 bits (140),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            W+RRNPS   S+SS NEV KT+Q    DS SQDWKARL +P PDTRY+T
Sbjct  73   WMRRNPSGTPSDSSVNEVEKTVQPVNPDSGSQDWKARLKLPPPDTRYKT  121



>gb|KDP28654.1| hypothetical protein JCGZ_14425 [Jatropha curcas]
Length=500

 Score =   135 bits (341),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  118  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  177

Query  634  AAFCI  648
            AAFCI
Sbjct  178  AAFCI  182


 Score = 57.8 bits (138),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+    A++SS +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  70   WLRRS-QLPAADSSVDEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  117



>emb|CDP08841.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   134 bits (337),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  106  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  165

Query  634  AAFCI  648
            AAFCI
Sbjct  166  AAFCI  170


 Score = 59.3 bits (142),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR      S+S+  EV KTIQSEG+DSSSQDWKA+L IP  DTRY+T
Sbjct  59   WLRRT--QLGSDSAVEEVEKTIQSEGVDSSSQDWKAKLKIPPADTRYKT  105



>gb|KHF99913.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
 gb|KHF99914.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=495

 Score =   135 bits (340),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 57.8 bits (138),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        + ++EV KT+QSE +DSSSQDWKARL +P  DTRY+T
Sbjct  63   WLRRNQLPGGNDSTVADEVEKTVQSEAVDSSSQDWKARLKLPPSDTRYKT  112



>gb|EYU29737.1| hypothetical protein MIMGU_mgv1a005117mg [Erythranthe guttata]
Length=496

 Score =   134 bits (337),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  114  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  173

Query  634  AAFCI  648
            AAFCI
Sbjct  174  AAFCI  178


 Score = 58.9 bits (141),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            W+RRNPSA+A   S NEV KT+QSE I S+S+DWKA L IP  D R+RT
Sbjct  65   WMRRNPSASAVSDSYNEVEKTVQSEAIGSTSEDWKAGLRIPPADNRFRT  113



>ref|XP_006576348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X3 [Glycine max]
Length=499

 Score =   135 bits (340),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 57.4 bits (137),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE +DSSSQDWKARL IP  DTRYRT
Sbjct  83   DEVEKTVQSEAVDSSSQDWKARLKIPPADTRYRT  116



>ref|XP_006576347.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=502

 Score =   135 bits (339),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  120  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  179

Query  634  AAFCI  648
            AAFCI
Sbjct  180  AAFCI  184


 Score = 57.4 bits (137),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 6/49 (12%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ +A       +EV KT+QSE +DSSSQDWKARL IP  DTRYRT
Sbjct  77   WLRRDANAV------DEVEKTVQSEPMDSSSQDWKARLKIPPADTRYRT  119



>ref|XP_010540276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Tarenaya hassleriana]
 ref|XP_010540277.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Tarenaya hassleriana]
Length=497

 Score =   134 bits (338),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  115  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  174

Query  634  AAFCI  648
            AAFCI
Sbjct  175  AAFCI  179


 Score = 57.8 bits (138),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaas-esssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR      +   + +EV KT+QSE IDS+SQDWKARL +P PDTRY+T
Sbjct  65   WLRRAQFTGGNNGDAVDEVEKTVQSEAIDSNSQDWKARLKLPQPDTRYKT  114



>ref|XP_008794179.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794180.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
Length=482

 Score =   135 bits (339),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  100  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  159

Query  634  AAFCI  648
            AAFCI
Sbjct  160  AAFCI  164


 Score = 57.4 bits (137),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+     ++S ++EV+K++QS  IDSSSQDWKA+LN+P PD RY+T
Sbjct  53   WLRRH--QLGNDSGTSEVMKSVQSASIDSSSQDWKAQLNVPPPDMRYKT  99



>gb|KHN04659.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=484

 Score =   135 bits (340),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  102  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  161

Query  634  AAFCI  648
            AAFCI
Sbjct  162  AAFCI  166


 Score = 56.6 bits (135),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  68   DEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  101



>gb|KHN04661.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=484

 Score =   135 bits (340),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  102  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  161

Query  634  AAFCI  648
            AAFCI
Sbjct  162  AAFCI  166


 Score = 56.6 bits (135),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  68   DEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  101



>gb|KJB14857.1| hypothetical protein B456_002G146500 [Gossypium raimondii]
Length=193

 Score =   136 bits (342),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEE+IPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEENIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 55.8 bits (133),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        + ++EV KT+QSE +DSSSQDWKARL +P  +TRY+T
Sbjct  63   WLRRNQLPGGNDSTVADEVEKTVQSEAVDSSSQDWKARLKMPLSNTRYKT  112



>ref|XP_003521117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=499

 Score =   135 bits (340),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 56.2 bits (134),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  83   DEVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  116



>gb|KJB14858.1| hypothetical protein B456_002G146500 [Gossypium raimondii]
Length=198

 Score =   135 bits (341),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEE+IPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEENIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 55.8 bits (133),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        + ++EV KT+QSE +DSSSQDWKARL +P  +TRY+T
Sbjct  63   WLRRNQLPGGNDSTVADEVEKTVQSEAVDSSSQDWKARLKMPLSNTRYKT  112



>ref|XP_006339542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
tuberosum]
Length=497

 Score =   133 bits (335),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  115  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  174

Query  634  AAFCI  648
            A+FCI
Sbjct  175  ASFCI  179


 Score = 57.4 bits (137),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    +++S+  EV K +QSE +D SSQ+WKARL IP PDTRYRT
Sbjct  67   WLRRN-QLPSADSTVAEVEKNVQSEAVDQSSQEWKARLKIPLPDTRYRT  114



>ref|XP_006396262.1| hypothetical protein EUTSA_v10028588mg [Eutrema salsugineum]
 gb|ESQ37715.1| hypothetical protein EUTSA_v10028588mg [Eutrema salsugineum]
Length=512

 Score =   133 bits (334),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  130  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  189

Query  634  AAFCI  648
            AAFCI
Sbjct  190  AAFCI  194


 Score = 57.8 bits (138),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+QSE ID++S+DWKARL +PAPDTRYRT
Sbjct  97   EVEKTVQSEAIDTNSEDWKARLKLPAPDTRYRT  129



>gb|EYU32082.1| hypothetical protein MIMGU_mgv1a005052mg [Erythranthe guttata]
Length=499

 Score =   134 bits (337),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 57.0 bits (136),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN      +S+ +EV KT+QSE +DSSSQDWK RL +P  DTRYRT
Sbjct  69   WLRRN-QLPPVDSAVDEVEKTVQSEAVDSSSQDWKGRLKLPPVDTRYRT  116



>gb|KDO86092.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
 gb|KDO86093.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
Length=485

 Score =   134 bits (336),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  112  EDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  171

Query  634  AAFCI  648
            AAFCI
Sbjct  172  AAFCI  176


 Score = 57.0 bits (136),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEG-IDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    A  S  +EV KT+QSE  +D SSQDWKARL IP  DTRYRT
Sbjct  62   WLRRNNFPGADSSIVDEVEKTVQSEAAVDPSSQDWKARLKIPPADTRYRT  111



>emb|CAA09199.1| RNA helicase [Arabidopsis thaliana]
Length=505

 Score =   133 bits (334),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  123  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  182

Query  634  AAFCI  648
            AAFCI
Sbjct  183  AAFCI  187


 Score = 57.8 bits (138),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRN--PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR   P   ++  +  EV KT+QSE ID +S+DWKARL +PAPDTRYRT
Sbjct  72   WLRRGQIPGGNSNGDAVVEVEKTVQSEVIDPNSEDWKARLKLPAPDTRYRT  122



>ref|NP_191975.2| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 ref|NP_849535.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 sp|Q8RXK6.1|RH8_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis 
thaliana]
 gb|AAL87312.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAM45033.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AEE81915.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 gb|AEE81916.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
Length=505

 Score =   133 bits (334),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  123  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  182

Query  634  AAFCI  648
            AAFCI
Sbjct  183  AAFCI  187


 Score = 57.8 bits (138),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRN--PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR   P   ++  +  EV KT+QSE ID +S+DWKARL +PAPDTRYRT
Sbjct  72   WLRRGQIPGGNSNGDAVVEVEKTVQSEVIDPNSEDWKARLKLPAPDTRYRT  122



>gb|AAC13628.1| similar to ATP-dependent RNA helicases [Arabidopsis thaliana]
 emb|CAB80875.1| putative RNA helicase [Arabidopsis thaliana]
Length=499

 Score =   132 bits (333),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  123  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  182

Query  634  AAFCI  648
            AAFCI
Sbjct  183  AAFCI  187


 Score = 58.2 bits (139),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRN--PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR   P   ++  +  EV KT+QSE ID +S+DWKARL +PAPDTRYRT
Sbjct  72   WLRRGQIPGGNSNGDAVVEVEKTVQSEVIDPNSEDWKARLKLPAPDTRYRT  122



>gb|KJB14859.1| hypothetical protein B456_002G146500 [Gossypium raimondii]
Length=209

 Score =   135 bits (339),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEE+IPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEENIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 55.5 bits (132),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        + ++EV KT+QSE +DSSSQDWKARL +P  +TRY+T
Sbjct  63   WLRRNQLPGGNDSTVADEVEKTVQSEAVDSSSQDWKARLKMPLSNTRYKT  112



>ref|XP_010544383.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Tarenaya 
hassleriana]
Length=512

 Score =   135 bits (339),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  130  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  189

Query  634  AAFCI  648
            AAFCI
Sbjct  190  AAFCI  194


 Score = 55.8 bits (133),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE ID +SQDWKARL +P PDTRYRT
Sbjct  96   DEVEKTVQSEAIDLNSQDWKARLKLPPPDTRYRT  129



>ref|XP_006445089.1| hypothetical protein CICLE_v10019858mg [Citrus clementina]
 ref|XP_006491063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Citrus 
sinensis]
 gb|ESR58329.1| hypothetical protein CICLE_v10019858mg [Citrus clementina]
 gb|KDO86090.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
 gb|KDO86091.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
Length=494

 Score =   133 bits (335),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  112  EDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  171

Query  634  AAFCI  648
            AAFCI
Sbjct  172  AAFCI  176


 Score = 57.0 bits (136),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEG-IDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    A  S  +EV KT+QSE  +D SSQDWKARL IP  DTRYRT
Sbjct  62   WLRRNNFPGADSSIVDEVEKTVQSEAAVDPSSQDWKARLKIPPADTRYRT  111



>ref|XP_008353991.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Malus 
domestica]
Length=496

 Score =   135 bits (340),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  126  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  185

Query  634  AAFCI  648
            AAFCI
Sbjct  186  AAFCI  190


 Score = 55.1 bits (131),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRN--PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR     + +++S+ +EV KT+QSE +D SSQDWKARL IP  DTR+RT
Sbjct  75   WLRRGQLGGSTSADSAVDEVEKTVQSEAVDPSSQDWKARLKIPPADTRFRT  125



>ref|XP_004306806.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Fragaria vesca 
subsp. vesca]
Length=510

 Score =   135 bits (340),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  128  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  187

Query  634  AAFCI  648
            AAFCI
Sbjct  188  AAFCI  192


 Score = 55.1 bits (131),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRN--PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR     + +++S+ +EV KT+QSE +D SSQDWKARL IP  DTR+RT
Sbjct  77   WLRRGQLGGSTSADSAVDEVEKTVQSEAVDPSSQDWKARLKIPPADTRFRT  127



>ref|XP_004229903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Solanum lycopersicum]
Length=498

 Score =   133 bits (335),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  116  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  175

Query  634  AAFCI  648
            A+FCI
Sbjct  176  ASFCI  180


 Score = 56.6 bits (135),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    + +S+  EV K +QSE +D SSQ+WKARL IP PDTRYRT
Sbjct  68   WLRRN-QLPSPDSTVAEVEKNVQSEAVDQSSQEWKARLKIPQPDTRYRT  115



>gb|KJB70004.1| hypothetical protein B456_011G052700 [Gossypium raimondii]
Length=198

