BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050A11

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785953.1|  PREDICTED: sec-independent protein transloca...    127   6e-33   Nicotiana sylvestris
ref|XP_009766133.1|  PREDICTED: sec-independent protein transloca...    126   1e-32   Nicotiana sylvestris
ref|XP_006347746.1|  PREDICTED: sec-independent protein transloca...    121   2e-30   Solanum tuberosum [potatoes]
ref|XP_009610432.1|  PREDICTED: sec-independent protein transloca...    120   3e-30   Nicotiana tomentosiformis
ref|XP_004230095.1|  PREDICTED: sec-independent protein transloca...    118   3e-29   Solanum lycopersicum
gb|AFK47858.1|  unknown                                                 117   4e-29   Lotus japonicus
gb|ACJ85933.1|  unknown                                                 115   1e-28   Medicago truncatula
ref|XP_002279607.1|  PREDICTED: sec-independent protein transloca...    115   1e-28   Vitis vinifera
ref|XP_003521755.1|  PREDICTED: sec-independent protein transloca...    115   2e-28   Glycine max [soybeans]
ref|NP_001238018.1|  uncharacterized protein LOC100306385               112   2e-27   Glycine max [soybeans]
ref|XP_007147171.1|  hypothetical protein PHAVU_006G101800g             112   4e-27   Phaseolus vulgaris [French bean]
ref|XP_010550921.1|  PREDICTED: sec-independent protein transloca...    111   6e-27   Tarenaya hassleriana [spider flower]
ref|XP_009364497.1|  PREDICTED: sec-independent protein transloca...    111   9e-27   Pyrus x bretschneideri [bai li]
ref|XP_002531294.1|  conserved hypothetical protein                     111   9e-27   Ricinus communis
ref|XP_011078758.1|  PREDICTED: sec-independent protein transloca...    110   1e-26   Sesamum indicum [beniseed]
emb|CDP06816.1|  unnamed protein product                                110   2e-26   Coffea canephora [robusta coffee]
ref|XP_004495801.1|  PREDICTED: sec-independent protein transloca...    110   2e-26   Cicer arietinum [garbanzo]
gb|EEC75796.1|  hypothetical protein OsI_12727                          110   2e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001050716.1|  Os03g0634000                                       110   4e-26   
gb|KDP23662.1|  hypothetical protein JCGZ_23495                         109   4e-26   Jatropha curcas
ref|XP_009398562.1|  PREDICTED: sec-independent protein transloca...    109   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008345714.1|  PREDICTED: sec-independent protein transloca...    109   4e-26   
ref|XP_011032407.1|  PREDICTED: sec-independent protein transloca...    109   5e-26   Populus euphratica
ref|XP_006650323.1|  PREDICTED: sec-independent protein transloca...    107   6e-26   
ref|XP_002319073.2|  thylakoid assembly family protein                  108   6e-26   Populus trichocarpa [western balsam poplar]
gb|KJB82529.1|  hypothetical protein B456_013G200900                    109   7e-26   Gossypium raimondii
gb|ABK93649.1|  unknown                                                 108   7e-26   Populus trichocarpa [western balsam poplar]
gb|KHG04000.1|  Sec-independent translocase protein TatA                108   8e-26   Gossypium arboreum [tree cotton]
ref|XP_004302052.1|  PREDICTED: sec-independent protein transloca...    108   1e-25   Fragaria vesca subsp. vesca
gb|KFK31934.1|  hypothetical protein AALP_AA6G178200                    107   1e-25   Arabis alpina [alpine rockcress]
gb|ABK93003.1|  unknown                                                 108   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004494699.1|  PREDICTED: sec-independent protein transloca...    107   2e-25   Cicer arietinum [garbanzo]
ref|XP_006838884.1|  hypothetical protein AMTR_s00002p00267770          107   2e-25   Amborella trichopoda
ref|XP_009389019.1|  PREDICTED: sec-independent protein transloca...    107   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078757.1|  PREDICTED: sec-independent protein transloca...    107   3e-25   Sesamum indicum [beniseed]
ref|XP_008388678.1|  PREDICTED: sec-independent protein transloca...    107   3e-25   
gb|EYU33033.1|  hypothetical protein MIMGU_mgv1a021859mg                105   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_002874447.1|  hypothetical protein ARALYDRAFT_489661             107   3e-25   
ref|XP_007206084.1|  hypothetical protein PRUPE_ppa012899mg             107   4e-25   Prunus persica
ref|XP_009111899.1|  PREDICTED: sec-independent protein transloca...    106   4e-25   Brassica rapa
ref|XP_006588399.1|  PREDICTED: uncharacterized protein LOC100500...    106   4e-25   
ref|XP_004982373.1|  PREDICTED: sec-independent protein transloca...    107   5e-25   
ref|XP_008218264.1|  PREDICTED: sec-independent protein transloca...    106   5e-25   Prunus mume [ume]
gb|ACN32121.1|  unknown                                                 107   6e-25   Zea mays [maize]
ref|NP_001104942.1|  sec-independent protein translocase protein ...    107   6e-25   
ref|NP_001150512.1|  THA4                                               107   6e-25   
ref|XP_010495580.1|  PREDICTED: sec-independent protein transloca...    105   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007030572.1|  Bacterial sec-independent translocation prot...    106   7e-25   
ref|XP_010528803.1|  PREDICTED: sec-independent protein transloca...    106   7e-25   Tarenaya hassleriana [spider flower]
emb|CDX86209.1|  BnaA06g29260D                                          105   8e-25   
sp|Q9XH46.1|TATA_PEA  RecName: Full=Sec-independent protein trans...    105   8e-25   Pisum sativum [garden pea]
gb|KHN16199.1|  Sec-independent protein translocase protein TatA        105   9e-25   Glycine soja [wild soybean]
ref|XP_010455196.1|  PREDICTED: sec-independent protein transloca...    105   1e-24   Camelina sativa [gold-of-pleasure]
gb|KHN04931.1|  Sec-independent protein translocase protein TatA        105   1e-24   Glycine soja [wild soybean]
ref|XP_009399359.1|  PREDICTED: sec-independent protein transloca...    105   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG40026.1|  THA4                                                    106   1e-24   Zea mays [maize]
ref|XP_009151263.1|  PREDICTED: sec-independent protein transloca...    105   1e-24   Brassica rapa
ref|XP_009129537.1|  PREDICTED: sec-independent protein transloca...    105   1e-24   Brassica rapa
ref|NP_198227.1|  sec-independent protein translocase protein TatA      105   1e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57016.1|  BnaA09g03480D                                          105   1e-24   Brassica napus [oilseed rape]
ref|XP_008450744.1|  PREDICTED: sec-independent protein transloca...    105   2e-24   Cucumis melo [Oriental melon]
ref|NP_001237608.1|  uncharacterized protein LOC100500409               104   2e-24   
ref|XP_002464206.1|  hypothetical protein SORBIDRAFT_01g014100          105   2e-24   
emb|CDY00023.1|  BnaC09g02780D                                          104   2e-24   
emb|CDY48664.1|  BnaC07g27450D                                          104   3e-24   Brassica napus [oilseed rape]
ref|XP_006288854.1|  hypothetical protein CARUB_v10002208mg             104   3e-24   Capsella rubella
ref|XP_010421703.1|  PREDICTED: sec-independent protein transloca...    104   3e-24   Camelina sativa [gold-of-pleasure]
ref|NP_001104943.1|  tha9 protein                                       105   3e-24   Zea mays [maize]
ref|XP_003556468.1|  PREDICTED: sec-independent protein transloca...    104   3e-24   Glycine max [soybeans]
emb|CDY05605.1|  BnaC02g39320D                                          104   4e-24   
ref|XP_004135654.1|  PREDICTED: sec-independent protein transloca...    104   4e-24   Cucumis sativus [cucumbers]
gb|EYU22665.1|  hypothetical protein MIMGU_mgv1a016077mg                103   4e-24   Erythranthe guttata [common monkey flower]
ref|XP_004171639.1|  PREDICTED: sec-independent protein transloca...    103   5e-24   
ref|XP_010923487.1|  PREDICTED: sec-independent protein transloca...    103   9e-24   Elaeis guineensis
ref|XP_010936083.1|  PREDICTED: LOW QUALITY PROTEIN: sec-independ...    103   1e-23   Elaeis guineensis
gb|EMS64861.1|  CBL-interacting protein kinase 7                        107   1e-23   Triticum urartu
ref|XP_010246331.1|  PREDICTED: sec-independent protein transloca...    102   1e-23   Nelumbo nucifera [Indian lotus]
gb|AFK44195.1|  unknown                                                 102   2e-23   Medicago truncatula
ref|XP_006395030.1|  hypothetical protein EUTSA_v10005085mg             102   3e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010674831.1|  PREDICTED: sec-independent protein transloca...    101   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010027195.1|  PREDICTED: light-inducible protein CPRF2-like      107   4e-23   
ref|XP_008788140.1|  PREDICTED: sec-independent protein transloca...    101   6e-23   Phoenix dactylifera
ref|XP_003562204.2|  PREDICTED: CBL-interacting protein kinase 7-...    106   7e-23   Brachypodium distachyon [annual false brome]
ref|XP_006432928.1|  hypothetical protein CICLE_v10002770mg             100   9e-23   Citrus clementina [clementine]
gb|EPS74317.1|  hypothetical protein M569_00442                       99.4    1e-22   Genlisea aurea
ref|XP_008786083.1|  PREDICTED: sec-independent protein transloca...  95.5    1e-20   Phoenix dactylifera
gb|ABK21127.1|  unknown                                               94.0    3e-20   Picea sitchensis
gb|KIZ03129.1|  hypothetical protein MNEG_4832                        92.8    6e-20   Monoraphidium neglectum
ref|XP_002976419.1|  hypothetical protein SELMODRAFT_267974           92.0    2e-19   Selaginella moellendorffii
ref|XP_002987256.1|  hypothetical protein SELMODRAFT_125456           90.1    2e-19   
ref|XP_001774935.1|  predicted protein                                89.7    1e-18   
gb|KEH43019.1|  twin arginine translocase                             86.7    5e-18   Medicago truncatula
ref|XP_001768091.1|  predicted protein                                87.8    9e-18   
ref|XP_008804879.1|  PREDICTED: sec-independent protein transloca...  86.7    1e-17   Phoenix dactylifera
gb|AAS47586.1|  chloroplast Tha4-1                                    87.0    1e-17   Physcomitrella patens
gb|EYU30524.1|  hypothetical protein MIMGU_mgv1a0158101mg             84.0    5e-17   Erythranthe guttata [common monkey flower]
emb|CEF96594.1|  Sec-independent protein translocase protein TatA/E   83.6    8e-17   Ostreococcus tauri
ref|XP_002946596.1|  hypothetical protein VOLCADRAFT_120302           84.7    9e-17   Volvox carteri f. nagariensis
ref|WP_006512458.1|  twin arginine-targeting protein translocase,...  82.8    1e-16   Xenococcus sp. PCC 7305
ref|XP_006382793.1|  hypothetical protein POPTR_0005s05490g           82.4    3e-16   
ref|XP_002500552.1|  twin arginine targeting family                   82.4    5e-16   Micromonas commoda
ref|XP_005646948.1|  twin arginine-targeting protein trans            80.5    5e-16   Coccomyxa subellipsoidea C-169
ref|XP_001690564.1|  TatA-like sec-independent protein translocat...  80.5    1e-15   Chlamydomonas reinhardtii
tpg|DAA50381.1|  TPA: thylakoid assembly4                             79.7    2e-15   
ref|WP_028083231.1|  preprotein translocase subunit TatA              78.2    4e-15   Dolichospermum circinale
ref|WP_028089196.1|  preprotein translocase subunit TatA              78.2    4e-15   Dolichospermum circinale
ref|WP_006275635.1|  MULTISPECIES: primosome subunit DnaD             78.2    4e-15   Aphanizomenonaceae
ref|WP_012410656.1|  primosome subunit DnaD                           78.2    5e-15   Nostoc punctiforme
ref|XP_003056138.1|  twin arginine targeting family                   79.3    6e-15   Micromonas pusilla CCMP1545
gb|KEH24554.1|  twin arginine translocase                             78.6    6e-15   Medicago truncatula
ref|WP_015222444.1|  Sec-independent protein translocase TatA         77.0    1e-14   
ref|WP_013191028.1|  primosome subunit DnaD                           77.0    1e-14   Trichormus azollae
ref|WP_036901406.1|  translocase                                      76.6    1e-14   Prochlorococcus sp. MIT 0601
ref|WP_015078234.1|  twin-arginine translocation protein              76.6    2e-14   Anabaena sp. 90