 Score =   135 bits (339),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEE IPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEERIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 54.7 bits (130),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        +  +EV KT+QSE  DSSSQDWKARL +P  DTRY+T
Sbjct  63   WLRRNQLPGGNDSTVVDEVEKTVQSEAGDSSSQDWKARLKMPPSDTRYKT  112



>ref|XP_004510805.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cicer 
arietinum]
Length=530

 Score =   136 bits (342),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  148  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  207

Query  634  AAFCI  648
            AAFCI
Sbjct  208  AAFCI  212


 Score = 53.5 bits (127),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaases-ssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR     +  +   +EV KT+QSE  D SSQ+WKARL IP PDTRYRT
Sbjct  98   WLRRAQLGGSESNNVVDEVEKTVQSEVADPSSQEWKARLKIPPPDTRYRT  147



>gb|KHN27313.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=499

 Score =   135 bits (340),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 53.9 bits (128),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            + V KT+QSE +DSSSQDWKARL IP  DTRY+T
Sbjct  83   DAVEKTVQSEAVDSSSQDWKARLKIPPADTRYKT  116



>ref|XP_008778709.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Phoenix dactylifera]
 ref|XP_008778717.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Phoenix dactylifera]
Length=488

 Score =   134 bits (338),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  106  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  165

Query  634  AAFCI  648
            AAFCI
Sbjct  166  AAFCI  170


 Score = 54.7 bits (130),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    ++  +S    K++QS+ +DSSSQDWKARL IP PDTRY T
Sbjct  58   WLRRN-QMGSNSGNSEAAAKSVQSDAVDSSSQDWKARLKIPPPDTRYMT  105



>gb|KJB70003.1| hypothetical protein B456_011G052700 [Gossypium raimondii]
Length=209

 Score =   134 bits (337),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEE IPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEERIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 54.7 bits (130),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN        +  +EV KT+QSE  DSSSQDWKARL +P  DTRY+T
Sbjct  63   WLRRNQLPGGNDSTVVDEVEKTVQSEAGDSSSQDWKARLKMPPSDTRYKT  112



>ref|XP_006287568.1| hypothetical protein CARUB_v10000779mg [Capsella rubella]
 gb|EOA20466.1| hypothetical protein CARUB_v10000779mg [Capsella rubella]
Length=502

 Score =   132 bits (333),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  120  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  179

Query  634  AAFCI  648
            AAFCI
Sbjct  180  AAFCI  184


 Score = 55.5 bits (132),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = +3

Query  309  WLRRN---PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR    P   ++  +  EV KT+QSE ID +S+DWKARL +PAPDTR+RT
Sbjct  68   WLRRAQIPPGGNSNGDAVVEVEKTVQSEVIDPNSEDWKARLKLPAPDTRFRT  119



>ref|XP_006587858.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=504

 Score =   134 bits (337),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEE IPIALTGSDILARAKNGTGKT
Sbjct  122  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEECIPIALTGSDILARAKNGTGKT  181

Query  634  AAFCI  648
            AAFCI
Sbjct  182  AAFCI  186


 Score = 53.9 bits (128),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaases-ssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLR++  +  + +    EV KT+QSE I+SSSQDWKARLNIP PDT ++T
Sbjct  72   WLRKDQLSGGTNTNVVEEVEKTMQSEAINSSSQDWKARLNIPPPDTCHKT  121



>ref|XP_002875020.1| hypothetical protein ARALYDRAFT_490504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51279.1| hypothetical protein ARALYDRAFT_490504 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   132 bits (333),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  125  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  184

Query  634  AAFCI  648
            AAFCI
Sbjct  185  AAFCI  189


 Score = 55.1 bits (131),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+QSE ID +S+DWKARL +PAPDTRYRT
Sbjct  92   EVEKTVQSEVIDPNSEDWKARLKLPAPDTRYRT  124



>gb|ABG66173.1| ATP-dependent RNA helicase ste13, putative, expressed [Oryza 
sativa Japonica Group]
Length=474

 Score =   134 bits (337),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  139  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  198

Query  634  AAFCI  648
            AAFCI
Sbjct  199  AAFCI  203


 Score = 53.5 bits (127),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ + AA+ S         Q E +DSSS+DWKA+LN+PAPDTRYRT
Sbjct  90   WLRRDQATAAAASGEVAARTAAQLEAVDSSSEDWKAQLNLPAPDTRYRT  138



>ref|XP_006587857.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=539

 Score =   134 bits (336),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEE IPIALTGSDILARAKNGTGKT
Sbjct  157  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEECIPIALTGSDILARAKNGTGKT  216

Query  634  AAFCI  648
            AAFCI
Sbjct  217  AAFCI  221


 Score = 53.9 bits (128),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaases-ssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLR++  +  + +    EV KT+QSE I+SSSQDWKARLNIP PDT ++T
Sbjct  107  WLRKDQLSGGTNTNVVEEVEKTMQSEAINSSSQDWKARLNIPPPDTCHKT  156



>gb|EEC67267.1| hypothetical protein OsI_34232 [Oryza sativa Indica Group]
Length=524

 Score =   134 bits (337),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  142  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  201

Query  634  AAFCI  648
            AAFCI
Sbjct  202  AAFCI  206


 Score = 53.5 bits (127),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ + AA+ S         Q E +DSSS+DWKA+LN+PAPDTRYRT
Sbjct  93   WLRRDQATAAAASGEVAARTAAQLEAVDSSSEDWKAQLNLPAPDTRYRT  141



>sp|Q109G2.2|RH12_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 12 [Oryza sativa 
Japonica Group]
 gb|AAG13612.1|AC078840_3 putative RNA helicase [Oryza sativa Japonica Group]
 gb|ABB47852.2| ATP-dependent RNA helicase ste13, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG93281.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51233.1| hypothetical protein OsJ_32082 [Oryza sativa Japonica Group]
Length=521

 Score =   134 bits (337),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  139  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  198

Query  634  AAFCI  648
            AAFCI
Sbjct  199  AAFCI  203


 Score = 53.5 bits (127),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ + AA+ S         Q E +DSSS+DWKA+LN+PAPDTRYRT
Sbjct  90   WLRRDQATAAAASGEVAARTAAQLEAVDSSSEDWKAQLNLPAPDTRYRT  138



>ref|NP_001065000.2| Os10g0503700 [Oryza sativa Japonica Group]
 dbj|BAF26914.2| Os10g0503700 [Oryza sativa Japonica Group]
Length=521

 Score =   134 bits (337),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  139  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  198

Query  634  AAFCI  648
            AAFCI
Sbjct  199  AAFCI  203


 Score = 53.5 bits (127),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ + AA+ S         Q E +DSSS+DWKA+LN+PAPDTRYRT
Sbjct  90   WLRRDQATAAAASGEVAARTAAQLEAVDSSSEDWKAQLNLPAPDTRYRT  138



>ref|XP_010424044.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Camelina 
sativa]
Length=455

 Score =   133 bits (335),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  121  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  180

Query  634  AAFCI  648
            AAFCI
Sbjct  181  AAFCI  185


 Score = 54.3 bits (129),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+QSE ID +S+DWKA+L +PAPDTRYRT
Sbjct  88   EVEKTVQSEVIDPNSEDWKAKLKLPAPDTRYRT  120



>tpg|DAA49387.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=461

 Score =   134 bits (337),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  121  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  180

Query  634  AAFCI  648
            AAFCI
Sbjct  181  AAFCI  185


 Score = 53.1 bits (126),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPsaaase-sssNEVLKTI-QSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+   A +   S N V KT  Q + +DSSSQDWKA+LNIPAPDTRYRT
Sbjct  70   WLRRDQGPAVAGPVSGNAVPKTAPQLDAVDSSSQDWKAQLNIPAPDTRYRT  120



>ref|XP_011091933.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
8 [Sesamum indicum]
Length=492

 Score =   131 bits (329),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  172

Query  634  AAFC  645
            A FC
Sbjct  173  ATFC  176


 Score = 56.2 bits (134),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN     ++S+ +EV KT+QSE ++SSSQDWK RL +P  DTRYRT
Sbjct  65   WLRRN-QLPHTDSTVDEVEKTVQSEAVESSSQDWKGRLKLPPADTRYRT  112



>ref|XP_006848084.1| hypothetical protein AMTR_s00029p00205680 [Amborella trichopoda]
 gb|ERN09665.1| hypothetical protein AMTR_s00029p00205680 [Amborella trichopoda]
Length=468

 Score =   135 bits (339),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  86   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  145

Query  634  AAFCI  648
            AAFCI
Sbjct  146  AAFCI  150


 Score = 52.4 bits (124),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            W+RRN S+   + + NE  K +QSE +D SSQDWKA+L IP  DTRY+T
Sbjct  37   WMRRNESSPIEDGNQNEEEKRVQSEVVDPSSQDWKAQLKIPPVDTRYKT  85



>ref|NP_001140760.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
 gb|ACF84564.1| unknown [Zea mays]
 gb|ACG33781.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 gb|AFW68449.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=499

 Score =   134 bits (337),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            AAFCI
Sbjct  177  AAFCI  181


 Score = 53.1 bits (126),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPs-aaasesssNEVLKTI-QSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ + A A  +S N V KT  Q + + SSSQDWKA+LNIPAPDTRYRT
Sbjct  66   WLRRDQAPAVAGAASGNAVAKTASQLDAVGSSSQDWKAQLNIPAPDTRYRT  116



>gb|AES80120.2| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=523

 Score =   131 bits (329),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  141  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  200

Query  634  AAFCI  648
            AAF I
Sbjct  201  AAFSI  205


 Score = 56.2 bits (134),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaases-ssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN     +++    EV KT+QSE  D SSQDWKARL IPA DTRYRT
Sbjct  91   WLRRNQLGGGTDTNVVEEVEKTVQSETNDPSSQDWKARLKIPAADTRYRT  140



>gb|AAX95709.1| DEAD/DEAH box helicase, putative [Oryza sativa Japonica Group]
Length=532

 Score =   134 bits (336),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  139  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  198

Query  634  AAFCI  648
            AAFCI
Sbjct  199  AAFCI  203


 Score = 53.1 bits (126),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ + AA+ S         Q E +DSSS+DWKA+LN+PAPDTRYRT
Sbjct  90   WLRRDQATAAAASGEVAARTAAQLEAVDSSSEDWKAQLNLPAPDTRYRT  138



>ref|XP_010466626.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Camelina 
sativa]
Length=484

 Score =   133 bits (334),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  122  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  181

Query  634  AAFCI  648
            AAFCI
Sbjct  182  AAFCI  186


 Score = 54.3 bits (129),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+QSE ID +S+DWKA+L +PAPDTRYRT
Sbjct  89   EVEKTVQSEVIDPNSEDWKAKLKLPAPDTRYRT  121



>ref|NP_001150170.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 ref|XP_008677767.1| PREDICTED: ATP-dependent RNA helicase dhh1 isoform X1 [Zea mays]
 gb|ACG38116.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 tpg|DAA49386.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=503

 Score =   134 bits (337),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  121  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  180

Query  634  AAFCI  648
            AAFCI
Sbjct  181  AAFCI  185


 Score = 53.1 bits (126),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPsaaase-sssNEVLKTI-QSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+   A +   S N V KT  Q + +DSSSQDWKA+LNIPAPDTRYRT
Sbjct  70   WLRRDQGPAVAGPVSGNAVPKTAPQLDAVDSSSQDWKAQLNIPAPDTRYRT  120



>gb|EPS57204.1| hypothetical protein M569_17616, partial [Genlisea aurea]
Length=409

 Score =   135 bits (339),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  107  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  166

Query  634  AAFCI  648
            AAFCI
Sbjct  167  AAFCI  171


 Score = 52.4 bits (124),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV K++QSE IDSSS DWK++L +P PDTRY+T
Sbjct  73   DEVEKSVQSEAIDSSSHDWKSQLKLPPPDTRYKT  106



>ref|XP_010456256.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Camelina sativa]
Length=503

 Score =   133 bits (334),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  121  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  180

Query  634  AAFCI  648
            AAFCI
Sbjct  181  AAFCI  185


 Score = 54.3 bits (129),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+QSE ID +S+DWKA+L +PAPDTRYRT
Sbjct  88   EVEKTVQSEVIDPNSEDWKAKLKLPAPDTRYRT  120



>ref|XP_003623900.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES80118.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=514

 Score =   131 bits (329),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  132  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  191

Query  634  AAFCI  648
            AAF I
Sbjct  192  AAFSI  196


 Score = 55.8 bits (133),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaases-ssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN     +++    EV KT+QSE  DSSSQDWKARL +P  DTRYRT
Sbjct  82   WLRRNQLGGGTDTNVVEEVEKTVQSEANDSSSQDWKARLKLPPADTRYRT  131



>ref|XP_002464412.1| hypothetical protein SORBIDRAFT_01g017760 [Sorghum bicolor]
 gb|EER91410.1| hypothetical protein SORBIDRAFT_01g017760 [Sorghum bicolor]
Length=507

 Score =   134 bits (337),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  125  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  184

Query  634  AAFCI  648
            AAFCI
Sbjct  185  AAFCI  189


 Score = 52.8 bits (125),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  375  QSEGIDSSSQDWKARLNIPAPDTRYRT  455
            Q + IDSSSQDWKA+LNIPAPDTRYRT
Sbjct  98   QLDAIDSSSQDWKAQLNIPAPDTRYRT  124



>ref|XP_009111462.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Brassica rapa]
Length=510

 Score =   133 bits (334),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  128  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  187

Query  634  AAFCI  648
            AAFCI
Sbjct  188  AAFCI  192


 Score = 53.1 bits (126),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV K++ SE +D++S+DWKARL +PAPDTRYRT
Sbjct  95   EVEKSVLSEAVDTNSEDWKARLKLPAPDTRYRT  127



>ref|XP_004982679.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
12-like [Setaria italica]
Length=505

 Score =   134 bits (337),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  131  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  190

Query  634  AAFCI  648
            AAFCI
Sbjct  191  AAFCI  195


 Score = 52.0 bits (123),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQS-EGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+ +AA++    +   +T    + +DSSSQDWKA+LNIPAPDTRYRT
Sbjct  81   WLRRDQAAASAAGPGDAAGRTASHLDAVDSSSQDWKAQLNIPAPDTRYRT  130



>gb|EYU35077.1| hypothetical protein MIMGU_mgv1a005045mg [Erythranthe guttata]
 gb|EYU35078.1| hypothetical protein MIMGU_mgv1a005045mg [Erythranthe guttata]
Length=499

 Score =   133 bits (334),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  117  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  176

Query  634  AAFCI  648
            A+FCI
Sbjct  177  ASFCI  181


 Score = 52.4 bits (124),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE  DSSSQDWKA+L +P  DTRYRT
Sbjct  83   DEVEKTVQSEATDSSSQDWKAQLKLPPQDTRYRT  116



>emb|CDY51147.1| BnaA09g51820D [Brassica napus]
Length=496

 Score =   133 bits (334),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  114  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  173

Query  634  AAFCI  648
            AAFCI
Sbjct  174  AAFCI  178


 Score = 52.0 bits (123),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV K++ SE +D++S+DWKARL +PAPDTR+RT
Sbjct  81   EVEKSVLSEAVDTNSEDWKARLKLPAPDTRFRT  113



>ref|XP_010234885.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brachypodium 
distachyon]
Length=523

 Score =   134 bits (338),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  141  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  200

Query  634  AAFCI  648
            AAFCI
Sbjct  201  AAFCI  205


 Score = 49.7 bits (117),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  381  EGIDSSSQDWKARLNIPAPDTRYRT  455
            + +D+SSQDWKA+LNIPAPDTRYRT
Sbjct  116  DAVDTSSQDWKAQLNIPAPDTRYRT  140



>ref|XP_009400273.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400274.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   134 bits (337),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174


 Score = 49.7 bits (117),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
             EV+K++QSE  DSS QDWKA+L IP  D+RY+T
Sbjct  76   GEVMKSVQSEATDSSLQDWKAQLKIPPADSRYKT  109



>ref|XP_010940461.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Elaeis guineensis]
Length=490

 Score =   133 bits (334),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  108  EDVTGTKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  167

Query  634  AAFCI  648
            AAFCI
Sbjct  168  AAFCI  172


 Score = 50.8 bits (120),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN    ++  SS    K++Q + +DSSSQDWKA+L IP PDTRY+T
Sbjct  60   WLRRN-QMGSNSGSSAAAAKSVQPDAVDSSSQDWKAQLKIPPPDTRYKT  107



>ref|XP_008681228.1| PREDICTED: uncharacterized protein LOC100194030 isoform X2 [Zea 
mays]
 gb|ACL54546.1| unknown [Zea mays]
Length=525

 Score =   135 bits (341),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  143  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  202

Query  634  AAFCI  648
            AAFCI
Sbjct  203  AAFCI  207


 Score = 47.8 bits (112),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  378  SEGIDSSSQDWKARLNIPAPDTRYRT  455
            ++G+DSSSQDWKA+L +P PDTRYRT
Sbjct  117  ADGVDSSSQDWKAQLKLPPPDTRYRT  142



>dbj|BAJ95381.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88430.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   134 bits (338),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  142  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  201

Query  634  AAFCI  648
            AAFCI
Sbjct  202  AAFCI  206


 Score = 48.5 bits (114),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  381  EGIDSSSQDWKARLNIPAPDTRYRT  455
            + +D+SSQDWKA+LNIPAPDTR+RT
Sbjct  117  DAVDTSSQDWKAQLNIPAPDTRFRT  141



>gb|EMS59803.1| DEAD-box ATP-dependent RNA helicase 12 [Triticum urartu]
Length=478

 Score =   134 bits (337),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  129  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  188

Query  634  AAFCI  648
            AAFCI
Sbjct  189  AAFCI  193


 Score = 48.5 bits (114),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  381  EGIDSSSQDWKARLNIPAPDTRYRT  455
            + +D+SSQDWKA+LNIPAPDTR+RT
Sbjct  104  DAVDTSSQDWKAQLNIPAPDTRFRT  128



>ref|XP_002464413.1| hypothetical protein SORBIDRAFT_01g017770 [Sorghum bicolor]
 gb|EER91411.1| hypothetical protein SORBIDRAFT_01g017770 [Sorghum bicolor]
Length=507

 Score =   134 bits (337),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  125  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  184

Query  634  AAFCI  648
            AAFCI
Sbjct  185  AAFCI  189


 Score = 48.1 bits (113),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  375  QSEGIDSSSQDWKARLNIPAPDTRYRT  455
            Q + I SSS DWKA+LNIPAPDTRYRT
Sbjct  98   QLDAIGSSSHDWKAQLNIPAPDTRYRT  124



>emb|CDY07205.1| BnaCnng02200D [Brassica napus]
Length=491

 Score =   132 bits (333),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  109  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  168

Query  634  AAFCI  648
            AAFCI
Sbjct  169  AAFCI  173


 Score = 49.7 bits (117),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +V K++ S+ ID++S+DWKARL +PAPDTR+RT
Sbjct  76   QVEKSVLSQAIDTNSEDWKARLQLPAPDTRFRT  108



>gb|EAY94957.1| hypothetical protein OsI_16765 [Oryza sativa Indica Group]
Length=484

 Score =   135 bits (341),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  102  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  161

Query  634  AAFCI  648
            AAFCI
Sbjct  162  AAFCI  166


 Score = 47.0 bits (110),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN  AA +  +S +    + ++GIDSSSQDWKA+L +P  DTRYRT
Sbjct  54   WLRRNQIAAEAAGASEQKAPPV-ADGIDSSSQDWKAQLKLPPQDTRYRT  101



>ref|XP_011093152.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
8-like [Sesamum indicum]
Length=489

 Score =   125 bits (314),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/61 (98%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  109  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  168

Query  634  A  636
            A
Sbjct  169  A  169


 Score = 56.6 bits (135),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR    ++++S+ +EV KT+QSE IDS SQDWKARL +P  DTRY+T
Sbjct  61   WLRR-AQLSSADSAVDEVEKTVQSEAIDSGSQDWKARLKLPPADTRYKT  108



>ref|NP_001053408.1| Os04g0533000 [Oryza sativa Japonica Group]
 sp|Q7XMK8.1|RH6_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 6 [Oryza sativa 
Japonica Group]
 emb|CAE04571.1| OSJNBb0039L24.10 [Oryza sativa Japonica Group]
 dbj|BAF15322.1| Os04g0533000 [Oryza sativa Japonica Group]
 gb|EAZ31443.1| hypothetical protein OsJ_15580 [Oryza sativa Japonica Group]
 dbj|BAG92597.1| unnamed protein product [Oryza sativa Japonica Group]
Length=498

 Score =   134 bits (338),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  116  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  175

Query  634  AAFCI  648
            AAFCI
Sbjct  176  AAFCI  180


 Score = 47.0 bits (110),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN  AA +  +S +    + ++GIDSSSQDWKA+L +P  DTRYRT
Sbjct  68   WLRRNQIAAEAAGASEQKAPPV-ADGIDSSSQDWKAQLKLPPQDTRYRT  115



>ref|XP_009384494.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   133 bits (334),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGS+ILARAKNGTGKT
Sbjct  106  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSNILARAKNGTGKT  165

Query  634  AAFCI  648
            AAFCI
Sbjct  166  AAFCI  170


 Score = 48.5 bits (114),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGI---DSSSQDWKARLNIPAPDTRYRT  455
            W RRN      +S   EV+K +QS+ +   DSSSQDWKA L IP  DTRYRT
Sbjct  56   WSRRN--QMGGDSGVGEVVKAVQSDAVTLMDSSSQDWKALLKIPPSDTRYRT  105



>ref|XP_006662493.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Oryza 
brachyantha]
Length=510

 Score =   135 bits (340),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  128  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  187

Query  634  AAFCI  648
            AAFCI
Sbjct  188  AAFCI  192


 Score = 45.8 bits (107),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN ++AA    +           +DSSS+DWK++LN+PAPDTRY+T
Sbjct  79   WLRRNQASAAEPGEAAARTAAQLDAVVDSSSEDWKSQLNLPAPDTRYKT  127



>gb|EPS67203.1| hypothetical protein M569_07571 [Genlisea aurea]
Length=492

 Score =   135 bits (339),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174


 Score = 46.2 bits (108),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE  +S  Q WKA LN+P  DTRYRT
Sbjct  76   DEVEKTVQSEATESKLQGWKAELNLPPKDTRYRT  109



>ref|XP_009408278.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   133 bits (335),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174


 Score = 47.8 bits (112),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            W RRN      +S S EV+K++Q E  D+S QDWKA+L +P PDTRY+T
Sbjct  63   WSRRN--QLGGDSGSGEVVKSVQPETSDTSLQDWKAQLKMPPPDTRYKT  109



>ref|XP_004953257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Setaria 
italica]
Length=517

 Score =   135 bits (340),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  135  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  194

Query  634  AAFCI  648
            AAFCI
Sbjct  195  AAFCI  199


 Score = 45.1 bits (105),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +3

Query  309  WLRRNPsaaasesssN-----EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN  A  +  ++       +  +  ++G+DSSSQDWKA+L +P  DTRYRT
Sbjct  81   WLRRNQIAREAAGAAGTSEPKALAPSTAADGVDSSSQDWKAQLKLPPQDTRYRT  134



>ref|XP_003623903.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES80121.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=516

 Score =   131 bits (329),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  134  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  193

Query  634  AAFCI  648
            AAF I
Sbjct  194  AAFSI  198


 Score = 48.9 bits (115),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query  309  WLRRNPsaaases-ssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN     +++    EV KT+QSE  D SSQDWK +L +P  DTRYRT
Sbjct  84   WLRRNQLGGGTDTNVVEEVEKTVQSETNDPSSQDWKEKLKLPPADTRYRT  133



>sp|Q6H7S2.2|RH8_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 8 [Oryza sativa 
Japonica Group]
 dbj|BAD25226.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAG92832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57460.1| hypothetical protein OsJ_07688 [Oryza sativa Japonica Group]
Length=508

 Score =   135 bits (340),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  126  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  185

Query  634  AAFCI  648
            AAFCI
Sbjct  186  AAFCI  190


 Score = 45.1 bits (105),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 5/54 (9%)
 Frame = +3