gb|ACZ26222.1|  TatA/E                                                76.6    2e-14   Aphanizomenon sp. NH-5
ref|WP_015167027.1|  twin arginine-targeting protein translocase,...  76.6    2e-14   Synechococcus sp. PCC 7502
ref|WP_027402857.1|  preprotein translocase subunit TatA              76.3    2e-14   Aphanizomenon flos-aquae
ref|WP_010477319.1|  MULTISPECIES: preprotein translocase subunit...  77.0    2e-14   Acaryochloris
ref|WP_017718938.1|  hypothetical protein                             76.3    2e-14   Oscillatoria sp. PCC 10802
ref|XP_007515120.1|  twin arginine translocase protein A              77.4    2e-14   Bathycoccus prasinos
ref|WP_011127144.1|  primosome subunit DnaD                           75.9    2e-14   Synechococcus sp. WH 8102
ref|WP_044106578.1|  preprotein translocase subunit SecA              76.3    3e-14   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_015129400.1|  Sec-independent protein translocase TatA         75.9    3e-14   Calothrix sp. PCC 7507
ref|WP_011932240.1|  primosome subunit DnaD                           75.5    3e-14   Synechococcus sp. WH 7803
ref|WP_036486219.1|  preprotein translocase subunit SecA              75.9    4e-14   Myxosarcina sp. GI1
ref|WP_015218443.1|  Sec-independent protein translocase TatA         75.5    4e-14   Cyanobacterium aponinum
ref|WP_017296345.1|  hypothetical protein                             75.5    4e-14   Geminocystis herdmanii
ref|WP_011243599.1|  MULTISPECIES: preprotein translocase subunit...  75.5    4e-14   Synechococcus
ref|WP_022607742.1|  twin arginine-targeting protein translocase,...  75.5    4e-14   Rubidibacter lacunae
ref|WP_017655009.1|  primosome subunit DnaD                           75.5    5e-14   Fortiea contorta
ref|WP_015135395.1|  Sec-independent protein translocase TatA         75.5    5e-14   Leptolyngbya sp. PCC 7376
ref|WP_016952632.1|  primosome subunit DnaD                           75.1    5e-14   Anabaena sp. PCC 7108
ref|WP_010314490.1|  primosome subunit DnaD                           74.7    6e-14   Synechococcus sp. CB0205
ref|WP_009788805.1|  primosome subunit DnaD                           74.3    7e-14   Synechococcus sp. BL107
ref|WP_015142774.1|  twin arginine-targeting protein translocase,...  74.7    8e-14   Pleurocapsa minor
ref|WP_019502800.1|  hypothetical protein                             74.3    9e-14   Pseudanabaena sp. PCC 6802
ref|WP_025956123.1|  hypothetical protein                             74.3    1e-13   
ref|WP_037218329.1|  preprotein translocase subunit TatA              74.3    1e-13   
ref|WP_015214503.1|  Sec-independent protein translocase TatA         74.3    1e-13   Anabaena cylindrica
ref|WP_027840950.1|  preprotein translocase subunit TatA              74.3    1e-13   Mastigocoleus testarum
ref|WP_015188791.1|  Sec-independent protein translocase TatA         74.3    1e-13   Gloeocapsa sp. PCC 7428
ref|WP_017327885.1|  hypothetical protein                             74.7    1e-13   Synechococcus sp. PCC 7336
gb|ELS32305.1|  Sec-independent protein translocase protein tatA/...  74.7    1e-13   Pseudanabaena biceps PCC 7429
ref|WP_044195831.1|  preprotein translocase subunit TatA              73.9    1e-13   Oscillatoria acuminata
ref|WP_040054321.1|  preprotein translocase subunit SecA              73.9    1e-13   
ref|WP_026787063.1|  MULTISPECIES: hypothetical protein               73.6    2e-13   Planktothrix
ref|XP_010917651.1|  PREDICTED: sec-independent protein transloca...  75.1    2e-13   Elaeis guineensis
ref|WP_012628897.1|  preprotein translocase subunit TatA              74.3    2e-13   Cyanothece sp. PCC 7425
ref|WP_006042329.1|  primosome subunit DnaD                           73.2    2e-13   Synechococcus sp. WH 7805
ref|WP_036531210.1|  preprotein translocase subunit TatA              73.9    2e-13   Neosynechococcus sphagnicola
ref|WP_035997640.1|  hypothetical protein                             73.9    2e-13   [Leptolyngbya] sp. JSC-1
ref|WP_006516772.1|  twin arginine-targeting protein translocase,...  73.9    2e-13   Leptolyngbya sp. PCC 7375
ref|WP_040688524.1|  preprotein translocase subunit TatA              72.8    2e-13   
ref|WP_012194832.1|  translocase                                      73.2    2e-13   Prochlorococcus marinus
ref|WP_011360824.1|  primosome subunit DnaD                           72.8    3e-13   Synechococcus sp. CC9902
gb|AAP79161.1|  Tha4 plastid transport protein                        75.5    3e-13   Bigelowiella natans
ref|WP_006853679.1|  prohead protease                                 73.2    3e-13   Synechococcus sp. WH 8016
ref|WP_028948124.1|  preprotein translocase subunit SecA              72.8    3e-13   Synechocystis sp. PCC 6714
ref|WP_019509197.1|  hypothetical protein                             73.2    3e-13   Pleurocapsa sp. PCC 7319
ref|WP_040932916.1|  hypothetical protein                             73.2    3e-13   
ref|WP_012954283.1|  primosome subunit DnaD                           73.2    3e-13   Candidatus Atelocyanobacterium thalassa
ref|WP_011936751.1|  primosome subunit DnaD                           72.8    3e-13   Synechococcus sp. RCC307
ref|WP_011124437.1|  MULTISPECIES: translocase                        72.8    3e-13   Prochlorococcus
ref|WP_011618288.1|  prohead protease                                 72.8    3e-13   Synechococcus sp. CC9311
ref|WP_008235394.1|  Twin-arginine translocation protein TatA         72.8    3e-13   Richelia intracellularis
ref|WP_009632533.1|  twin arginine-targeting protein translocase,...  73.2    4e-13   Synechocystis sp. PCC 7509
ref|WP_024546019.1|  hypothetical protein                             72.8    4e-13   Synechococcus
gb|EDX84644.1|  twin arginine-targeting protein translocase, TatA...  73.9    4e-13   Synechococcus sp. PCC 7335
ref|WP_012594970.1|  MULTISPECIES: primosome subunit DnaD             72.8    4e-13   Cyanothece
ref|WP_039895374.1|  preprotein translocase subunit TatA              72.4    4e-13   Lyngbya sp. PCC 8106
ref|WP_012267736.1|  primosome subunit DnaD                           72.4    4e-13   Microcystis
ref|WP_038542939.1|  primosome subunit DnaD                           72.4    4e-13   Synechococcus sp. KORDI-100
ref|WP_017316132.1|  primosome subunit DnaD                           72.4    4e-13   Mastigocladopsis repens
ref|WP_002762408.1|  primosome subunit DnaD                           72.4    5e-13   Microcystis aeruginosa
ref|XP_005846144.1|  hypothetical protein CHLNCDRAFT_25319            71.6    5e-13   Chlorella variabilis
ref|WP_015118028.1|  twin arginine-targeting protein translocase,...  72.4    5e-13   Rivularia sp. PCC 7116
ref|WP_041425909.1|  preprotein translocase subunit SecA              72.4    5e-13   Synechocystis
ref|WP_023067361.1|  twin arginine-targeting translocase, TatA/E ...  72.4    5e-13   Lyngbya aestuarii
ref|WP_038019212.1|  hypothetical protein                             72.4    5e-13   
ref|WP_023071402.1|  sec-independent protein translocase              72.8    5e-13   Leptolyngbya sp. Heron Island J
ref|WP_010871658.1|  hypothetical protein                             73.2    5e-13   
ref|WP_028953506.1|  primosome subunit DnaD                           72.0    5e-13   Synechococcus sp. CC9616
ref|WP_012306345.1|  MULTISPECIES: primosome subunit DnaD             72.4    6e-13   Synechococcus
ref|WP_017307186.1|  hypothetical protein                             72.4    6e-13   Spirulina subsalsa
ref|WP_002735474.1|  MULTISPECIES: primosome subunit DnaD             72.0    6e-13   Microcystis
emb|CAO89342.1|  unnamed protein product                              72.8    7e-13   Microcystis aeruginosa PCC 7806
ref|WP_015956190.1|  primosome subunit DnaD                           72.0    7e-13   Cyanothece sp. PCC 7424
ref|WP_006172416.1|  prohead protease                                 72.8    7e-13   
dbj|GAL93280.1|  twin-arginine translocation protein TatB             71.6    8e-13   Microcystis aeruginosa NIES-44
ref|WP_002743526.1|  primosome subunit DnaD                           71.6    8e-13   Microcystis
ref|WP_011377062.1|  MULTISPECIES: twin arginine-targeting protei...  71.6    8e-13   Prochlorococcus marinus
ref|WP_015161113.1|  twin arginine-targeting protein translocase,...  71.6    8e-13   Chamaesiphon minutus
ref|WP_041034563.1|  preprotein translocase subunit TatA              71.6    8e-13   Tolypothrix campylonemoides
ref|WP_002765259.1|  primosome subunit DnaD                           71.6    9e-13   Microcystis aeruginosa
ref|WP_015136549.1|  twin arginine-targeting protein translocase,...  71.6    1e-12   Nostoc sp. PCC 7524
ref|XP_003074238.1|  chloroplast Tha4-2 (ISS)                         72.4    1e-12   
ref|WP_011612401.1|  preprotein translocase subunit TatA              71.6    1e-12   Trichodesmium erythraeum
ref|WP_038551417.1|  primosome subunit DnaD                           71.2    1e-12   Synechococcus sp. KORDI-52
gb|AHF62674.1|  twin-arginine translocation protein, TatA/E family    71.2    1e-12   Synechococcus sp. WH 8109
ref|WP_009546094.1|  MULTISPECIES: primosome subunit DnaD             71.2    1e-12   Cyanothece
ref|WP_011363292.1|  primosome subunit DnaD                           71.2    1e-12   Synechococcus sp. CC9605
ref|WP_011429652.1|  prohead protease                                 72.0    1e-12   Synechococcus
ref|WP_008275801.1|  primosome subunit DnaD                           71.2    1e-12   Cyanothece sp. CCY0110
gb|AFY67086.1|  Sec-independent protein translocase TatA              71.6    1e-12   Geitlerinema sp. PCC 7407
ref|WP_032515366.1|  hypothetical protein                             71.2    1e-12   Prochlorococcus marinus
ref|WP_006099206.1|  primosome subunit DnaD                           71.2    1e-12   Coleofasciculus chthonoplastes
ref|WP_029977877.1|  hypothetical protein                             70.5    1e-12   
ref|WP_007100743.1|  preprotein translocase subunit TatA              71.2    1e-12   Synechococcus sp. RS9917
ref|WP_036913569.1|  MULTISPECIES: preprotein translocase subunit...  70.9    2e-12   Prochlorococcus
ref|WP_015202296.1|  Sec-independent protein translocase TatA         70.9    2e-12   Crinalium epipsammum
ref|WP_041269048.1|  preprotein translocase subunit TatA              70.9    2e-12   
ref|WP_015191613.1|  Sec-independent protein translocase protein ...  70.9    2e-12   Stanieria cyanosphaera
ref|WP_024124248.1|  twin-arginine protein translocation system c...  70.5    2e-12   Thermosynechococcus sp. NK55a
ref|WP_013323574.1|  primosome subunit DnaD                           70.9    2e-12   Cyanothece sp. PCC 7822
ref|WP_007099747.1|  primosome subunit DnaD                           70.9    2e-12   Synechococcus sp. RS9916
ref|WP_017322731.1|  primosome subunit DnaD                           70.5    2e-12   cyanobacterium PCC 7702
ref|WP_006530590.1|  twin arginine-targeting protein translocase,...  70.9    2e-12   Gloeocapsa sp. PCC 73106
ref|WP_015184092.1|  Sec-independent protein translocase TatA         70.9    2e-12   Microcoleus sp. PCC 7113
ref|WP_011131203.1|  preprotein translocase subunit TatA              70.5    2e-12   Prochlorococcus marinus
ref|WP_015157036.1|  Sec-independent protein translocase TatA         70.9    2e-12   Cyanobacteria [blue-green bacteria]
ref|WP_007354006.1|  MULTISPECIES: preprotein translocase subunit...  70.5    2e-12   Kamptonema
ref|WP_039713404.1|  preprotein translocase subunit TatA              70.5    2e-12   
ref|WP_044259952.1|  preprotein translocase subunit TatA              70.1    2e-12   Richelia intracellularis
ref|WP_011057225.1|  preprotein translocase subunit TatA              70.1    3e-12   Thermosynechococcus
ref|WP_011827044.1|  preprotein translocase subunit TatA              70.5    3e-12   
gb|AFY70239.1|  Sec-independent protein translocase protein tatA/...  71.2    3e-12   Pseudanabaena sp. PCC 7367
ref|WP_015209228.1|  twin arginine-targeting protein translocase,...  70.1    3e-12   Cylindrospermum stagnale
ref|WP_036029486.1|  hypothetical protein                             69.7    3e-12   
ref|WP_016858680.1|  MULTISPECIES: primosome subunit DnaD             69.7    3e-12   Hapalosiphonaceae