Query  309  WLRRNPsaaasesss-----NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN  A  +  +        V ++   +GIDSSSQDWKA+L +P  DTRYRT
Sbjct  72   WLRRNQIAREAAGTDRNSEPKAVAQSPAVDGIDSSSQDWKAQLKLPPQDTRYRT  125



>ref|XP_010676491.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676492.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=523

 Score =   135 bits (340),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  141  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  200

Query  634  AAFCI  648
            AAFCI
Sbjct  201  AAFCI  205


 Score = 44.7 bits (104),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  354  NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            N+V K+ Q+  +DSS++DWKA L +P PDTRY+T
Sbjct  107  NQVEKSNQTTNVDSSAEDWKASLKLPPPDTRYQT  140



>ref|XP_006652567.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
6-like [Oryza brachyantha]
Length=507

 Score =   135 bits (339),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  125  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  184

Query  634  AAFCI  648
            AAFCI
Sbjct  185  AAFCI  189


 Score = 45.1 bits (105),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN     +  +S +    +  +GIDSSSQDWKA+L +P  DTRYRT
Sbjct  77   WLRRNQITNEAAGASEQKAPPV-PDGIDSSSQDWKAQLKLPPQDTRYRT  124



>ref|XP_008391229.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Malus 
domestica]
Length=370

 Score =   135 bits (340),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  42   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  101

Query  634  AAFCI  648
            AAFCI
Sbjct  102  AAFCI  106


 Score = 44.3 bits (103),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +3

Query  387  IDSSSQDWKARLNIPAPDTRYRT  455
            I  SSQDWKARL IPAPDTR+RT
Sbjct  19   ILFSSQDWKARLKIPAPDTRFRT  41



>ref|XP_009389244.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   134 bits (338),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  104  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  163

Query  634  AAFCI  648
            AAFCI
Sbjct  164  AAFCI  168


 Score = 45.1 bits (105),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            W RRN      +  + +++K++QSE  ++S QDWKA+L +  PDTRY+T
Sbjct  57   WSRRN--QLGGDFGAGQIVKSVQSEATNTSLQDWKAQLKMAPPDTRYKT  103



>gb|EMT21677.1| DEAD-box ATP-dependent RNA helicase 12 [Aegilops tauschii]
Length=515

 Score =   135 bits (340),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  133  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  192

Query  634  AAFCI  648
            AAFCI
Sbjct  193  AAFCI  197


 Score = 44.3 bits (103),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  396  SSQDWKARLNIPAPDTRYRT  455
            SSQDWKA+LNIPAPDTR+RT
Sbjct  113  SSQDWKAQLNIPAPDTRFRT  132



>ref|XP_003580213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Brachypodium 
distachyon]
Length=495

 Score =   134 bits (338),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 44.7 bits (104),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  378  SEGIDSSSQDWKARLNIPAPDTRYRT  455
            ++GIDSSSQDWK +L +P PDTRY+T
Sbjct  87   TDGIDSSSQDWKTQLKLPPPDTRYQT  112



>ref|NP_001047552.1| Os02g0641800 [Oryza sativa Japonica Group]
 dbj|BAD25227.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF09466.1| Os02g0641800 [Oryza sativa Japonica Group]
 gb|EEC73681.1| hypothetical protein OsI_08237 [Oryza sativa Indica Group]
Length=483

 Score =   134 bits (338),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  101  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  160

Query  634  AAFCI  648
            AAFCI
Sbjct  161  AAFCI  165


 Score = 45.1 bits (105),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 5/54 (9%)
 Frame = +3

Query  309  WLRRNPsaaasesss-----NEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN  A  +  +        V ++   +GIDSSSQDWKA+L +P  DTRYRT
Sbjct  47   WLRRNQIAREAAGTDRNSEPKAVAQSPAVDGIDSSSQDWKAQLKLPPQDTRYRT  100



>gb|ACG29146.1| ATP-dependent RNA helicase dhh1 [Zea mays]
Length=517

 Score =   135 bits (340),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  135  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  194

Query  634  AAFCI  648
            AAFCI
Sbjct  195  AAFCI  199


 Score = 43.9 bits (102),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +3

Query  309  WLRRN-----PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN      + AA  S    +  +  ++G++SSSQDWK +L +P PDTRYRT
Sbjct  81   WLRRNQIAREAAGAAVTSEPKALAPSTAADGVNSSSQDWKTQLKLPPPDTRYRT  134



>ref|NP_001148960.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 gb|ACG33648.1| ATP-dependent RNA helicase dhh1 [Zea mays]
Length=517

 Score =   135 bits (340),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  135  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  194

Query  634  AAFCI  648
            AAFCI
Sbjct  195  AAFCI  199


 Score = 43.9 bits (102),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +3

Query  309  WLRRN-----PsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN      + AA  S    +  +  ++G++SSSQDWK +L +P PDTRYRT
Sbjct  81   WLRRNQIAREAAGAAVTSEPKALAPSTAADGVNSSSQDWKTQLKLPPPDTRYRT  134



>ref|XP_004976343.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Setaria 
italica]
Length=501

 Score =   134 bits (338),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  119  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  178

Query  634  AAFCI  648
            AAFCI
Sbjct  179  AAFCI  183


 Score = 44.7 bits (104),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  381  EGIDSSSQDWKARLNIPAPDTRYRT  455
            +GIDSSSQDWKA+L +P  DTRYRT
Sbjct  94   DGIDSSSQDWKAQLKLPPQDTRYRT  118



>ref|XP_009134538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Brassica 
rapa]
Length=514

 Score =   132 bits (333),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  132  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  191

Query  634  AAFCI  648
            AAFCI
Sbjct  192  AAFCI  196


 Score = 45.8 bits (107),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 3/33 (9%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+ S   D++S+DWKARL +PAPDTRYRT
Sbjct  102  EVEKTVLS---DTNSEDWKARLKLPAPDTRYRT  131



>emb|CDX74342.1| BnaA03g27050D [Brassica napus]
Length=514

 Score =   132 bits (333),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  132  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  191

Query  634  AAFCI  648
            AAFCI
Sbjct  192  AAFCI  196


 Score = 45.8 bits (107),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 3/33 (9%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+ S   D++S+DWKARL +PAPDTRYRT
Sbjct  102  EVEKTVLS---DTNSEDWKARLKLPAPDTRYRT  131



>dbj|BAJ90747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   134 bits (336),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  136  EDVTATKGNEFEDYFLKRELLMGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  195

Query  634  AAFCI  648
            AAFCI
Sbjct  196  AAFCI  200


 Score = 43.5 bits (101),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN   AA  S    V     + G DSSSQDWKA+L +P  DTR+RT
Sbjct  87   WLRRNQITAAGTSGPKVVAPPPAAAGNDSSSQDWKAQLKLPPADTRFRT  135



>emb|CDX91901.1| BnaC03g32030D [Brassica napus]
Length=501

 Score =   133 bits (335),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  442  HVIGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNG  621
            H   +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTG DILARAKNG
Sbjct  115  HYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNG  174

Query  622  TGKTAAFCI  648
            TGKTAAFCI
Sbjct  175  TGKTAAFCI  183


 Score = 43.9 bits (102),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 3/33 (9%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+ S   D++S+DWKARL +PAPDT YRT
Sbjct  89   EVEKTVLS---DTNSEDWKARLKLPAPDTHYRT  118



>gb|KHN27312.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=406

 Score =   136 bits (343),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/65 (100%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  24   QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  83

Query  634  AAFCI  648
            AAFCI
Sbjct  84   AAFCI  88


 Score = 40.0 bits (92),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  387  IDSSSQDWKARLNIPAPDTRY  449
            +DSSSQDWKARL IP  DTRY
Sbjct  1    MDSSSQDWKARLKIPPADTRY  21



>gb|ABR16163.1| unknown [Picea sitchensis]
Length=477

 Score =   135 bits (340),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  95   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  154

Query  634  AAFCI  648
            AAFCI
Sbjct  155  AAFCI  159


 Score = 41.2 bits (95),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  366  KTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            K +QS  +D S QDWK++L IP PD+RY+T
Sbjct  65   KRVQSGDVDPSVQDWKSQLKIPPPDSRYKT  94



>ref|XP_008681227.1| PREDICTED: uncharacterized protein LOC100194030 isoform X1 [Zea 
mays]
Length=536

 Score =   135 bits (341),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  154  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  213

Query  634  AAFCI  648
            AAFCI
Sbjct  214  AAFCI  218


 Score = 39.3 bits (90),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 11/37 (30%)
 Frame = +3

Query  378  SEGIDSS-----------SQDWKARLNIPAPDTRYRT  455
            ++G+DSS           SQDWKA+L +P PDTRYRT
Sbjct  117  ADGVDSSYTGTVLIHMCSSQDWKAQLKLPPPDTRYRT  153



>ref|XP_006827696.1| hypothetical protein AMTR_s00009p00258110 [Amborella trichopoda]
 gb|ERM95112.1| hypothetical protein AMTR_s00009p00258110 [Amborella trichopoda]
Length=459

 Score =   135 bits (339),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  77   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  136

Query  634  AAFCI  648
            AAFCI
Sbjct  137  AAFCI  141


 Score = 40.0 bits (92),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 28/49 (57%), Gaps = 9/49 (18%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRR+           E  K + SE   SSSQDWKA+L IP  D+RY+T
Sbjct  37   WLRRDQV---------EEEKRVTSEDAASSSQDWKAQLKIPPKDSRYKT  76



>gb|KJB24710.1| hypothetical protein B456_004G1574001, partial [Gossypium raimondii]
Length=243

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA
Sbjct  1    DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  60

Query  637  AFCI  648
            AFCI
Sbjct  61   AFCI  64



>dbj|BAJ94923.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   135 bits (339),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  113  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  172

Query  634  AAFCI  648
            AAFCI
Sbjct  173  AAFCI  177


 Score = 38.9 bits (89),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +3

Query  390  DSSSQDWKARLNIPAPDTRYRT  455
            D SSQDWKA+L +P PDTRY+T
Sbjct  91   DLSSQDWKAQLKLPPPDTRYQT  112



>gb|EMT23815.1| DEAD-box ATP-dependent RNA helicase 6 [Aegilops tauschii]
Length=522

 Score =   135 bits (339),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  159  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  218

Query  634  AAFCI  648
            AAFCI
Sbjct  219  AAFCI  223


 Score = 38.1 bits (87),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 3/35 (9%)
 Frame = +3

Query  360  VLKTIQSEG---IDSSSQDWKARLNIPAPDTRYRT  455
            VL+ + S G   ++  SQDWKA+L +P PDTRY+T
Sbjct  124  VLEAMCSCGCCVLNICSQDWKAQLKLPPPDTRYQT  158



>ref|XP_001765911.1| predicted protein [Physcomitrella patens]
 gb|EDQ69232.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   135 bits (339),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  24   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  83

Query  634  AAFCI  648
            AAFCI
Sbjct  84   AAFCI  88


 Score = 38.1 bits (87),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +3

Query  387  IDSSSQDWKARLNIPAPDTRYRT  455
            + SSSQDWKA+L +P PD RY+T
Sbjct  1    MSSSSQDWKAQLKLPPPDARYKT  23



>ref|XP_010908425.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Elaeis guineensis]
Length=404

 Score =   135 bits (339),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  100  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  159

Query  634  AAFCI  648
            AAFCI
Sbjct  160  AAFCI  164


 Score = 37.4 bits (85),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN      +S ++EV+K++QS+ IDSSSQDWKARL +P PDTRY+T
Sbjct  53   WLRRN--LMGGDSGTSEVVKSVQSDSIDSSSQDWKARLKVPPPDTRYKT  99



>ref|XP_010908424.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Elaeis guineensis]
Length=482

 Score =   134 bits (338),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  100  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  159

Query  634  AAFCI  648
            AAFCI
Sbjct  160  AAFCI  164


 Score = 37.4 bits (85),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN      +S ++EV+K++QS+ IDSSSQDWKARL +P PDTRY+T
Sbjct  53   WLRRN--LMGGDSGTSEVVKSVQSDSIDSSSQDWKARLKVPPPDTRYKT  99