ref|WP_043694585.1|  primosome subunit DnaD                           69.7    4e-12   Synechococcus sp. KORDI-49
ref|WP_011321124.1|  primosome subunit DnaD                           70.1    4e-12   Trichormus variabilis
ref|WP_011434012.1|  prohead protease                                 70.5    4e-12   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_010312066.1|  primosome subunit DnaD                           69.7    4e-12   Synechococcus sp. CB0101
ref|WP_010995019.1|  primosome subunit DnaD                           69.3    6e-12   Nostocaceae
ref|WP_016875716.1|  primosome subunit DnaD                           69.3    6e-12   Chlorogloeopsis fritschii
ref|WP_007306580.1|  primosome subunit DnaD                           69.3    6e-12   Crocosphaera watsonii
ref|WP_015111805.1|  Sec-independent protein translocase TatA         69.3    6e-12   Nostoc sp. PCC 7107
gb|KIJ84523.1|  preprotein translocase subunit TatA                   69.7    6e-12   Scytonema tolypothrichoides VB-61278
ref|WP_036916527.1|  MULTISPECIES: hypothetical protein               68.9    7e-12   Prochlorococcus
ref|WP_009459239.1|  MULTISPECIES: primosome subunit DnaD             68.9    7e-12   Fischerella
ref|WP_006633691.1|  preprotein translocase subunit TatA              68.9    8e-12   Microcoleus vaginatus
ref|WP_015176008.1|  Sec-independent protein translocase TatA         68.9    8e-12   Oscillatoria nigro-viridis
ref|WP_011294250.1|  translocase                                      68.6    8e-12   Prochlorococcus marinus
ref|WP_029637480.1|  preprotein translocase subunit TatA [            68.9    9e-12   [Scytonema hofmanni] UTEX B 1581
ref|WP_006618394.1|  MULTISPECIES: preprotein translocase subunit...  68.6    9e-12   Arthrospira
ref|WP_011823102.1|  translocase                                      68.2    9e-12   Prochlorococcus marinus
ref|WP_041699455.1|  preprotein translocase subunit TatA              67.4    1e-11   
ref|WP_039739679.1|  preprotein translocase subunit TatA              68.6    1e-11   
ref|WP_036617295.1|  preprotein translocase subunit TatA              67.8    1e-11   
gb|AFY84251.1|  twin arginine-targeting protein translocase, TatA...  68.2    1e-11   Oscillatoria acuminata PCC 6304
ref|WP_006909120.1|  prohead protease                                 68.9    1e-11   Cyanobium sp. PCC 7001
ref|WP_006194119.1|  primosome subunit DnaD                           68.2    1e-11   Nodularia spumigena
ref|WP_018400284.1|  hypothetical protein                             68.6    1e-11   filamentous cyanobacterium ESFC-1
ref|WP_026731687.1|  preprotein translocase subunit TatA              68.2    2e-11   Fischerella sp. PCC 9605
ref|WP_016866312.1|  primosome subunit DnaD                           67.8    2e-11   Fischerella muscicola
ref|WP_044492070.1|  primosome subunit DnaD                           68.2    2e-11   Moorea producens
gb|EKQ67486.1|  twin arginine-targeting protein translocase, TatA...  68.6    2e-11   Oscillatoriales cyanobacterium JSC-12
ref|WP_025782329.1|  hypothetical protein                             67.8    2e-11   Candidatus Synechococcus spongiarum
ref|WP_019488579.1|  primosome subunit DnaD                           67.4    2e-11   Calothrix sp. PCC 7103
ref|WP_015224612.1|  twin-arginine translocation protein, TatA/E ...  67.8    3e-11   Halothece sp. PCC 7418
ref|WP_019476599.1|  hypothetical protein                             67.0    3e-11   
ref|WP_017746590.1|  primosome subunit DnaD                           67.0    3e-11   Scytonema hofmannii
ref|WP_035831648.1|  hypothetical protein                             67.4    4e-11   
ref|WP_038651129.1|  translocase                                      66.6    4e-11   Prochlorococcus sp. MIT 0801
gb|EAW38682.1|  hypothetical protein L8106_14745                      67.0    4e-11   Lyngbya sp. PCC 8106
ref|WP_032521902.1|  preprotein translocase subunit TatA              67.0    4e-11   Prochlorococcus marinus
ref|WP_025929795.1|  preprotein translocase subunit TatA              67.0    5e-11   
ref|WP_015124563.1|  twin arginine-targeting protein translocase,...  67.4    5e-11   Synechococcus sp. PCC 6312
ref|WP_019480068.1|  MULTISPECIES: hypothetical protein               66.2    5e-11   
ref|XP_001415796.1|  Tat family transporter: pH-dependent thylako...  65.9    5e-11   Ostreococcus lucimarinus CCE9901
gb|KIE07939.1|  preprotein translocase subunit TatA                   66.6    5e-11   Tolypothrix bouteillei VB521301
ref|WP_035156719.1|  preprotein translocase subunit TatA              66.2    7e-11   Calothrix sp. 336/3
ref|WP_015109628.1|  twin arginine-targeting protein translocase,...  66.6    8e-11   Cyanobium gracile
ref|WP_032524089.1|  preprotein translocase subunit TatA              66.2    8e-11   Prochlorococcus marinus
ref|WP_039728023.1|  MULTISPECIES: hypothetical protein               66.6    9e-11   Lyngbya confervoides
ref|WP_015199060.1|  Sec-independent protein translocase TatA         65.5    1e-10   Calothrix parietina
ref|WP_025924574.1|  MULTISPECIES: translocase                        64.7    2e-10   Prochlorococcus
ref|WP_011375911.1|  preprotein translocase subunit TatA              65.5    2e-10   Prochlorococcus marinus
ref|WP_025920894.1|  MULTISPECIES: hypothetical protein               65.1    2e-10   
ref|WP_025944096.1|  translocase                                      64.3    2e-10   
ref|WP_011862382.1|  preprotein translocase subunit TatA              65.1    2e-10   
ref|WP_032526670.1|  preprotein translocase subunit TatA              65.1    2e-10   
gb|KGG08202.1|  Twin-arginine translocation protein TatA              65.9    2e-10   
ref|WP_032515017.1|  translocase                                      63.9    3e-10   
ref|WP_002808122.1|  MULTISPECIES: preprotein translocase subunit...  64.7    3e-10   
ref|WP_025931391.1|  MULTISPECIES: preprotein translocase subunit...  64.7    3e-10   
gb|KGG16679.1|  Twin-arginine translocation protein TatA              63.9    3e-10   
ref|WP_015230087.1|  twin arginine-targeting protein translocase,...  64.7    3e-10   
ref|WP_036921460.1|  preprotein translocase subunit TatA              64.7    3e-10   
ref|WP_011125382.1|  MULTISPECIES: translocase                        64.3    3e-10   
ref|WP_025939386.1|  MULTISPECIES: translocase                        63.9    3e-10   
ref|WP_032520463.1|  preprotein translocase subunit TatA              64.3    3e-10   
ref|WP_042849833.1|  preprotein translocase subunit TatA              64.3    4e-10   
ref|WP_011819696.1|  preprotein translocase subunit TatA              64.3    4e-10   
ref|WP_025927350.1|  MULTISPECIES: preprotein translocase subunit...  64.3    4e-10   
ref|WP_011817838.1|  preprotein translocase subunit TatA              64.3    4e-10   
ref|WP_019476887.1|  hypothetical protein                             64.7    4e-10   
ref|WP_025980516.1|  translocase                                      63.5    4e-10   
ref|XP_010917652.1|  PREDICTED: sec-independent protein transloca...  64.7    5e-10   
ref|WP_017290542.1|  hypothetical protein                             64.3    5e-10   
ref|WP_025947718.1|  preprotein translocase subunit TatA              63.5    7e-10   
ref|WP_025924185.1|  MULTISPECIES: preprotein translocase subunit...  63.5    7e-10   
ref|WP_025953436.1|  preprotein translocase subunit TatA              63.5    7e-10   
ref|WP_025890446.1|  preprotein translocase subunit TatA              63.5    7e-10   
ref|WP_032515612.1|  preprotein translocase subunit TatA              63.5    8e-10   
ref|WP_025922921.1|  preprotein translocase subunit TatA              63.5    8e-10   
ref|WP_025914192.1|  preprotein translocase subunit TatA              63.5    8e-10   
ref|WP_025894022.1|  MULTISPECIES: preprotein translocase subunit...  63.2    8e-10   
ref|WP_025891414.1|  MULTISPECIES: preprotein translocase subunit...  63.2    8e-10   
ref|WP_029982994.1|  preprotein translocase subunit TatA              63.2    9e-10   
ref|WP_025927997.1|  preprotein translocase subunit TatA              63.2    9e-10   
ref|WP_025929169.1|  preprotein translocase subunit TatA              62.8    1e-09   
ref|WP_023408438.1|  hypothetical protein                             62.8    1e-09   
ref|WP_026100045.1|  prohead protease                                 62.0    1e-09   
ref|WP_011131980.1|  preprotein translocase subunit TatA              62.8    1e-09   
gb|EGJ35383.1|  twin arginine-targeting protein translocase, TatA...  62.8    1e-09   
ref|WP_015402314.1|  twin arginine-targeting protein translocase,...  62.4    2e-09   
emb|CAN65505.1|  hypothetical protein VITISV_028343                   63.5    2e-09   
gb|EMT18555.1|  hypothetical protein F775_30996                       61.2    2e-09   
ref|XP_011087507.1|  PREDICTED: psbP domain-containing protein 1,...  64.7    3e-09   
ref|XP_010255316.1|  PREDICTED: sec-independent protein transloca...  63.9    3e-09   
ref|XP_010255314.1|  PREDICTED: sec-independent protein transloca...  63.9    3e-09   
ref|XP_010255313.1|  PREDICTED: sec-independent protein transloca...  64.3    3e-09   
ref|XP_009774620.1|  PREDICTED: sec-independent protein transloca...  62.0    3e-09   
ref|XP_010255315.1|  PREDICTED: sec-independent protein transloca...  63.5    4e-09   
ref|WP_032514028.1|  preprotein translocase subunit TatA              61.6    4e-09   
ref|WP_025971433.1|  preprotein translocase subunit TatA              60.1    6e-09   
ref|WP_038146540.1|  hypothetical protein                             60.5    6e-09   
ref|WP_013886861.1|  preprotein translocase subunit TatA              60.5    7e-09   
ref|XP_008379943.1|  PREDICTED: sec-independent protein transloca...  60.1    8e-09   
ref|WP_005998440.1|  preprotein translocase subunit TatA              59.7    9e-09   
gb|EKD36228.1|  Twin-arginine translocation protein TatA/E            60.1    1e-08   
ref|WP_039745004.1|  preprotein translocase subunit TatA              59.7    2e-08   
ref|WP_040484823.1|  preprotein translocase subunit TatA              58.9    2e-08   
gb|AFW58102.1|  high chlorophyll fluorescence106c                     61.6    3e-08   
ref|NP_001104973.1|  HCF106C precursor protein                        61.6    3e-08   
ref|NP_001105878.1|  sec-independent protein translocase protein ...  62.0    3e-08   
emb|CDN11968.1|  Twin-arginine translocation protein TatB             58.5    3e-08   
ref|XP_002446330.1|  hypothetical protein SORBIDRAFT_06g014410        61.6    3e-08   
gb|ACN31099.1|  unknown                                               61.6    3e-08   
ref|WP_015116966.1|  twin arginine-targeting protein translocase,...  58.2    3e-08   
ref|WP_002773949.1|  prohead protease                                 58.2    3e-08   
ref|WP_038324418.1|  hypothetical protein                             58.9    3e-08   
ref|WP_002733416.1|  prohead protease                                 58.2    3e-08   
ref|XP_007038767.1|  Bacterial sec-independent translocation prot...  61.6    4e-08   
ref|XP_010035161.1|  PREDICTED: sec-independent protein transloca...  61.2    4e-08   
ref|WP_015718151.1|  preprotein translocase subunit TatA              58.5    5e-08   
emb|CDY38919.1|  BnaA03g12600D                                        61.2    5e-08   
ref|WP_019156623.1|  hypothetical protein                             57.8    5e-08   
ref|WP_012595045.1|  MULTISPECIES: prohead protease                   57.8    5e-08   
ref|WP_013162920.1|  preprotein translocase subunit TatA              58.2    5e-08   
ref|WP_038048152.1|  preprotein translocase subunit TatA              58.2    5e-08   
ref|XP_006279826.1|  hypothetical protein CARUB_v10028150mg           61.2    6e-08   
ref|WP_006694806.1|  Sec-independent protein translocase protein ...  57.8    6e-08   
ref|WP_019550705.1|  preprotein translocase subunit TatA              58.2    6e-08   
ref|WP_038031563.1|  preprotein translocase subunit TatA              58.5    6e-08   
ref|XP_007038768.1|  Bacterial sec-independent translocation prot...  60.1    6e-08   
ref|WP_038070485.1|  preprotein translocase subunit TatA              58.2    6e-08   
ref|WP_004513699.1|  primosome subunit DnaD                           58.2    7e-08   
gb|ACN36614.1|  unknown                                               58.9    7e-08   
ref|WP_002763330.1|  MULTISPECIES: prohead protease                   57.4    7e-08   
ref|WP_015127136.1|  twin-arginine translocation protein, TatA/E ...  57.4    7e-08   
ref|WP_007294095.1|  preprotein translocase subunit TatA              58.2    7e-08   
ref|WP_028494109.1|  preprotein translocase subunit TatA              58.2    8e-08   
gb|AGK51986.1|  twin-arginine translocation proteinTatA/E family ...  57.8    8e-08   
ref|WP_041580825.1|  prohead protease                                 57.4    8e-08   
ref|WP_006632937.1|  prohead protease                                 57.0    9e-08   
ref|WP_002769654.1|  prohead protease                                 57.0    1e-07   
ref|XP_006827568.1|  hypothetical protein AMTR_s00009p00224110        59.7    1e-07   
gb|KCW46454.1|  hypothetical protein EUGRSUZ_K00283                   59.3    1e-07   
ref|WP_044392335.1|  preprotein translocase subunit SecA              57.0    1e-07   
emb|CDP05165.1|  unnamed protein product                              60.5    1e-07   
ref|WP_014514826.1|  preprotein translocase subunit TatA              57.0    1e-07   
ref|WP_035230506.1|  preprotein translocase subunit TatA              57.0    1e-07   
ref|WP_028842558.1|  hypothetical protein                             57.8    1e-07   
ref|XP_004970559.1|  PREDICTED: sec-independent protein transloca...  60.1    1e-07   
ref|WP_012062253.1|  preprotein translocase subunit TatA              56.6    1e-07   
ref|WP_018111087.1|  preprotein translocase subunit TatA              57.0    1e-07   
ref|WP_025951424.1|  preprotein translocase subunit TatA              56.2    1e-07   
ref|WP_044077287.1|  hypothetical protein                             57.4    1e-07   
ref|XP_007038769.1|  Bacterial sec-independent translocation prot...  58.9    1e-07   
ref|WP_035545258.1|  hypothetical protein                             56.2    2e-07   
ref|WP_038058378.1|  preprotein translocase subunit TatA              57.0    2e-07   
ref|WP_039457958.1|  preprotein translocase subunit TatA              56.6    2e-07   
ref|WP_012546321.1|  twin arginine-targeting protein translocase ...  57.0    2e-07   
ref|WP_026696478.1|  preprotein translocase subunit TatA              55.8    2e-07   
emb|CCG45564.1|  sec-independent protein translocase protein TatA     56.2    2e-07   
gb|ELK21849.1|  twin arginine-targeting translocase, TatA/E famil...  56.2    2e-07   
ref|XP_009132526.1|  PREDICTED: sec-independent protein transloca...  58.9    2e-07   
ref|WP_035018658.1|  preprotein translocase subunit SecA              55.8    2e-07   
ref|WP_016329796.1|  twin arginine-targeting protein translocase,...  56.2    2e-07   
ref|WP_009361196.1|  MULTISPECIES: twin arginine translocase A        55.8    2e-07   
ref|WP_010940700.1|  primosome subunit DnaD                           57.0    2e-07   
dbj|GAC89906.1|  twin-arginine translocation protein TatA             56.2    2e-07   
ref|WP_012575061.1|  preprotein translocase subunit TatA              55.8    2e-07   
ref|WP_039647545.1|  preprotein translocase subunit TatA              57.0    3e-07   
gb|KHG30385.1|  Sec-independent translocase protein TatA              59.3    3e-07   
ref|WP_016950696.1|  hypothetical protein                             55.8    3e-07   
ref|WP_019508711.1|  hypothetical protein                             55.8    3e-07   
ref|XP_002864174.1|  HCF106                                           59.3    3e-07   
ref|WP_012470831.1|  prohead protease                                 56.2    3e-07   
ref|WP_009335913.1|  MULTISPECIES: preprotein translocase subunit...  55.8    3e-07   
ref|WP_010153029.1|  preprotein translocase subunit TatA              55.8    3e-07   
emb|CBL87174.1|  protein with similarity to twin-arginine translo...  55.8    3e-07   
ref|XP_009132527.1|  PREDICTED: sec-independent protein transloca...  58.2    3e-07   
ref|XP_010442771.1|  PREDICTED: sec-independent protein transloca...  58.9    4e-07   
ref|XP_006353895.1|  PREDICTED: sec-independent protein transloca...  59.3    4e-07   
ref|XP_006353894.1|  PREDICTED: sec-independent protein transloca...  59.3    4e-07   
ref|XP_006353893.1|  PREDICTED: sec-independent protein transloca...  59.3    4e-07   
ref|XP_006353892.1|  PREDICTED: sec-independent protein transloca...  59.3    4e-07   
ref|XP_006353891.1|  PREDICTED: sec-independent protein transloca...  59.3    4e-07   
ref|XP_002992704.1|  hypothetical protein SELMODRAFT_36641            55.5    4e-07   
ref|NP_200057.1|  sec-independent protein translocase protein TATB    58.9    4e-07   
ref|WP_021684585.1|  twin arginine-targeting protein translocase,...  55.5    4e-07   
ref|WP_011142996.1|  hypothetical protein                             55.8    4e-07   
ref|WP_021771622.1|  twin arginine-targeting protein translocase,...  55.5    4e-07   
gb|KJB34144.1|  hypothetical protein B456_006G049600                  58.5    5e-07   
gb|ACB00209.1|  twin-arginine translocation protein, TatA/E famil...  55.1    5e-07   
ref|WP_041601335.1|  preprotein translocase subunit SecA              55.1    5e-07   
ref|WP_026564126.1|  preprotein translocase subunit TatA              55.1    5e-07   
ref|XP_010317629.1|  PREDICTED: sec-independent protein transloca...  58.9    6e-07   
ref|XP_010317630.1|  PREDICTED: sec-independent protein transloca...  58.9    6e-07   
ref|XP_008779231.1|  PREDICTED: sec-independent protein transloca...  58.2    6e-07   
ref|XP_010317631.1|  PREDICTED: sec-independent protein transloca...  58.9    6e-07   
ref|XP_010317632.1|  PREDICTED: sec-independent protein transloca...  58.9    6e-07   
ref|XP_004234427.1|  PREDICTED: sec-independent protein transloca...  58.9    6e-07   
ref|XP_010317633.1|  PREDICTED: sec-independent protein transloca...  58.9    6e-07   
emb|CEG28936.1|  twin-arginine translocation protein TatA             54.7    6e-07   
ref|XP_010317634.1|  PREDICTED: sec-independent protein transloca...  58.5    7e-07   
ref|XP_010317635.1|  PREDICTED: sec-independent protein transloca...  58.5    7e-07   
ref|WP_003397248.1|  twin arginine translocase protein A              54.7    7e-07   
ref|WP_029979942.1|  preprotein translocase subunit TatA              55.1    7e-07   
ref|WP_026582608.1|  preprotein translocase subunit TatA              54.7    8e-07   
ref|WP_040930298.1|  prohead protease                                 54.3    8e-07   
ref|WP_036088389.1|  preprotein translocase subunit TatA              54.3    9e-07   
ref|XP_004496540.1|  PREDICTED: sec-independent protein transloca...  57.8    9e-07   
gb|EPS59585.1|  hypothetical protein M569_15219                       58.5    9e-07   
ref|WP_041443593.1|  prohead protease                                 54.3    9e-07   
ref|XP_010555674.1|  PREDICTED: sec-independent protein transloca...  57.8    9e-07   
ref|XP_002513673.1|  conserved hypothetical protein                   57.8    1e-06   
ref|WP_026689553.1|  hypothetical protein                             54.3    1e-06   
ref|WP_022851069.1|  preprotein translocase subunit TatA              54.7    1e-06   
ref|WP_017436200.1|  preprotein translocase subunit TatA              54.3    1e-06   
ref|XP_006401824.1|  hypothetical protein EUTSA_v10014513mg           57.4    1e-06   
ref|WP_030007305.1|  prohead protease                                 54.3    1e-06   
ref|WP_015179206.1|  Sec-independent protein translocase protein ...  54.3    1e-06   
ref|WP_012412063.1|  prohead protease                                 53.9    1e-06   
ref|WP_025942164.1|  MULTISPECIES: preprotein translocase subunit...  54.7    1e-06   
ref|WP_007356474.1|  MULTISPECIES: prohead protease                   53.9    1e-06   
ref|WP_044503511.1|  hypothetical protein                             54.3    1e-06   
ref|XP_010662697.1|  PREDICTED: sec-independent protein transloca...  57.4    1e-06   
ref|XP_010935799.1|  PREDICTED: sec-independent protein transloca...  57.4    1e-06   
ref|XP_002270827.1|  PREDICTED: sec-independent protein transloca...  57.4    1e-06   
ref|XP_004157194.1|  PREDICTED: sec-independent protein transloca...  57.4    1e-06   
ref|WP_043926097.1|  preprotein translocase subunit TatA              54.3    1e-06   
ref|XP_008234198.1|  PREDICTED: sec-independent protein transloca...  57.8    1e-06   
ref|XP_010935798.1|  PREDICTED: sec-independent protein transloca...  57.4    1e-06   
emb|CBI22684.3|  unnamed protein product                              57.4    1e-06   
emb|CDX91651.1|  BnaC02g15090D                                        57.0    1e-06   
ref|WP_018132250.1|  hypothetical protein                             54.3    1e-06   
ref|XP_003563823.1|  PREDICTED: sec-independent protein transloca...  57.0    1e-06   
gb|AGY57309.1|  twin arginine translocase protein A                   54.7    1e-06   
gb|KGF28105.1|  preprotein translocase subunit TatA                   53.9    2e-06   
ref|WP_026765329.1|  primosome subunit DnaD                           55.1    2e-06   
ref|XP_010935800.1|  PREDICTED: sec-independent protein transloca...  57.0    2e-06   
ref|WP_027890419.1|  preprotein translocase subunit TatA              53.9    2e-06   
ref|WP_023558807.1|  preprotein translocase subunit TatA              53.9    2e-06   
ref|WP_012937922.1|  prohead protease                                 53.9    2e-06   
ref|WP_039237474.1|  hypothetical protein                             53.9    2e-06   
ref|WP_034765465.1|  preprotein translocase subunit TatA              53.9    2e-06   
ref|WP_041244377.1|  hypothetical protein                             53.9    2e-06   
ref|XP_011048765.1|  PREDICTED: sec-independent protein transloca...  57.0    2e-06   
ref|WP_015214724.1|  Sec-independent protein translocase protein ...  53.5    2e-06   
gb|EEQ48169.1|  twin arginine-targeting protein translocase, TatA...  53.9    2e-06   
ref|XP_011076133.1|  PREDICTED: sec-independent protein transloca...  57.4    2e-06   
ref|XP_010935803.1|  PREDICTED: sec-independent protein transloca...  56.2    2e-06   
gb|KDP22247.1|  hypothetical protein JCGZ_26078                       55.8    2e-06   
gb|KDO51971.1|  hypothetical protein CISIN_1g023111mg                 56.2    2e-06   
gb|KDO51972.1|  hypothetical protein CISIN_1g023111mg                 56.2    2e-06   
ref|WP_015210399.1|  twin arginine-targeting protein translocase,...  53.1    2e-06   
ref|WP_016870212.1|  prohead protease                                 53.5    2e-06   
ref|WP_041281314.1|  preprotein translocase subunit SecA              54.3    2e-06   
ref|WP_006456113.1|  prohead protease                                 53.1    2e-06   
ref|WP_028052256.1|  primosome subunit DnaD                           53.1    2e-06   
gb|ACU24087.1|  unknown                                               56.6    2e-06   
ref|WP_011430879.1|  preprotein translocase subunit TatA              53.9    2e-06   
ref|WP_028585596.1|  preprotein translocase subunit TatA              53.5    2e-06   
ref|WP_008539032.1|  MULTISPECIES: translocase                        53.1    2e-06   
ref|XP_007143455.1|  hypothetical protein PHAVU_007G073200g           56.2    2e-06   
ref|WP_022197841.1|  sec-independent protein translocase protein ...  53.9    3e-06   
gb|ABW68975.1|  twin-arginine translocation protein, TatA/E famil...  54.3    3e-06   
ref|WP_009441372.1|  twin arginine-targeting protein translocase,...  53.5    3e-06   
ref|WP_009138980.1|  translocase                                      53.9    3e-06   
ref|WP_023072963.1|  prohead protease                                 53.1    3e-06   
ref|XP_007218349.1|  hypothetical protein PRUPE_ppa010991mg           56.2    3e-06   
ref|WP_009438175.1|  MULTISPECIES: twin arginine-targeting protei...  53.1    3e-06   
ref|WP_009728538.1|  TatA/E family twin arginine-targeting protei...  53.1    3e-06   
ref|WP_012419298.1|  twin-arginine translocation protein, TatA/E ...  53.9    3e-06   
ref|WP_009554242.1|  twin arginine-targeting protein translocase,...  53.1    3e-06   
ref|WP_036741818.1|  hypothetical protein                             53.1    3e-06   