>ref|XP_006583310.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=545

 Score =   135 bits (340),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  163  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  222

Query  634  AAFCI  648
            AAFCI
Sbjct  223  AAFCI  227


 Score = 36.6 bits (83),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  399  SQDWKARLNIPAPDTRYRT  455
            SQDWKARL IP  DTRY+T
Sbjct  144  SQDWKARLKIPPADTRYKT  162



>ref|XP_007135054.1| hypothetical protein PHAVU_010G0977000g, partial [Phaseolus vulgaris]
 gb|ESW07048.1| hypothetical protein PHAVU_010G0977000g, partial [Phaseolus vulgaris]
Length=402

 Score =   135 bits (339),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  20   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  79

Query  634  AAFCI  648
            AAFCI
Sbjct  80   AAFCI  84


 Score = 36.6 bits (83),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  399  SQDWKARLNIPAPDTRYRT  455
            SQDWKARL IP  DTRY+T
Sbjct  1    SQDWKARLKIPPADTRYKT  19



>gb|KHN14047.1| DEAD-box ATP-dependent RNA helicase 8, partial [Glycine soja]
Length=311

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  20   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  79

Query  634  AAFCI  648
            A FCI
Sbjct  80   AVFCI  84



>ref|XP_001766771.1| predicted protein [Physcomitrella patens]
 gb|EDQ68402.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   134 bits (338),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  24   EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  83

Query  634  AAFCI  648
            AAFCI
Sbjct  84   AAFCI  88


 Score = 36.2 bits (82),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  396  SSQDWKARLNIPAPDTRYRT  455
            SSQDWKA+L +P PD RY+T
Sbjct  4    SSQDWKAQLKLPPPDARYKT  23



>ref|XP_010105971.1| DEAD-box ATP-dependent RNA helicase 8 [Morus notabilis]
 gb|EXC06853.1| DEAD-box ATP-dependent RNA helicase 8 [Morus notabilis]
Length=436

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/67 (96%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +1

Query  448  IGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG  627
            + +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG
Sbjct  31   LSRDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG  90

Query  628  KTAAFCI  648
            KTAAFCI
Sbjct  91   KTAAFCI  97



>gb|KJB24711.1| hypothetical protein B456_004G1574001, partial [Gossypium raimondii]
Length=382

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA
Sbjct  1    DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  60

Query  637  AFCI  648
            AFCI
Sbjct  61   AFCI  64



>ref|XP_010905111.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Elaeis 
guineensis]
Length=492

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  110  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  169

Query  634  AAFCI  648
            AAFCI
Sbjct  170  AAFCI  174



>ref|XP_008794547.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794548.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
Length=484

 Score =   134 bits (338),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  102  EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  161

Query  634  AAFCI  648
            AAFCI
Sbjct  162  AAFCI  166


 Score = 34.7 bits (78),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  408  WKARLNIPAPDTRYRT  455
            WKA+LNIP PDTRYRT
Sbjct  86   WKAQLNIPPPDTRYRT  101



>gb|EMS61023.1| DEAD-box ATP-dependent RNA helicase 8 [Triticum urartu]
Length=356

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  22   EDVTATKGNEFEDYFLKRELLMGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  81

Query  634  AAFCI  648
            AAFCI
Sbjct  82   AAFCI  86



>gb|EMS53111.1| DEAD-box ATP-dependent RNA helicase 8 [Triticum urartu]
Length=558

 Score =   133 bits (334),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  26   EDVTATKGNEFEDYFLKRELLMGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  85

Query  634  AAFCI  648
            AAFCI
Sbjct  86   AAFCI  90


 Score = 36.2 bits (82),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  393  SSSQDWKARLNIPAPDTRYRT  455
            +SSQDWKA+L +P  DTR+RT
Sbjct  5    ASSQDWKAQLKLPPADTRFRT  25



>ref|XP_002320116.2| hypothetical protein POPTR_0014s07690g [Populus trichocarpa]
 gb|EEE98431.2| hypothetical protein POPTR_0014s07690g [Populus trichocarpa]
Length=505

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 71/83 (86%), Gaps = 6/83 (7%)
 Frame = +1

Query  400  LKIGRLD*IYQRLIHVIGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPI  579
            LKI   D  YQ       +DVTATKGN+FEDYFLKRELLMGIYEKGFERPSPIQEESIPI
Sbjct  111  LKIPPADTRYQ------TEDVTATKGNDFEDYFLKRELLMGIYEKGFERPSPIQEESIPI  164

Query  580  ALTGSDILARAKNGTGKTAAFCI  648
            ALTGSDILARAKNGTGKTAAFCI
Sbjct  165  ALTGSDILARAKNGTGKTAAFCI  187


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN   AA++SS +EV KT+QSE +DSSSQDWKA+L IP  DTRY+T
Sbjct  75   WLRRN-QLAAADSSVDEVEKTVQSEAVDSSSQDWKAKLKIPPADTRYQT  122



>gb|EMT21717.1| DEAD-box ATP-dependent RNA helicase 8 [Aegilops tauschii]
Length=426

 Score =   132 bits (332),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGIYEKGFE PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  26   EDVTATKGNEFEDYFLKRELLMGIYEKGFENPSPIQEESIPIALTGSDILARAKNGTGKT  85

Query  634  AAFCI  648
            AAFCI
Sbjct  86   AAFCI  90


 Score = 35.8 bits (81),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  393  SSSQDWKARLNIPAPDTRYRT  455
            +SSQDWKA+L +P  DTR+RT
Sbjct  5    ASSQDWKAQLKLPPADTRFRT  25



>ref|XP_004240107.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Solanum lycopersicum]
Length=487

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 71/83 (86%), Gaps = 6/83 (7%)
 Frame = +1

Query  400  LKIGRLD*IYQRLIHVIGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPI  579
            LKI  LD  Y+       +DVTATKGN+FEDYFLKRELLMGIYEKGFERPSPIQEESIPI
Sbjct  93   LKIPPLDARYR------TEDVTATKGNDFEDYFLKRELLMGIYEKGFERPSPIQEESIPI  146

Query  580  ALTGSDILARAKNGTGKTAAFCI  648
             LTGSDILARAKNGTGKTAAFCI
Sbjct  147  VLTGSDILARAKNGTGKTAAFCI  169



>ref|XP_010413440.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like isoform 
X2 [Camelina sativa]
Length=496

 Score =   127 bits (318),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  115  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  174

Query  637  AFCI  648
            AFCI
Sbjct  175  AFCI  178


 Score = 40.8 bits (94),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            W RR P    + +++NEV KT QSE   + + QDWKA L +P PDTRY+T 
Sbjct  65   WSRR-PQIPGNANNANEVQKTSQSEATSEPNGQDWKATLRLPPPDTRYQTA  114



>ref|XP_010469048.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Camelina 
sativa]
Length=500

 Score =   127 bits (318),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  119  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  178

Query  637  AFCI  648
            AFCI
Sbjct  179  AFCI  182


 Score = 40.8 bits (94),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            W RR P    + +++NEV KT QSE   + + QDWKA L +P PDTRY+T 
Sbjct  69   WSRR-PQIPGNANNANEVQKTSQSEATSEPNGQDWKATLRLPPPDTRYQTA  118



>ref|XP_010512458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Camelina sativa]
Length=502

 Score =   126 bits (317),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  121  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  180

Query  637  AFCI  648
            AFCI
Sbjct  181  AFCI  184


 Score = 40.8 bits (94),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            W RR P    + +++NEV KT QSE   + + QDWKA L +P PDTRY+T 
Sbjct  71   WSRR-PQIPGNANNANEVQKTSQSEATSEPNGQDWKATLRLPPPDTRYQTA  120



>ref|XP_002880201.1| hypothetical protein ARALYDRAFT_483719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56460.1| hypothetical protein ARALYDRAFT_483719 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   127 bits (319),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  139  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  198

Query  634  AAFCI  648
             AFCI
Sbjct  199  GAFCI  203


 Score = 40.0 bits (92),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE I DS+++DWKA L +P  D RY+T
Sbjct  104  DEVEKTVQSEAISDSNNEDWKATLKLPPRDNRYQT  138



>ref|XP_006345594.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
tuberosum]
Length=478

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 71/83 (86%), Gaps = 6/83 (7%)
 Frame = +1

Query  400  LKIGRLD*IYQRLIHVIGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPI  579
            LKI  LD  Y+       +DVTATKGN+FEDYFLKRELLMGIYEKGFERPSPIQEESIPI
Sbjct  84   LKIPPLDARYR------TEDVTATKGNDFEDYFLKRELLMGIYEKGFERPSPIQEESIPI  137

Query  580  ALTGSDILARAKNGTGKTAAFCI  648
             LTGSDILARAKNGTGKTAAFCI
Sbjct  138  VLTGSDILARAKNGTGKTAAFCI  160



>ref|XP_010413439.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like isoform 
X1 [Camelina sativa]
Length=524

 Score =   126 bits (317),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  115  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  174

Query  637  AFCI  648
            AFCI
Sbjct  175  AFCI  178


 Score = 40.8 bits (94),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            W RR P    + +++NEV KT QSE   + + QDWKA L +P PDTRY+T 
Sbjct  65   WSRR-PQIPGNANNANEVQKTSQSEATSEPNGQDWKATLRLPPPDTRYQTA  114



>ref|XP_003623902.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=586

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/67 (96%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  448  IGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG  627
            + QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG
Sbjct  202  VSQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG  261

Query  628  KTAAFCI  648
            KTAAF I
Sbjct  262  KTAAFSI  268


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  WLRRNPsaaas-esssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRTGCD  464
            WLRRN     +  +   EV KT+QSE  D SSQDWKARL IPA DTRYRT  D
Sbjct  91   WLRRNQLGGGTDTNVVEEVEKTVQSETNDPSSQDWKARLKIPAADTRYRTEVD  143



>ref|XP_002876600.1| hypothetical protein ARALYDRAFT_486601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52859.1| hypothetical protein ARALYDRAFT_486601 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   127 bits (318),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  113  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  172

Query  637  AFCI  648
            AFCI
Sbjct  173  AFCI  176


 Score = 40.4 bits (93),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 1/36 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            NEV KT Q E   D++ QDWKA L +P PDTRY+T 
Sbjct  77   NEVQKTSQPEASSDANGQDWKATLRLPPPDTRYQTA  112



>ref|NP_182105.1| DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis thaliana]
 sp|Q94BV4.2|RH6_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis 
thaliana]
 gb|AAC28543.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AEC10604.1| DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis thaliana]
Length=528

 Score =   127 bits (319),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  146  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  205

Query  634  AAFCI  648
             AFCI
Sbjct  206  GAFCI  210


 Score = 40.0 bits (92),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE I DS+++DWKA L +P  D RY+T
Sbjct  111  DEVEKTVQSEAISDSNNEDWKATLKLPPRDNRYQT  145



>ref|XP_006290970.1| hypothetical protein CARUB_v10017085mg [Capsella rubella]
 gb|EOA23868.1| hypothetical protein CARUB_v10017085mg [Capsella rubella]
Length=494

 Score =   126 bits (317),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  113  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  172

Query  637  AFCI  648
            AFCI
Sbjct  173  AFCI  176


 Score = 40.4 bits (93),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGI--DSSSQDWKARLNIPAPDTRYRTG  458
            W RR P    + S++NE+ KT QSE    D + QDWKA L +P PDTRY+T 
Sbjct  62   WSRR-PQLPGNASNANELQKTSQSEASSGDPNGQDWKATLRLPPPDTRYQTA  112



>ref|XP_006397769.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39222.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=480

 Score =   127 bits (320),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  136  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  195

Query  634  AAFCI  648
             AFCI
Sbjct  196  GAFCI  200


 Score = 38.1 bits (87),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 2/36 (6%)
 Frame = +3

Query  354  NEVLKTIQSEGI--DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE    DS++QDWKA L +P  D RY+T
Sbjct  100  DEVEKTVQSEAHTNDSNNQDWKAMLKLPPRDNRYQT  135



>ref|XP_010518223.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
 ref|XP_010518224.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
Length=519