>ref|XP_009785953.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Nicotiana sylvestris]
Length=157

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 6/95 (6%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            RT  + SN +K L CNCLFGLGVP LVVIAGV AL+FGPK+LP++GR +GKT+KSFQQAA
Sbjct  57   RTSKLVSNDKKGLSCNCLFGLGVPELVVIAGVAALVFGPKKLPDVGRSIGKTVKSFQQAA  116

Query  496  KEFETELKKEPD---ELPV---KEGGEEEKPDAVV  582
            KEFETELKKEPD   + PV   +E G+EEK DA V
Sbjct  117  KEFETELKKEPDASIDPPVEKAREIGQEEKQDASV  151



>ref|XP_009766133.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Nicotiana sylvestris]
Length=158

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 74/92 (80%), Gaps = 6/92 (7%)
 Frame = +1

Query  325  NVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEF  504
             VRS+G+K L CNCLFGLGVP LVVIAGV AL+FGPKQLPE+GR +GKT+KSFQQAAKEF
Sbjct  60   KVRSSGKKGLSCNCLFGLGVPELVVIAGVAALVFGPKQLPEVGRTIGKTVKSFQQAAKEF  119

Query  505  ETELKKEP---DELPVK---EGGEEEKPDAVV  582
            ETELKKEP    E PV+   E  +EEK DA V
Sbjct  120  ETELKKEPVASAEPPVEKAIEASQEEKQDATV  151



>ref|XP_006347746.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Solanum tuberosum]
Length=167

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 6/94 (6%)
 Frame = +1

Query  319  TCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAK  498
            T  VRSN ++ L C CLFGLGVP L VIAGV AL+FGPKQLPE+GR +GKT+KSFQQAAK
Sbjct  67   TRKVRSNSKRGLSCYCLFGLGVPELAVIAGVAALVFGPKQLPEVGRTIGKTVKSFQQAAK  126

Query  499  EFETELKKEPD---ELPVK---EGGEEEKPDAVV  582
            EFETEL+KEPD   + PV+   EG +EEK D  V
Sbjct  127  EFETELRKEPDASAQPPVEKAIEGSQEEKQDTKV  160



>ref|XP_009610432.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Nicotiana tomentosiformis]
Length=158

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 6/91 (7%)
 Frame = +1

Query  328  VRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFE  507
            V S+ +K   CNCLFGLGVP LVVIAGV AL+FGPKQLPE+GR +G+T+KSFQQAAKEFE
Sbjct  61   VTSSAKKGFSCNCLFGLGVPELVVIAGVAALVFGPKQLPEVGRTIGRTVKSFQQAAKEFE  120

Query  508  TELKKEPD---ELPVK---EGGEEEKPDAVV  582
            TELKKEP+   E P++   E  +EEK DA V
Sbjct  121  TELKKEPEASAEPPMEKAIEASQEEKQDATV  151



>ref|XP_004230095.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Solanum lycopersicum]
Length=160

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = +1

Query  187  AAIASAVSLSFAPKPTssvaafssssslf-----fssNPGGLKRSLG--LRTCNVRSNGR  345
            AA+ + +SLSF PKP SS ++ S+                  +  LG    T  VRSN +
Sbjct  9    AAVTTTLSLSFTPKPISSSSSSSAPKIQTLCSSSSLFFNSNSQLFLGPPTTTRKVRSNSK  68

Query  346  KRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE  525
            + L C CLFGLGVP L VIAGV AL+FGPKQLPE+GR +GKT+KSFQQAAKEFE+ELKKE
Sbjct  69   RGLSCYCLFGLGVPELAVIAGVAALVFGPKQLPEVGRNIGKTVKSFQQAAKEFESELKKE  128

Query  526  PD---ELPVK---EGGEEEKPDAVV  582
            PD   + PV+   E   EEK D  V
Sbjct  129  PDASAQPPVEKAIEVSHEEKQDTKV  153



>gb|AFK47858.1| unknown [Lotus japonicus]
Length=147

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 4/83 (5%)
 Frame = +1

Query  331  RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFET  510
            R N    L CN LFGLGVP LVVIAGV A++FGPK+LPE+GR +GKTLKSFQQAAKEFET
Sbjct  52   RRNKGTALTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTLKSFQQAAKEFET  111

Query  511  ELKKEPDELPVKEGGEEEKPDAV  579
            ELKKEPD +    GG+ E+P AV
Sbjct  112  ELKKEPDSI----GGQSEEPLAV  130



>gb|ACJ85933.1| unknown [Medicago truncatula]
 gb|AFK48565.1| unknown [Medicago truncatula]
 gb|KEH43020.1| twin arginine translocase [Medicago truncatula]
Length=139

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +1

Query  304  SLGLRTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSF  483
            SL L+    R+   KR  CN  FGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSF
Sbjct  39   SLLLKKARTRTRSTKRFTCNAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSF  98

Query  484  QQAAKEFETELKKEP---DELPVKEGGEEE  564
            QQAAKEFETELKKEP   +E+ V    E++
Sbjct  99   QQAAKEFETELKKEPNSTEEISVTNDQEDQ  128



>ref|XP_002279607.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Vitis vinifera]
 emb|CBI34159.3| unnamed protein product [Vitis vinifera]
Length=136

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = +1

Query  193  IASAVSLSFAPKPTssvaafssssslffssNPGGLKRSLGLRTCNVRSNGRKRLYCNCLF  372
            +A+A+ LS  PKPT +++  SS S+ F +       ++L +     R   +KRL C CLF
Sbjct  1    MAAALYLSSIPKPTQTLSFSSSHSNFFNA-------KTLVVARSRTRIRTQKRLTCTCLF  53

Query  373  GLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEP  528
            GLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSFQQAAKEFETELKKEP
Sbjct  54   GLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAAKEFETELKKEP  105



>ref|XP_003521755.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Glycine max]
 gb|KHN31463.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=143

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +1

Query  313  LRTCNVRSNGRKR---LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSF  483
              +  V  NGR+R   L CN +FGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSF
Sbjct  37   FNSARVAVNGRRRNKGLSCNAMFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSF  96

Query  484  QQAAKEFETELKKEPDELPVKEGGEEEKPDAVV  582
            QQAAKEFE+ELKKEPD     +G   EKP   V
Sbjct  97   QQAAKEFESELKKEPDS---TQGDSSEKPIVTV  126



>ref|NP_001238018.1| uncharacterized protein LOC100306385 [Glycine max]
 gb|ACU14531.1| unknown [Glycine max]
 gb|KHN43189.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=142

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 70/98 (71%), Gaps = 7/98 (7%)
 Frame = +1

Query  295  LKRSLGLRTCNVRSNGRKR---LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLG  465
            L  S+ +R   V  NGR R   L CN +FGLGVP LVVIAGV AL+FGPK+LPE+GR +G
Sbjct  31   LFNSVSVRVA-VNVNGRGRNKGLSCNAMFGLGVPELVVIAGVAALVFGPKKLPEVGRSIG  89

Query  466  KTLKSFQQAAKEFETELKKEPDELPVKEGGEEEKPDAV  579
            KT+KSFQQAAKEFE+ELKKEPD     EG   EK   V
Sbjct  90   KTVKSFQQAAKEFESELKKEPDS---TEGDSSEKSIVV  124



>ref|XP_007147171.1| hypothetical protein PHAVU_006G101800g [Phaseolus vulgaris]
 gb|ESW19165.1| hypothetical protein PHAVU_006G101800g [Phaseolus vulgaris]
Length=147

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = +1

Query  313  LRTCNVRSNGRKR---LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSF  483
            +R  +V+  GR+R   L CN +FGLG+P LVVIAGV AL+FGPK+LPE+GR +GKT+KSF
Sbjct  43   VRAVSVK-GGRRRNRGLTCNAIFGLGMPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSF  101

Query  484  QQAAKEFETELKKEPDELPVKEGGEEEKPDAV  579
            QQAAKEFE+ELKKEPD     EG   EKP A+
Sbjct  102  QQAAKEFESELKKEPDS---TEGDSSEKPIAI  130



>ref|XP_010550921.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Tarenaya hassleriana]
Length=150

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RKR  CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFE+ELKK
Sbjct  57   RKRFTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKK  116

Query  523  EPDELPVKEGGEEEKPDAV  579
            EPD  P  +    EKP  V
Sbjct  117  EPD--PPTDSSSAEKPVEV  133



>ref|XP_009364497.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Pyrus x bretschneideri]
Length=148

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = +1

Query  304  SLGLRTCNVRSN-GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKS  480
            + GLR    R+   +K + CN LFGLG+P +VVIAGV AL+FGPK+LPE+G+ +GKT+KS
Sbjct  46   AFGLRRSRTRTERAQKGMTCNALFGLGMPEIVVIAGVAALVFGPKKLPEVGKSIGKTVKS  105

Query  481  FQQAAKEFETELKKEPD---ELPVKEGGEEEKPDAVV  582
            FQQAAKEFETELKKEP+   E P     EEEK +A V
Sbjct  106  FQQAAKEFETELKKEPEGLTETPTA-VSEEEKQEAKV  141



>ref|XP_002531294.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31107.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 6/86 (7%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSFQ+AAKEFE+ELKK
Sbjct  57   RKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQEAAKEFESELKK  116

Query  523  EPDELPVKEG------GEEEKPDAVV  582
            EPD      G       EE+K DA V
Sbjct  117  EPDSALESPGETPTAISEEKKQDAEV  142



>ref|XP_011078758.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Sesamum indicum]
Length=141

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +1

Query  331  RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFET  510
            R+  ++ L CNCLFGLGVP LVVIAGVTAL+FGPK+LPE+GR +GKT+KSFQQAAKEFE+
Sbjct  50   RTAKKRGLSCNCLFGLGVPELVVIAGVTALVFGPKKLPEVGRSIGKTVKSFQQAAKEFES  109

Query  511  ELKK------EPDELPVKEGGEEEKPD  573
            ELKK      EP    +    EEEK +
Sbjct  110  ELKKEGESSAEPSSEKITTASEEEKQE  136



>emb|CDP06816.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +1

Query  313  LRTCNVRSNGRKR-LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQ  489
            ++  +  S  RKR L C CLFGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSFQQ
Sbjct  50   IKNNSASSRARKRGLSCTCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQ  109

Query  490  AAKEFETELKKEP  528
            AAKEFE+ELKKEP
Sbjct  110  AAKEFESELKKEP  122



>ref|XP_004495801.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Cicer arietinum]
Length=135

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = +1

Query  304  SLGLRTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSF  483
            S+ L+   + S   K   C   FGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSF
Sbjct  34   SVVLKKARISSRRTKGFTCKAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSF  93

Query  484  QQAAKEFETELKKEP---DELPVKEGGEEE  564
            QQAAKEFETELKKEP   +E+PV    EE+
Sbjct  94   QQAAKEFETELKKEPNSTEEIPVTSDQEEQ  123



>gb|EEC75796.1| hypothetical protein OsI_12727 [Oryza sativa Indica Group]
Length=171

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 10/82 (12%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE--  525
            + C CLFGLGVP LVVIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKE  
Sbjct  79   MGCKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKESD  138

Query  526  --------PDELPVKEGGEEEK  567
                    P E  V +GGEE+K
Sbjct  139  DGGDQPPPPTETAVSDGGEEKK  160



>ref|NP_001050716.1| Os03g0634000 [Oryza sativa Japonica Group]
 sp|Q75GK3.1|TATA_ORYSJ RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|AAS07275.1| putative sec-independent protein transporter [Oryza sativa Japonica 
Group]
 gb|ABF97773.1| twin-arginine translocation protein, TatA/E family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12630.1| Os03g0634000 [Oryza sativa Japonica Group]
 dbj|BAG88816.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59547.1| hypothetical protein OsJ_11824 [Oryza sativa Japonica Group]
Length=170

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 10/85 (12%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE--  525
            + C CLFGLGVP LVVIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKE  
Sbjct  79   MGCKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKESD  138

Query  526  --------PDELPVKEGGEEEKPDA  576
                    P E  V +GGEE++ +A
Sbjct  139  DGGDQPPPPTETAVSDGGEEKELEA  163



>gb|KDP23662.1| hypothetical protein JCGZ_23495 [Jatropha curcas]
Length=148

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = +1

Query  346  KRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE  525
            K L CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFE+ELKKE
Sbjct  57   KGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKKE  116

Query  526  PDELPVKEGGEEEKPDAV  579
            PD L    G   EKP  V
Sbjct  117  PDSLSDSPG---EKPTGV  131



>ref|XP_009398562.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=146

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  331  RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFET  510
            R +G   L C CLFGLGVP LVVIAGV AL+FGPK+LPEIGR  GKT+KSFQQAAKEFET
Sbjct  48   RQHGSGALGCRCLFGLGVPELVVIAGVAALVFGPKKLPEIGRSFGKTIKSFQQAAKEFET  107

Query  511  ELKKEPDE  534
            ELKK+P++
Sbjct  108  ELKKDPED  115



>ref|XP_008345714.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Malus domestica]
Length=148

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 4/84 (5%)
 Frame = +1

Query  340  GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
              K + C  LFGLG+P LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFETELK
Sbjct  59   AZKGMTCTALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFETELK  118

Query  520  KEPD---ELPVKEGGEEEKPDAVV  582
            KEP+   E P     EEEK DA V
Sbjct  119  KEPEGLTETPTA-ASEEEKQDAKV  141



>ref|XP_011032407.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Populus euphratica]
Length=148

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 6/87 (7%)
 Frame = +1

Query  340  GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
             +K L CN LFGLGVP LVVIAGV  L+FGPKQLPE+GR +GKT+KSFQQAAKEFE+ELK
Sbjct  55   AKKGLTCNALFGLGVPELVVIAGVATLLFGPKQLPEVGRSIGKTVKSFQQAAKEFESELK  114

Query  520  KEPDELPVKEG------GEEEKPDAVV  582
            KEPD      G       EE+K D  V
Sbjct  115  KEPDSTSDTPGEQPTTISEEKKHDIAV  141



>ref|XP_006650323.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Oryza brachyantha]
Length=93

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            + C CLFGLGVP LVVIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKEP+
Sbjct  1    MGCKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPE  60

Query  532  E  534
            +
Sbjct  61   D  61



>ref|XP_002319073.2| thylakoid assembly family protein [Populus trichocarpa]
 gb|EEE94996.2| thylakoid assembly family protein [Populus trichocarpa]
Length=149

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            +T +     +K L CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT++SFQQAA
Sbjct  48   KTTSGSQRAKKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVRSFQQAA  107

Query  496  KEFETELKKEPDELPVKEGGEEEKPDAVV  582
            KEFE+ELKKEP+  P   G   E+P A++
Sbjct  108  KEFESELKKEPESEPETPG---EQPKAII  133



>gb|KJB82529.1| hypothetical protein B456_013G200900 [Gossypium raimondii]
Length=157

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 6/84 (7%)
 Frame = +1

Query  340  GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
             +K L CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFETELK
Sbjct  64   AKKGLTCNALFGLGVPELVVIAGVAALLFGPKKLPEVGKSIGKTVKSFQQAAKEFETELK  123

Query  520  KEPDELP------VKEGGEEEKPD  573
            KEP+ +            EE+KPD
Sbjct  124  KEPESITEQPKENTSAVSEEKKPD  147



>gb|ABK93649.1| unknown [Populus trichocarpa]
Length=150

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            +T +     +K L CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT++SFQQAA
Sbjct  48   KTTSGSQRAKKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVRSFQQAA  107

Query  496  KEFETELKKEPDELPVKEGGEEEKPDAVV  582
            KEFE+ELKKEP+  P   G   E+P A++
Sbjct  108  KEFESELKKEPESEPETPG---EQPKAII  133



>gb|KHG04000.1| Sec-independent translocase protein TatA [Gossypium arboreum]
Length=157

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 6/84 (7%)
 Frame = +1

Query  340  GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
             +K L CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFETELK
Sbjct  64   AKKGLTCNALFGLGVPELVVIAGVAALLFGPKKLPEVGKSIGKTVKSFQQAAKEFETELK  123

Query  520  KEPDELPV--KEG----GEEEKPD  573
            KEP+ +    KE      EE+KPD
Sbjct  124  KEPESMTEQPKENTTAVSEEKKPD  147



>ref|XP_004302052.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=150

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +1

Query  340  GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
             RK L CN LFGLGVP L VIAGV AL+FGPK+LPE+G+ LGKT+KSFQQAAKEFETELK
Sbjct  57   ARKGLTCNALFGLGVPELAVIAGVAALVFGPKKLPEVGKSLGKTIKSFQQAAKEFETELK  116