 Score =   127 bits (320),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  137  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  196

Query  634  AAFCI  648
             AFCI
Sbjct  197  GAFCI  201


 Score = 38.5 bits (88),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE   DS++QDWKA L +P  D RY+T
Sbjct  102  DEVEKTVQSEANNDSNTQDWKATLKLPPRDERYQT  136



>ref|XP_006397770.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39223.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=487

 Score =   127 bits (320),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  136  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  195

Query  634  AAFCI  648
             AFCI
Sbjct  196  GAFCI  200


 Score = 38.1 bits (87),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 2/36 (6%)
 Frame = +3

Query  354  NEVLKTIQSEGI--DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE    DS++QDWKA L +P  D RY+T
Sbjct  100  DEVEKTVQSEAHTNDSNNQDWKAMLKLPPRDNRYQT  135



>ref|XP_011035912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Populus euphratica]
 ref|XP_011035920.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Populus euphratica]
Length=503

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 70/83 (84%), Gaps = 6/83 (7%)
 Frame = +1

Query  400  LKIGRLD*IYQRLIHVIGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPI  579
            LKI   D  YQ       +DVTATKGN+FEDYFLKRELLMGIYEKGFE PSPIQEESIPI
Sbjct  109  LKIPPADTRYQ------TEDVTATKGNDFEDYFLKRELLMGIYEKGFESPSPIQEESIPI  162

Query  580  ALTGSDILARAKNGTGKTAAFCI  648
            ALTGSDILARAKNGTGKTAAFCI
Sbjct  163  ALTGSDILARAKNGTGKTAAFCI  185


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            WLRRN   AA++SS +EV KT+QSE +DSSSQDWKA+L IP  DTRY+T
Sbjct  73   WLRRN-QLAAADSSVDEVEKTVQSEAVDSSSQDWKAKLKIPPADTRYQT  120



>ref|XP_006397771.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39224.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=518

 Score =   127 bits (320),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  136  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  195

Query  634  AAFCI  648
             AFCI
Sbjct  196  GAFCI  200


 Score = 38.1 bits (87),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 2/36 (6%)
 Frame = +3

Query  354  NEVLKTIQSEGI--DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE    DS++QDWKA L +P  D RY+T
Sbjct  100  DEVEKTVQSEAHTNDSNNQDWKAMLKLPPRDNRYQT  135



>ref|XP_010506559.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Camelina sativa]
 ref|XP_010506560.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Camelina sativa]
Length=520

 Score =   127 bits (319),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  138  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  197

Query  634  AAFCI  648
             AFCI
Sbjct  198  GAFCI  202


 Score = 38.1 bits (87),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE   DS++QDWKA L +P  D RY+T
Sbjct  103  DEVEKTVQSEANNDSNTQDWKATLKLPPRDDRYQT  137



>ref|XP_009142369.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Brassica rapa]
Length=517

 Score =   127 bits (319),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  135  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  194

Query  634  AAFCI  648
             AFCI
Sbjct  195  GAFCI  199


 Score = 38.1 bits (87),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE   DS++QDWKA L +P  D RY+T
Sbjct  100  DEVEKTVQSEANNDSNNQDWKATLKLPPRDNRYQT  134



>emb|CDY37067.1| BnaA04g26450D [Brassica napus]
Length=510

 Score =   127 bits (319),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  128  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  187

Query  634  AAFCI  648
             AFCI
Sbjct  188  GAFCI  192


 Score = 37.7 bits (86),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE   DS++QDWKA L +P  D RY+T
Sbjct  93   DEVEKTVQSEANNDSNNQDWKATLKLPPRDNRYQT  127



>ref|XP_009116788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brassica rapa]
 ref|XP_009116789.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brassica rapa]
Length=473

 Score =   127 bits (318),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  92   DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  151

Query  637  AFCI  648
            AFCI
Sbjct  152  AFCI  155


 Score = 38.1 bits (87),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 4/39 (10%)
 Frame = +3

Query  354  NEVLKTIQSE----GIDSSSQDWKARLNIPAPDTRYRTG  458
            NEV KT  S+      DS+ QDWK+ L +P PDTRY+T 
Sbjct  53   NEVQKTTSSQPPVASSDSNGQDWKSTLRLPPPDTRYQTA  91



>gb|AAK63966.1| At2g45810/F4I18.21 [Arabidopsis thaliana]
 gb|AAO11625.1| At2g45810/F4I18.21 [Arabidopsis thaliana]
Length=528

 Score =   125 bits (313),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDY LKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  146  EDVTATKGNEFEDYLLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  205

Query  634  AAFCI  648
             AFCI
Sbjct  206  GAFCI  210


 Score = 40.0 bits (92),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE I DS+++DWKA L +P  D RY+T
Sbjct  111  DEVEKTVQSEAISDSNNEDWKATLKLPPRDNRYQT  145



>ref|XP_010508105.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
 ref|XP_010508106.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
Length=520

 Score =   127 bits (320),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  138  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  197

Query  634  AAFCI  648
             AFCI
Sbjct  198  GAFCI  202


 Score = 37.0 bits (84),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE   DS++QDWKA + +P  D RY+T
Sbjct  103  DEVEKTVQSEANNDSNTQDWKATVKLPPRDDRYQT  137



>ref|XP_006294022.1| hypothetical protein CARUB_v10023015mg [Capsella rubella]
 gb|EOA26920.1| hypothetical protein CARUB_v10023015mg [Capsella rubella]
Length=518

 Score =   127 bits (319),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  136  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  195

Query  634  AAFCI  648
             AFCI
Sbjct  196  GAFCI  200


 Score = 37.0 bits (84),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRT  455
            +EV KT+QSE   DS+++DWKA L +P  D RY+T
Sbjct  101  DEVEKTVQSEANNDSNTEDWKATLKLPPRDDRYQT  135



>ref|NP_191683.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 ref|NP_974472.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 sp|Q9M2E0.1|RH12_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis 
thaliana]
 emb|CAB71054.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AAM53270.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AAN15357.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AEE80177.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 gb|AEE80178.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
Length=498

 Score =   127 bits (318),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  117  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  176

Query  637  AFCI  648
            AFCI
Sbjct  177  AFCI  180


 Score = 37.4 bits (85),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 3/52 (6%)
 Frame = +3

Query  309  WLRRNPsaaasesssNEVLK-TIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            W RR P    + S++NEV++ T Q E   D++ QDWKA L +P PDTRY+T 
Sbjct  66   WSRR-PQLPGNASNANEVVQQTTQPEASSDANGQDWKATLRLPPPDTRYQTA  116



>emb|CDY48935.1| BnaA09g39020D [Brassica napus]
Length=475

 Score =   127 bits (318),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  94   DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  153

Query  637  AFCI  648
            AFCI
Sbjct  154  AFCI  157


 Score = 37.4 bits (85),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  390  DSSSQDWKARLNIPAPDTRYRTG  458
            DS+ QDWKA L +P PDTRY+T 
Sbjct  71   DSNGQDWKASLRLPPPDTRYQTA  93



>ref|XP_006402503.1| hypothetical protein EUTSA_v10005922mg [Eutrema salsugineum]
 gb|ESQ43956.1| hypothetical protein EUTSA_v10005922mg [Eutrema salsugineum]
Length=485

 Score =   127 bits (318),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  104  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  163

Query  637  AFCI  648
            AFCI
Sbjct  164  AFCI  167


 Score = 37.0 bits (84),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 1/36 (3%)
 Frame = +3

Query  354  NEVLKTIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            NEV KT Q     D + QDWKA L +P PDTRY+T 
Sbjct  68   NEVQKTSQPVATSDPNGQDWKATLRLPPPDTRYQTA  103



>emb|CDY27357.1| BnaC04g50480D [Brassica napus]
Length=509

 Score =   127 bits (319),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  127  EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  186

Query  634  AAFCI  648
             AFCI
Sbjct  187  GAFCI  191


 Score = 36.6 bits (83),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 2/33 (6%)
 Frame = +3

Query  357  EVLKTIQSEGIDSSSQDWKARLNIPAPDTRYRT  455
            EV KT+QSE   +S+QDWKA L +P  D RY+T
Sbjct  96   EVEKTVQSEA--NSNQDWKATLKLPPRDNRYQT  126



>ref|XP_005849570.1| hypothetical protein CHLNCDRAFT_56077 [Chlorella variabilis]
 gb|EFN57468.1| hypothetical protein CHLNCDRAFT_56077 [Chlorella variabilis]
Length=390

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGN FEDYFLKRELLMGIYEKGFE PSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  32   EDVTATKGNSFEDYFLKRELLMGIYEKGFENPSPIQEESIPIALTGRDILARAKNGTGKT  91

Query  634  AAFCI  648
            AAFCI
Sbjct  92   AAFCI  96



>ref|XP_009587318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 64/69 (93%), Gaps = 2/69 (3%)
 Frame = +1

Query  442  HVIGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNG  621
            H IG  VTATKGNEFEDYFLK ELLMGIYEKGFERPSPIQEESIPIAL GSDILARAKNG
Sbjct  46   HSIG--VTATKGNEFEDYFLKHELLMGIYEKGFERPSPIQEESIPIALIGSDILARAKNG  103

Query  622  TGKTAAFCI  648
            TGKTAAFCI
Sbjct  104  TGKTAAFCI  112



>emb|CDY58787.1| BnaA07g38020D [Brassica napus]
Length=482

 Score =   126 bits (317),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  101  DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  160

Query  637  AFCI  648
            AFCI
Sbjct  161  AFCI  164


 Score = 35.8 bits (81),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +3

Query  393  SSSQDWKARLNIPAPDTRYRTG  458
            S  QDWKA L +P PDTRY+T 
Sbjct  79   SGGQDWKATLKLPPPDTRYQTA  100



>ref|XP_002951166.1| DEAD-box RNA helicase, ATP-dependent, cytoplasmic [Volvox carteri 
f. nagariensis]
 gb|EFJ47695.1| DEAD-box RNA helicase, ATP-dependent, cytoplasmic [Volvox carteri 
f. nagariensis]
Length=406

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+EKGFE+PSPIQEESIPIAL G DILARAKNGTGKT
Sbjct  24   EDVTATKGNEFEDYFLKRELLMGIFEKGFEKPSPIQEESIPIALAGRDILARAKNGTGKT  83

Query  634  AAFCI  648
            AAFCI
Sbjct  84   AAFCI  88



>gb|KIZ02033.1| ATP-dependent RNA helicase DDX6/DHH1 [Monoraphidium neglectum]
Length=256

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKG+EFEDYFLKRELLMGIYEKGFE+PSPIQEESIPIALTG DILARAKNGTGKTA
Sbjct  11   DVTATKGHEFEDYFLKRELLMGIYEKGFEKPSPIQEESIPIALTGRDILARAKNGTGKTA  70

Query  637  AFCI  648
            AF I
Sbjct  71   AFSI  74



>emb|CDX71756.1| BnaC08g31180D [Brassica napus]
Length=479

 Score =   127 bits (318),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  98   DVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  157

Query  637  AFCI  648
            AFCI
Sbjct  158  AFCI  161


 Score = 35.0 bits (79),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  396  SSQDWKARLNIPAPDTRYRTG  458
            S QDWKA L +P PDTRY+T 
Sbjct  77   SGQDWKATLRLPPPDTRYQTA  97



>ref|XP_001418212.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96505.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=419

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  37   EDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  96

Query  634  AAFCI  648
            AAF I
Sbjct  97   AAFTI  101



>ref|XP_006397768.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39221.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=406

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT
Sbjct  24   EDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKT  83

Query  634  AAFCI  648
             AFCI
Sbjct  84   GAFCI  88



>ref|XP_009104295.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Brassica 
rapa]
Length=477

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 75/105 (71%), Gaps = 6/105 (6%)
 Frame = +1

Query  334  PPRNLALTKS*KLYNPKGLIRALKIGRLD*IYQRLIHVIGQDVTATKGNEFEDYFLKREL  513
            PP +   + S  L   K     LK+   D  YQ        DVTATKGNEFEDYFLKR+L
Sbjct  61   PPNDHKFSGSVTLSGGKDWKATLKLPPPDTRYQ------TADVTATKGNEFEDYFLKRDL  114