Query  520  KEPD---ELPVKE---GGEEEKPDAVV  582
            KEP+   E+   E     EE+KP+  V
Sbjct  117  KEPEPNTEVLTDEPTTVSEEQKPEVKV  143



>gb|KFK31934.1| hypothetical protein AALP_AA6G178200 [Arabis alpina]
Length=135

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  48   RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  107

Query  523  EP-DELPVKEGGEEEKPDAV  579
            EP D +PV    +E++   V
Sbjct  108  EPEDSVPVATSNQEDEKTEV  127



>gb|ABK93003.1| unknown [Populus trichocarpa]
Length=148

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +1

Query  304  SLGLRTCNVRSN-GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKS  480
            SL L     RS   +K L CN LFGLGVP LVVIAGV  L+FGPKQLPE+GR +GKT+KS
Sbjct  42   SLVLGKTRSRSQRAKKGLTCNALFGLGVPELVVIAGVATLLFGPKQLPEVGRSIGKTVKS  101

Query  481  FQQAAKEFETELKKEPD  531
            FQQAAKEFE+ELKKEPD
Sbjct  102  FQQAAKEFESELKKEPD  118



>ref|XP_004494699.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Cicer arietinum]
Length=144

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 3/67 (4%)
 Frame = +1

Query  331  RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFET  510
            R+NG   L CN LFGLGVP LVVIAGV A++FGPK+LPE+GR +GKT+KSFQQAAKEFE+
Sbjct  51   RNNG---LTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVKSFQQAAKEFES  107

Query  511  ELKKEPD  531
            ELKKEPD
Sbjct  108  ELKKEPD  114



>ref|XP_006838884.1| hypothetical protein AMTR_s00002p00267770 [Amborella trichopoda]
 gb|ERN01453.1| hypothetical protein AMTR_s00002p00267770 [Amborella trichopoda]
Length=140

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  319  TCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAK  498
            + N RS+G   L C CLFGLGVP LVVIAGV A++FGPK+LPE+GR +GKT++SFQQAAK
Sbjct  45   SLNRRSHGNAGLNCRCLFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVRSFQQAAK  104

Query  499  EFETELKKEPDEL  537
            EFETELKK+ + +
Sbjct  105  EFETELKKDKETI  117



>ref|XP_009389019.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RSLGLRTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKS  480
            R+L  R    RS G   L C CLFGLGVP LVVIAGV AL+FGPK LPEIGR +GKT+KS
Sbjct  44   RALQRRLRPGRSGG---LGCRCLFGLGVPELVVIAGVAALVFGPKNLPEIGRSIGKTVKS  100

Query  481  FQQAAKEFETELKKEPDE  534
            FQQAAKEFETELKK+P++
Sbjct  101  FQQAAKEFETELKKDPED  118



>ref|XP_011078757.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Sesamum indicum]
Length=148

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +1

Query  331  RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFET  510
            R   ++ L CNCLFGLGVP LVVIAGV AL+FGPKQLPE+GR +GKT+KSFQQAAKEFE+
Sbjct  50   RRAKKRGLSCNCLFGLGVPELVVIAGVAALVFGPKQLPEVGRSIGKTVKSFQQAAKEFES  109

Query  511  ELKK------EPDELPVKEGGEEEKPDAVV  582
            ELKK      EP    +    EEEK +  V
Sbjct  110  ELKKEGETSAEPSVEKITTVSEEEKQEGKV  139



>ref|XP_008388678.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Malus domestica]
Length=148

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            + CN LFGLG+P LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFETELKKEP+
Sbjct  63   MTCNALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFETELKKEPE  122

Query  532  ---ELPVKEGGEEEKPDAVV  582
               E P     EEEK +A V
Sbjct  123  GLTETPTA-VSEEEKQEAKV  141



>gb|EYU33033.1| hypothetical protein MIMGU_mgv1a021859mg [Erythranthe guttata]
Length=97

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
              CNCLFGLGVP LVVIAGV  ++FGPKQLPE+GR +GKT+KSFQQAAKEFETELKK+P+
Sbjct  9    FSCNCLFGLGVPELVVIAGVAVILFGPKQLPEVGRSIGKTVKSFQQAAKEFETELKKDPE  68



>ref|XP_002874447.1| hypothetical protein ARALYDRAFT_489661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50706.1| hypothetical protein ARALYDRAFT_489661 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RKRL CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  55   RKRLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKI  114

Query  523  EPDE  534
            EP++
Sbjct  115  EPED  118



>ref|XP_007206084.1| hypothetical protein PRUPE_ppa012899mg [Prunus persica]
 gb|EMJ07283.1| hypothetical protein PRUPE_ppa012899mg [Prunus persica]
Length=150

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +K L CN LFGLG+P LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFETELKK
Sbjct  62   KKGLTCNALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFETELKK  121

Query  523  EPDEL  537
            EP+ L
Sbjct  122  EPEAL  126



>ref|XP_009111899.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Brassica rapa]
Length=141

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  50   RKALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  109

Query  523  EPDE  534
            EP+E
Sbjct  110  EPEE  113



>ref|XP_006588399.1| PREDICTED: uncharacterized protein LOC100500409 isoform X1 [Glycine 
max]
Length=136

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 9/97 (9%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            R   + +   K L CN LFGLG+P L VIAGV AL FGPK LP++GR LGKT+KSFQQAA
Sbjct  34   RKARISTRRSKALTCNALFGLGLPELAVIAGVAALAFGPKNLPQVGRSLGKTIKSFQQAA  93

Query  496  KEFETELKKEPD---------ELPVKEGGEEEKPDAV  579
            KEFE+E+KKEPD         E P+    +EE+   V
Sbjct  94   KEFESEIKKEPDSTEENPTAAEKPIAASKQEEQETKV  130



>ref|XP_004982373.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Setaria italica]
Length=170

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +1

Query  358  CNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            C CLFGLGVP LVVIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKEP E
Sbjct  80   CKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRNIGKTVKSFQQAAKEFETELKKEPGE  138



>ref|XP_008218264.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Prunus mume]
Length=150

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 7/79 (9%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +K L CN LFGLG+P LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFETELKK
Sbjct  62   KKGLTCNALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFETELKK  121

Query  523  EPDELPVKEGGEEEKPDAV  579
            EP+ L        E P AV
Sbjct  122  EPEALT-------ETPTAV  133



>gb|ACN32121.1| unknown [Zea mays]
 tpg|DAA50382.1| TPA: thylakoid assembly4 [Zea mays]
Length=170

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  358  CNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            C CLFGLGVP L VIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKEP E
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPGE  140



>ref|NP_001104942.1| sec-independent protein translocase protein TATA, chloroplastic 
[Zea mays]
 sp|Q9XFJ8.1|TATA_MAIZE RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Zea mays]
 gb|AAD31522.1|AF145755_1 THA4 [Zea mays]
Length=170

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  358  CNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            C CLFGLGVP L VIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKEP E
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPGE  140



>ref|NP_001150512.1| THA4 [Zea mays]
 gb|ACG39360.1| THA4 [Zea mays]
Length=170

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  358  CNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            C CLFGLGVP L VIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKEP E
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPGE  140



>ref|XP_010495580.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like, partial [Camelina sativa]
Length=106

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  14   RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  73

Query  523  EP-----DELPVKEGGEEEKPDAVV  582
            EP     D  PV    +EE+  A V
Sbjct  74   EPEDSVTDSSPVAMSNKEEEKKAEV  98



>ref|XP_007030572.1| Bacterial sec-independent translocation protein mttA/Hcf106 [Theobroma 
cacao]
 gb|EOY11074.1| Bacterial sec-independent translocation protein mttA/Hcf106 [Theobroma 
cacao]
Length=153

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +1

Query  340  GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
             ++ L CN LFGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSFQQAAKEFE+ELK
Sbjct  62   AKRGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAAKEFESELK  121

Query  520  KEPDELPVKEGGEEEKPDAVV  582
            K P E P +    EE P AV+
Sbjct  122  KSP-ESPTEPS--EENPTAVI  139



>ref|XP_010528803.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Tarenaya hassleriana]
Length=151

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = +1

Query  319  TCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAK  498
            T N+RS  +K   C  LFGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT++SFQ+AAK
Sbjct  53   TRNLRS--KKGFTCYALFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVRSFQEAAK  110

Query  499  EFETELKKEPDELPVKEGGEEEKPDAV  579
            EFE+ELKKEP E      GE +KP AV
Sbjct  111  EFESELKKEPAEALAD--GEGDKPKAV  135



>emb|CDX86209.1| BnaA06g29260D [Brassica napus]
Length=144

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  51   RKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  110

Query  523  EPDE------LPVKEGGEEEKPDAV  579
            EP++       PV    +EE+ + V
Sbjct  111  EPEDSVAGSSSPVAMSNKEEEKNEV  135



>sp|Q9XH46.1|TATA_PEA RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Pisum sativum]
 gb|AAD33943.1|AF144708_1 Tha4 protein [Pisum sativum]
Length=137

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = +1

Query  328  VRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFE  507
            +++   K   CN  FGLGVP LVVIAGV AL+FGPK+LPE+GR +G+T+KSFQQAAKEFE
Sbjct  45   IKTRTTKGFTCNAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGQTVKSFQQAAKEFE  104

Query  508  TELKKEPDELPVKE---GGEEEKPDAVV  582
            TELKKEP+  P +E     E+EK +  V
Sbjct  105  TELKKEPN--PTEEISVASEQEKQEIKV  130



>gb|KHN16199.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=139

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 9/97 (9%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            R   + +   K L CN LFGLG+P L VIAGV AL FGPK LP++GR LGKT+KSFQQAA
Sbjct  37   RKARISTRRSKALTCNALFGLGLPELAVIAGVAALAFGPKNLPQVGRSLGKTIKSFQQAA  96

Query  496  KEFETELKKEPD---------ELPVKEGGEEEKPDAV  579
            KEFE+E+KKEPD         E P+    +EE+   V
Sbjct  97   KEFESEIKKEPDSTEENPTAAEKPIAASKQEEQETKV  133



>ref|XP_010455196.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Camelina sativa]
Length=146

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  54   RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  113

Query  523  EP-----DELPVKEGGEEEKPDAVV  582
            EP     D  PV    +EE+  A V
Sbjct  114  EPEDSVTDSSPVAMSNKEEEKKAEV  138



>gb|KHN04931.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=146

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            R   + +   K L CN LFGLGVP LVVIAGV  L FGPK LP++GR +GKT+KSFQQAA
Sbjct  43   RKARISTRRSKALTCNALFGLGVPELVVIAGVAVLAFGPKNLPQVGRSIGKTIKSFQQAA  102

Query  496  KEFETELKKEPD  531
            KEFE+E+KKEPD
Sbjct  103  KEFESEIKKEPD  114



>ref|XP_009399359.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009399360.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=153

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            L C C+FGLGVP LVVIAGVTAL+FGPK+LPEIGR  GKT+KSFQQAAKEFETELKK P+
Sbjct  61   LGCRCMFGLGVPELVVIAGVTALVFGPKKLPEIGRSFGKTVKSFQQAAKEFETELKKGPE  120