Query  514  LMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCI  648
            L GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT AFCI
Sbjct  115  LKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCI  159



>ref|XP_010544718.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Tarenaya hassleriana]
Length=474

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGN+FEDYFLKRELLMGIYEKGF++PSP+QEESIPIALTGSDILAR+KNGTGKT
Sbjct  92   EDVTTTKGNDFEDYFLKRELLMGIYEKGFQKPSPVQEESIPIALTGSDILARSKNGTGKT  151

Query  634  AAFCI  648
            AAFCI
Sbjct  152  AAFCI  156



>ref|XP_003079824.1| putative RNA helicase (ISS) [Ostreococcus tauri]
 emb|CAL53470.1| Helicase, C-terminal [Ostreococcus tauri]
Length=425

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  43   EDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  102

Query  634  AAFCI  648
            AAF I
Sbjct  103  AAFSI  107



>ref|XP_002508100.1| DEAD/DEAH box helicase [Micromonas sp. RCC299]
 gb|ACO69358.1| DEAD/DEAH box helicase [Micromonas sp. RCC299]
Length=464

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  82   EDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGRDILARAKNGTGKT  141

Query  634  AAFCI  648
            AAF I
Sbjct  142  AAFTI  146



>emb|CAA09203.1| RNA helicase [Arabidopsis thaliana]
Length=498

 Score =   125 bits (313),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFE+YFLKR+LL GIYEKGFE+PSPIQEESIPIALTGSDILARAKNGTGKT 
Sbjct  117  DVTATKGNEFENYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTG  176

Query  637  AFCI  648
            AFCI
Sbjct  177  AFCI  180


 Score = 35.0 bits (79),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +3

Query  354  NEVLK-TIQSEGI-DSSSQDWKARLNIPAPDTRYRTG  458
            NEV++ T Q E   D++ Q+WKA L +P PDTRY+T 
Sbjct  80   NEVVQQTTQPEASSDANGQNWKATLRLPPPDTRYQTA  116



>gb|KHN28121.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=331

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  448  IGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG  627
            I QD    +GNE EDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG
Sbjct  50   IDQDNNVIQGNEVEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTG  109

Query  628  KTAAFCI  648
            KTAAFCI
Sbjct  110  KTAAFCI  116


 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +1

Query  517  MGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCI  648
            MGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCI
Sbjct  1    MGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCI  44



>ref|XP_001692202.1| cytoplasmic DExD/H-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP04152.1| cytoplasmic DExD/H-box RNA helicase [Chlamydomonas reinhardtii]
Length=405

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKGFE+PSPIQEESIPIAL G DILARAKNGTGKT
Sbjct  23   EDVTNTKGNEFEDYFLKRELLMGIFEKGFEKPSPIQEESIPIALAGRDILARAKNGTGKT  82

Query  634  AAFCI  648
            AAFCI
Sbjct  83   AAFCI  87



>gb|KIY97689.1| ATP-dependent RNA helicase DDX6/DHH1 [Monoraphidium neglectum]
Length=351

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKG+EFEDYFLKRELLMGIYEKGFE+PSPIQEESIPIALTG DILARAKNGTGKTA
Sbjct  27   DVTATKGHEFEDYFLKRELLMGIYEKGFEKPSPIQEESIPIALTGRDILARAKNGTGKTA  86

Query  637  AFCI  648
            AF I
Sbjct  87   AFSI  90



>ref|XP_006681354.1| hypothetical protein BATDEDRAFT_20569 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77881.1| hypothetical protein BATDEDRAFT_20569 [Batrachochytrium dendrobatidis 
JAM81]
Length=422

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            QDVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEESIPIAL G DILARAKNGTGKT
Sbjct  39   QDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALAGRDILARAKNGTGKT  98

Query  634  AAFCI  648
            AAF I
Sbjct  99   AAFVI  103



>gb|ETW32647.1| DEAD-box ATP-dependent RNA helicase 12 [Plasmodium falciparum 
Tanzania (2000708)]
Length=133

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  52   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFAI  116



>gb|ESA01456.1| hypothetical protein GLOINDRAFT_333744 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX61432.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX61433.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX61434.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
Length=490

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  37   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALTGRDILARAKNGTGKT  96

Query  634  AAFCI  648
            AAF I
Sbjct  97   AAFVI  101



>dbj|GAN04011.1| eukaryotic translation initiation factor 4A-like protein [Mucor 
ambiguus]
Length=520

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>gb|EPB84122.1| ATP-dependent RNA helicase DHH1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=513

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>emb|CEP17217.1| hypothetical protein [Parasitella parasitica]
Length=492

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>dbj|GAN00930.1| conserved hypothetical protein [Mucor ambiguus]
Length=491

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>emb|CDS12947.1| Putative ATP-dependent RNA helicase DHH1 [Absidia idahoensis 
var. thermophila]
Length=451

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  24   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  83

Query  634  AAFCI  648
            AAF I
Sbjct  84   AAFII  88



>gb|EPB90373.1| ATP-dependent RNA helicase dhh1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=499

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>emb|CDH55774.1| atp-dependent rna helicase dhh1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=455

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  24   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  83

Query  634  AAFCI  648
            AAF I
Sbjct  84   AAFII  88



>gb|KFH64831.1| ATP-dependent RNA helicase dhh1 [Mortierella verticillata NRRL 
6337]
Length=494

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEESIPIAL G DILARAKNGTGKT
Sbjct  32   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALAGRDILARAKNGTGKT  91

Query  634  AAFCI  648
            AAF I
Sbjct  92   AAFVI  96



>gb|KFH66615.1| ATP-dependent RNA helicase dhh1 [Mortierella verticillata NRRL 
6337]
Length=475

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEESIPIAL G DILARAKNGTGKT
Sbjct  32   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALAGRDILARAKNGTGKT  91

Query  634  AAFCI  648
            AAF I
Sbjct  92   AAFVI  96



>emb|CDS11083.1| Putative ATP-dependent RNA helicase DHH1 [Absidia idahoensis 
var. thermophila]
Length=495

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+E GFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  24   EDVTKTKGNEFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALTGRDILARAKNGTGKT  83

Query  634  AAFCI  648
            AAF I
Sbjct  84   AAFVI  88



>emb|CDH58577.1| atp-dependent rna helicase dhh1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=506

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+E GFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  33   EDVTKTKGNEFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALTGRDILARAKNGTGKT  92

Query  634  AAFCI  648
            AAF I
Sbjct  93   AAFVI  97



>emb|CEP14076.1| hypothetical protein [Parasitella parasitica]
Length=484

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDY+LKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  28   EDVTATKGNEFEDYYLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  87

Query  634  AAFCI  648
            AAF I
Sbjct  88   AAFVI  92



>gb|EPZ36415.1| putative ATP-dependent RNA helicase ddx6 [Rozella allomycis CSF55]
Length=409

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDY+LKRELLMGIYE G+E PSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  27   EDVTATKGNEFEDYYLKRELLMGIYEMGYEHPSPIQEESIPIALTGRDILARAKNGTGKT  86

Query  634  AAFCI  648
            AAF I
Sbjct  87   AAFII  91



>ref|XP_005646927.1| cytoplasmic DExD/H-box RNA helicase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22383.1| cytoplasmic DExD/H-box RNA helicase [Coccomyxa subellipsoidea 
C-169]
Length=415

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDY LKRELLMGIYEKGFE+PSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  33   EDVTNTKGNEFEDYVLKRELLMGIYEKGFEKPSPIQEESIPIALTGRDILARAKNGTGKT  92

Query  634  AAFCI  648
            AAF I
Sbjct  93   AAFTI  97



>gb|KDE02539.1| ATP-dependent RNA helicase dhh1 [Microbotryum violaceum p1A1 
Lamole]
Length=532

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  65   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  124

Query  634  AAFCI  648
            AAF I
Sbjct  125  AAFII  129



>gb|EGU12280.1| ATP-dependent RNA helicase dhh1 [Rhodotorula glutinis ATCC 204091]
Length=557

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  34   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  93

Query  634  AAFCI  648
            AAF I
Sbjct  94   AAFII  98



>gb|EMS22443.1| ATP-dependent rna helicase dhh1 [Rhodosporidium toruloides NP11]
Length=564

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  35   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  94

Query  634  AAFCI  648
            AAF I
Sbjct  95   AAFII  99



>gb|EWC90657.1| histone H2A [Plasmodium falciparum NF54]
Length=257

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  52   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFAI  116



>emb|CDR46917.1| RHTO0S13e03356g1_1 [Rhodosporidium toruloides]
Length=553

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALTG DILARAKNGTGKT
Sbjct  35   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTGRDILARAKNGTGKT  94

Query  634  AAFCI  648
            AAF I
Sbjct  95   AAFII  99



>ref|XP_005777763.1| hypothetical protein EMIHUDRAFT_457595 [Emiliania huxleyi CCMP1516]
 gb|EOD25334.1| hypothetical protein EMIHUDRAFT_457595 [Emiliania huxleyi CCMP1516]
Length=344

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGN+FEDYFLKRELLMGI+E GFERPSPIQEESIPIAL G D+LARAKNGTGKTA
Sbjct  45   DVTATKGNDFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALAGRDVLARAKNGTGKTA  104

Query  637  AFCI  648
            AF I
Sbjct  105  AFVI  108



>gb|EIE82813.1| ATP-dependent RNA helicase dhh1 [Rhizopus delemar RA 99-880]
Length=453

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIALT  DILARAKNGTGKTA
Sbjct  15   DVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALTNRDILARAKNGTGKTA  74

Query  637  AFCI  648
            AF I
Sbjct  75   AFVI  78



>emb|CEI85652.1| Putative DEAD/DEAH box helicase [Rhizopus microsporus]
Length=498

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IP+AL G DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPLALAGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>emb|CEJ02025.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=521

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIAL G D+LARAKNGTGKT
Sbjct  36   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALAGRDVLARAKNGTGKT  95

Query  634  AAFCI  648
            AAF I
Sbjct  96   AAFVI  100



>ref|XP_002769151.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER01869.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
Length=210

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGN+FEDYFLKRELLMGI+EKGFE+PSPIQEESIP AL G +ILARAKNGTGKTA
Sbjct  61   DVTATKGNDFEDYFLKRELLMGIFEKGFEKPSPIQEESIPPALAGKNILARAKNGTGKTA  120

Query  637  AFCI  648
            +F I
Sbjct  121  SFLI  124



>emb|CEG81286.1| Putative Atp-dependent rna helicase dhh1 [Rhizopus microsporus]
Length=501

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IP+AL G DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPLALAGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>emb|CEG82997.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=523

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIAL G D+LARAKNGTGKT
Sbjct  36   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALAGRDVLARAKNGTGKT  95

Query  634  AAFCI  648
            AAF I
Sbjct  96   AAFVI  100



>emb|CEG71520.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=527

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIAL G D+LARAKNGTGKT
Sbjct  36   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALAGRDVLARAKNGTGKT  95

Query  634  AAFCI  648
            AAF I
Sbjct  96   AAFVI  100



>ref|XP_009690645.1| ATP-dependent RNA helicase [Theileria orientalis strain Shintoku]
 dbj|BAM40344.1| ATP-dependent RNA helicase [Theileria orientalis strain Shintoku]
Length=415

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKG+EFEDYFLKRELLMGI+EKGFERPSPIQEESIP+AL G DILARAKNGTGKT
Sbjct  34   EDVTKTKGSEFEDYFLKRELLMGIFEKGFERPSPIQEESIPVALAGHDILARAKNGTGKT  93

Query  634  AAFCI  648
            AAF I
Sbjct  94   AAFVI  98



>emb|CEI93304.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=528

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIAL G D+LARAKNGTGKT
Sbjct  36   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALAGRDVLARAKNGTGKT  95

Query  634  AAFCI  648
            AAF I
Sbjct  96   AAFVI  100



>emb|CCF74289.1| unnamed protein product [Babesia microti strain RI]
Length=466

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT T+G EFEDYFLKRELLMGI+EKG ERPSPIQEE+IPIALTG +ILARAKNGTGKT
Sbjct  78   EDVTKTRGTEFEDYFLKRELLMGIFEKGMERPSPIQEETIPIALTGKNILARAKNGTGKT  137

Query  634  AAFCI  648
            AAFCI
Sbjct  138  AAFCI  142



>emb|CEG63343.1| Putative Atp-dependent rna helicase dhh1 [Rhizopus microsporus]
Length=508

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IP+AL G DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPLALAGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>emb|CEI99706.1| Putative DEAD/DEAH box helicase [Rhizopus microsporus]
Length=499

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IP+AL G DILARAKNGTGKT
Sbjct  30   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPLALAGRDILARAKNGTGKT  89

Query  634  AAFCI  648
            AAF I
Sbjct  90   AAFVI  94



>ref|XP_765179.1| ATP-dependent RNA helicase [Theileria parva strain Muguga]
 gb|EAN32896.1| ATP-dependent RNA helicase, putative [Theileria parva]
Length=417

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT T+G+EFEDYFLKRELLMGI+EKGFERPSPIQEESIPIAL G DILARAKNGTGKT
Sbjct  36   EDVTKTRGSEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALAGHDILARAKNGTGKT  95

Query  634  AAFCI  648
            AAF I
Sbjct  96   AAFVI  100



>ref|XP_004829238.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi]
 gb|AFZ79572.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi strain WA]
Length=430

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKG+EFEDYFLKRELLMGI+EKGFERPSPIQEESIP+AL G DILARAKNGTGKT
Sbjct  49   EDVTKTKGSEFEDYFLKRELLMGIFEKGFERPSPIQEESIPVALAGHDILARAKNGTGKT  108

Query  634  AAFCI  648
            AAF I
Sbjct  109  AAFVI  113



>ref|XP_005780551.1| hypothetical protein EMIHUDRAFT_73141 [Emiliania huxleyi CCMP1516]
 gb|EOD28122.1| hypothetical protein EMIHUDRAFT_73141 [Emiliania huxleyi CCMP1516]
Length=439

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVTATKGN+FEDYFLKRELLMGI+E GFERPSPIQEESIPIAL G D+LARAKNGTGKTA
Sbjct  60   DVTATKGNDFEDYFLKRELLMGIFEAGFERPSPIQEESIPIALAGRDVLARAKNGTGKTA  119

Query  637  AFCI  648
            AF I
Sbjct  120  AFVI  123



>ref|XP_001388425.1| ATP-dependent RNA helicase [Cryptosporidium parvum Iowa II]
 gb|EAZ51465.1| ATP-dependent RNA helicase, putative [Cryptosporidium parvum 
Iowa II]
Length=406

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVT TKG++FEDYFLKRELLMGIYEKGFERPSPIQEESIP+AL G DILARAKNGTGKTA
Sbjct  26   DVTKTKGSDFEDYFLKRELLMGIYEKGFERPSPIQEESIPVALAGKDILARAKNGTGKTA  85

Query  637  AFCI  648
            AF I
Sbjct  86   AFVI  89



>ref|XP_002139920.1| ATP-dependent RNA helicase [Cryptosporidium muris RN66]
 gb|EEA05571.1| ATP-dependent RNA helicase, putative [Cryptosporidium muris RN66]
Length=406

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  DVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA  636
            DVT TKG++FEDYFLKRELLMGIYEKGFERPSPIQEESIP+AL G DILARAKNGTGKTA
Sbjct  26   DVTKTKGSDFEDYFLKRELLMGIYEKGFERPSPIQEESIPVALAGKDILARAKNGTGKTA  85

Query  637  AFCI  648
            AF I
Sbjct  86   AFVI  89



>ref|XP_004336605.1| atpdependent rna helicase ddx6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14592.1| atpdependent rna helicase ddx6, putative [Acanthamoeba castellanii 
str. Neff]
Length=407

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  445  VIGQDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGT  624
            ++ +DVT TKGNEFEDY+LKRELLMGIYEKGFE PSPIQEE+IPIAL G DILARAKNGT
Sbjct  30   LLTEDVTTTKGNEFEDYYLKRELLMGIYEKGFENPSPIQEEAIPIALAGRDILARAKNGT  89

Query  625  GKTAAFCI  648
            GKTA+F I
Sbjct  90   GKTASFLI  97



>ref|XP_952098.1| ATP-dependent RNA helicase [Theileria annulata strain Ankara]
 emb|CAI74366.1| ATP-dependent RNA helicase, putative [Theileria annulata]
Length=416

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT T+G+EFEDYFLKRELLMGI+EKGFERPSPIQEESIP+AL G DILARAKNGTGKT
Sbjct  35   EDVTKTRGSEFEDYFLKRELLMGIFEKGFERPSPIQEESIPVALAGHDILARAKNGTGKT  94

Query  634  AAFCI  648
            AAF I
Sbjct  95   AAFVI  99



>ref|XP_007875348.1| hypothetical protein PNEG_03276 [Pneumocystis murina B123]
 gb|EMR08445.1| hypothetical protein PNEG_03276 [Pneumocystis murina B123]
Length=495

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFED++LKRELLMGI+E GFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  37   EDVTKTKGNEFEDFYLKRELLMGIFEAGFERPSPIQEESIPIALTGRDILARAKNGTGKT  96

Query  634  AAFCI  648
            AAF I
Sbjct  97   AAFVI  101



>ref|XP_007875349.1| hypothetical protein, variant [Pneumocystis murina B123]
 gb|EMR08446.1| hypothetical protein, variant [Pneumocystis murina B123]
Length=485

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFED++LKRELLMGI+E GFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  27   EDVTKTKGNEFEDFYLKRELLMGIFEAGFERPSPIQEESIPIALTGRDILARAKNGTGKT  86

Query  634  AAFCI  648
            AAF I
Sbjct  87   AAFVI  91



>emb|CCJ28577.1| unnamed protein product [Pneumocystis jirovecii]
Length=806

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFED++LKRELLMGI+E GFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  37   EDVTKTKGNEFEDFYLKRELLMGIFEAGFERPSPIQEESIPIALTGRDILARAKNGTGKT  96

Query  634  AAFCI  648
            AAF I
Sbjct  97   AAFII  101



>emb|CCJ28576.1| unnamed protein product [Pneumocystis jirovecii]
Length=500

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFED++LKRELLMGI+E GFERPSPIQEESIPIALTG DILARAKNGTGKT
Sbjct  37   EDVTKTKGNEFEDFYLKRELLMGIFEAGFERPSPIQEESIPIALTGRDILARAKNGTGKT  96

Query  634  AAFCI  648
            AAF I
Sbjct  97   AAFII  101



>gb|ETW32270.1| DEAD-box ATP-dependent RNA helicase 8 [Plasmodium falciparum 
FCH/4]
Length=544

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  52   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFAI  116



>gb|EIE81845.1| ATP-dependent RNA helicase DHH1 [Rhizopus delemar RA 99-880]
Length=494

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFERPSPIQEE+IPIAL   DILARAKNGTGKT
Sbjct  35   EDVTATKGNEFEDYFLKRELLMGIFEAGFERPSPIQEEAIPIALANRDILARAKNGTGKT  94

Query  634  AAFCI  648
            AAF I
Sbjct  95   AAFVI  99



>gb|EIE83902.1| ATP-dependent RNA helicase DHH1 [Rhizopus delemar RA 99-880]
Length=523

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGNEFEDYFLKRELLMGI+E GFE+PSPIQEE+IP+AL G DILARAKNGTGKT
Sbjct  29   EDVTATKGNEFEDYFLKRELLMGIFEAGFEKPSPIQEEAIPLALAGRDILARAKNGTGKT  88

Query  634  AAFCI  648
            AAF I
Sbjct  89   AAFII  93



>emb|CCU99198.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=495

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKGN+FED+FLKRELLMGI+E GFERPSPIQEESIPIAL+G DILARAKNGTGKT
Sbjct  25   EDVTATKGNDFEDFFLKRELLMGIFEAGFERPSPIQEESIPIALSGRDILARAKNGTGKT  84

Query  634  AAFCI  648
            AA+ I
Sbjct  85   AAYVI  89



>emb|CDO62632.1| ATP-dependent RNA helicase DDX6, putative [Plasmodium reichenowi]
Length=433

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  52   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFAI  116



>ref|XP_001351278.1| ATP-dependent RNA Helicase, putative [Plasmodium falciparum 3D7]
 emb|CAB39031.1| ATP-dependent RNA Helicase, putative [Plasmodium falciparum 3D7]
 gb|ABK58709.1| RNA helicase [Plasmodium falciparum]
 gb|ABK58710.1| RNA helicase [Plasmodium falciparum]
 gb|ETW20531.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium falciparum 
Vietnam Oak-Knoll (FVO)]
 gb|ETW45023.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium falciparum 
NF135/5.C10]
 gb|ETW52105.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium falciparum 
Palo Alto/Uganda]
 gb|ETW63536.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium falciparum 
CAMP/Malaysia]
 gb|EUR79893.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium falciparum 
7G8]
 gb|EUT92388.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium falciparum 
Santa Lucia]
 gb|EWC78665.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium falciparum 
UGT5.1]
Length=433

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  52   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFAI  116



>gb|KIY70674.1| DEAD-domain-containing protein [Cylindrobasidium torrendii FP15055 
ss-10]
Length=454

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVTATKG EFED FL+RELLMGIYE GFERPSPIQEE+IP+ALTG D+LARAKNGTGKT
Sbjct  47   EDVTATKGTEFEDMFLRRELLMGIYEAGFERPSPIQEEAIPVALTGRDVLARAKNGTGKT  106

Query  634  AAFCI  648
            AAF I
Sbjct  107  AAFVI  111



>ref|XP_001610166.1| ATP-dependent RNA helicase [Babesia bovis T2Bo]
 gb|EDO06598.1| ATP-dependent RNA helicase, putative [Babesia bovis]
Length=433

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT T+G+EFEDYFLKRELLMGI+EKGFE+PSPIQEESIP+AL G DILARAKNGTGKT
Sbjct  52   EDVTKTRGSEFEDYFLKRELLMGIFEKGFEKPSPIQEESIPVALAGHDILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFVI  116



>ref|XP_008623418.1| ATP-dependent RNA helicase ddx6 [Plasmodium vinckei vinckei]
 gb|ETB62194.1| DEAD-box ATP-dependent RNA helicase 6 [Plasmodium yoelii 17X]
 gb|ETB62195.1| DEAD-box ATP-dependent RNA helicase 6, variant [Plasmodium yoelii 
17X]
 gb|EUD72498.1| ATP-dependent RNA helicase ddx6 [Plasmodium vinckei petteri]
 gb|KEG03494.1| ATP-dependent RNA helicase ddx6 [Plasmodium vinckei vinckei]
 emb|CDR14662.1| ATP-dependent RNA helicase DDX6, putative [Plasmodium chabaudi 
chabaudi]
 emb|CDS49266.1| ATP-dependent RNA helicase DDX6 [Plasmodium berghei ANKA]
 emb|CDU19375.1| ATP-dependent RNA helicase DDX6, putative [Plasmodium yoelii]
 emb|CDZ13678.1| ATP-dependent RNA helicase DDX6, putative [Plasmodium yoelii]
Length=433

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  52   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFAI  116



>ref|XP_742509.1| ATP-dependent RNA helicase [Plasmodium chabaudi chabaudi]
 emb|CAH79576.1| ATP-dependent RNA helicase, putative [Plasmodium chabaudi chabaudi]
Length=429

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  48   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  107

Query  634  AAFCI  648
            AAF I
Sbjct  108  AAFAI  112



>ref|XP_001614505.1| ATP-dependent RNA helicase [Plasmodium vivax Sal-1]
 gb|EDL44778.1| ATP-dependent RNA helicase, putative [Plasmodium vivax]
Length=433

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  454  QDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT  633
            +DVT TKGNEFEDYFLKRELLMGI+EKG+E+PSPIQEESIP+AL G +ILARAKNGTGKT
Sbjct  52   EDVTKTKGNEFEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKT  111

Query  634  AAFCI  648
            AAF I
Sbjct  112  AAFAI  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625