Query  532  E  534
            +
Sbjct  121  D  121



>gb|ACG40026.1| THA4 [Zea mays]
Length=161

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            L C CLFGLGVP L VIAGV AL+FGPKQLPEIGR LGKT+KSFQ+AAKEFE+ELKKEP 
Sbjct  70   LGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSLGKTVKSFQEAAKEFESELKKEPG  129

Query  532  E  534
            E
Sbjct  130  E  130



>ref|XP_009151263.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Brassica rapa]
Length=144

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  51   RKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  110

Query  523  EPDE  534
            EP++
Sbjct  111  EPED  114



>ref|XP_009129537.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like, partial [Brassica rapa]
Length=142

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  49   RKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  108

Query  523  EPDE  534
            EP++
Sbjct  109  EPED  112



>ref|NP_198227.1| sec-independent protein translocase protein TatA  [Arabidopsis 
thaliana]
 sp|Q9LKU2.1|TATA_ARATH RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG40358.1|AF325006_1 AT5g28750 [Arabidopsis thaliana]
 gb|AAF67362.1| Hypothetical protein T32B20.e [Arabidopsis thaliana]
 gb|AAL07125.1| putative Tha4 protein [Arabidopsis thaliana]
 gb|AAM14368.1| putative Tha4 protein [Arabidopsis thaliana]
 gb|AED93831.1| sec-independent protein translocase protein TatA [Arabidopsis 
thaliana]
Length=147

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  55   RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  114

Query  523  EPDE  534
            EP+E
Sbjct  115  EPEE  118



>emb|CDY57016.1| BnaA09g03480D [Brassica napus]
Length=141

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  50   RKALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  109

Query  523  EPDE  534
            EP++
Sbjct  110  EPED  113



>ref|XP_008450744.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Cucumis melo]
 ref|XP_008450746.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Cucumis melo]
Length=158

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
             K L CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFE+ELKK
Sbjct  66   HKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKK  125

Query  523  EPD  531
            EP+
Sbjct  126  EPE  128



>ref|NP_001237608.1| uncharacterized protein LOC100500409 [Glycine max]
 gb|ACU15483.1| unknown [Glycine max]
Length=138

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 63/93 (68%), Gaps = 9/93 (10%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            R   + +   K L CN LFGLG+P L VIAGV AL FGPK LP++GR LGKT+KSFQQAA
Sbjct  34   RKARISTRRSKALTCNALFGLGLPELAVIAGVAALAFGPKNLPQVGRSLGKTIKSFQQAA  93

Query  496  KEFETELKKEPD---------ELPVKEGGEEEK  567
            KEFE+E+KKEPD         E P+    +EE+
Sbjct  94   KEFESEIKKEPDSTEENPTAAEKPIAASKQEEQ  126



>ref|XP_002464206.1| hypothetical protein SORBIDRAFT_01g014100 [Sorghum bicolor]
 gb|EER91204.1| hypothetical protein SORBIDRAFT_01g014100 [Sorghum bicolor]
Length=173

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            L C CLFGLGVP L VIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFE+ELKKEP 
Sbjct  82   LGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFESELKKEPG  141

Query  532  E  534
            E
Sbjct  142  E  142



>emb|CDY00023.1| BnaC09g02780D [Brassica napus]
Length=142

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  51   RKALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  110

Query  523  EPDE  534
            EP++
Sbjct  111  EPED  114



>emb|CDY48664.1| BnaC07g27450D [Brassica napus]
Length=146

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  51   RKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  110

Query  523  EPD  531
            EP+
Sbjct  111  EPE  113



>ref|XP_006288854.1| hypothetical protein CARUB_v10002208mg [Capsella rubella]
 gb|EOA21752.1| hypothetical protein CARUB_v10002208mg [Capsella rubella]
Length=146

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  54   RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  113

Query  523  EP-----DELPVKEGGEEEK  567
            EP     D  PV    +EE+
Sbjct  114  EPEDSVTDSSPVAMSNKEEE  133



>ref|XP_010421703.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Camelina sativa]
 ref|XP_010421704.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Camelina sativa]
Length=146

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            RK L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+KSFQQAAKEFE+ELK 
Sbjct  54   RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  113

Query  523  EP-----DELPVKEGGEEEK  567
            EP     D  PV    +EE+
Sbjct  114  EPEDSVTDSSPVAMSNKEEE  133



>ref|NP_001104943.1| tha9 protein [Zea mays]
 gb|AAD31523.1|AF145756_1 THA9 [Zea mays]
 gb|AFW68189.1| THA9 [Zea mays]
Length=169

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            L C CLFGLGVP L VIAGV AL+FGPKQLPEIGR LGKT+KSFQ+AAKEFE+ELKKEP 
Sbjct  70   LGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSLGKTVKSFQEAAKEFESELKKEPG  129

Query  532  E  534
            E
Sbjct  130  E  130



>ref|XP_003556468.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like isoform X1 [Glycine max]
Length=142

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  316  RTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAA  495
            R   + +   K L CN LFGLGVP LVVIAGV  L FGPK  P++GR +GKT+KSFQQAA
Sbjct  39   RKARISTRRSKALTCNALFGLGVPELVVIAGVAVLAFGPKNFPQVGRSIGKTIKSFQQAA  98

Query  496  KEFETELKKEPD  531
            KEFE+E+KKEPD
Sbjct  99   KEFESEIKKEPD  110



>emb|CDY05605.1| BnaC02g39320D [Brassica napus]
Length=147

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            R  L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ LGKT+KSFQQAAKEFE+ELK 
Sbjct  50   RNALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSLGKTVKSFQQAAKEFESELKT  109

Query  523  EP-----DELPVKEGGE-EEKPD  573
            EP     D  P+    + EEKP+
Sbjct  110  EPEDSVADSSPIAMSNKAEEKPE  132



>ref|XP_004135654.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Cucumis sativus]
 gb|KGN66148.1| hypothetical protein Csa_1G573670 [Cucumis sativus]
Length=158

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
             K   CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFE+ELKK
Sbjct  66   HKGFTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKK  125

Query  523  EPD  531
            EP+
Sbjct  126  EPE  128



>gb|EYU22665.1| hypothetical protein MIMGU_mgv1a016077mg [Erythranthe guttata]
Length=135

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            ++ L CNCLFGLGVP + VIAGV AL+FGPK+LPE+GR +GKTLK FQQAAKEFETELK 
Sbjct  53   KRGLSCNCLFGLGVPEIAVIAGVVALVFGPKKLPEVGRSIGKTLKGFQQAAKEFETELKS  112

Query  523  --EPDELPVKEGGEEEK  567
              EP    +    EEEK
Sbjct  113  DVEPSAEKITTVAEEEK  129



>ref|XP_004171639.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like, partial [Cucumis sativus]
Length=146

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
             K   CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFE+ELKK
Sbjct  54   HKGFTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKK  113

Query  523  EPD  531
            EP+
Sbjct  114  EPE  116



>ref|XP_010923487.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Elaeis guineensis]
Length=154

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 7/87 (8%)
 Frame = +1

Query  337  NGRKR------LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAK  498
            +GR+R      L C CLFGLGVP LVVIAGV AL+FG K LPE+GR +GKT+KSFQQAAK
Sbjct  51   SGRRRKGSSGGLGCRCLFGLGVPELVVIAGVAALVFGTKNLPEMGRSIGKTVKSFQQAAK  110

Query  499  EFETELKKEPDELPVKEGGEEEKPDAV  579
            EFETELKK+ DE   K     E P AV
Sbjct  111  EFETELKKD-DEDASKPTSPAESPKAV  136



>ref|XP_010936083.1| PREDICTED: LOW QUALITY PROTEIN: sec-independent protein translocase 
protein TATA, chloroplastic-like [Elaeis guineensis]
Length=153

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 60/81 (74%), Gaps = 9/81 (11%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE--  525
            L C CLFGLGVP LVVIAGV AL+FGPK+LPEIGR +GKT+KSFQQAAKEFETELKK+  
Sbjct  61   LGCRCLFGLGVPELVVIAGVAALVFGPKKLPEIGRSIGKTVKSFQQAAKEFETELKKDGE  120

Query  526  -------PDELPVKEGGEEEK  567
                   P E P     E+EK
Sbjct  121  DASKPPPPAESPKAVSSEDEK  141



>gb|EMS64861.1| CBL-interacting protein kinase 7 [Triticum urartu]
Length=354

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            L C CLFGLGVP +VVIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFETELKKEP 
Sbjct  275  LGCKCLFGLGVPEMVVIAGVAALLFGPKQLPEIGRSVGKTVKSFQQAAKEFETELKKEPG  334

Query  532  E  534
            E
Sbjct  335  E  335



>ref|XP_010246331.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Nelumbo nucifera]
Length=146

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  331  RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFET  510
            RS  ++ +   CLFGLGVP LVVIAGV AL+FGPK+LPEIGR  GKTLKSFQQAAKEFE+
Sbjct  50   RSKTQRGVNPRCLFGLGVPELVVIAGVAALVFGPKKLPEIGRSFGKTLKSFQQAAKEFES  109

Query  511  ELKKEPD  531
            ELKK+P+
Sbjct  110  ELKKDPE  116



>gb|AFK44195.1| unknown [Medicago truncatula]
 gb|KEH24553.1| twin arginine translocase [Medicago truncatula]
Length=144

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 3/67 (4%)
 Frame = +1

Query  328  VRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFE  507
            + +NG     CN LFGLGVP LVVIAGV A++FGPK+LPE+GR +GKT+KSFQQAAKEFE
Sbjct  50   INNNG---FTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVKSFQQAAKEFE  106

Query  508  TELKKEP  528
            +ELKKEP
Sbjct  107  SELKKEP  113



>ref|XP_006395030.1| hypothetical protein EUTSA_v10005085mg [Eutrema salsugineum]
 gb|ESQ32316.1| hypothetical protein EUTSA_v10005085mg [Eutrema salsugineum]
Length=145

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +1

Query  301  RSLGLRTCNVRSNGR-KRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLK  477
            RSL      +R   R K L CN LFGLGVP L VIAGV AL+FGPK+LPEIG+ +GKT+K
Sbjct  39   RSLVAIRPRIRPEPRGKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVK  98

Query  478  SFQQAAKEFETELKKEP-----DELPVKEGGEEEK  567
            SFQQAAKEFE+ELK EP     D  PV    +EE+
Sbjct  99   SFQQAAKEFESELKTEPEDSVADSSPVAMSKKEEE  133



>ref|XP_010674831.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=149

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  301  RSLGLRTCNVR--SNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTL  474
            + LGLR   VR     RK L CN LFGLGVP L VIAGV AL+FGPKQLPEIGR  GKT+
Sbjct  41   KGLGLR-ARVRPAYRARKGLTCNSLFGLGVPELAVIAGVAALVFGPKQLPEIGRNFGKTI  99

Query  475  KSFQQAAKEFETELKKEPDE  534
            KSFQQAAKEFE EL K P+E
Sbjct  100  KSFQQAAKEFEQELTK-PEE  118



>ref|XP_010027195.1| PREDICTED: light-inducible protein CPRF2-like [Eucalyptus grandis]
Length=679

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 8/91 (9%)
 Frame = +1

Query  331  RSNGRKR--LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEF  504
            R N R +  L CN LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEF
Sbjct  584  RRNQRAKRGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEF  643

Query  505  ETELKKEPDELPV------KEGGEEEKPDAV  579
            E+E+KKEP+ L        +E  +EEK D+ 
Sbjct  644  ESEIKKEPESLTEPSIEKPEEVAQEEKVDST  674



>ref|XP_008788140.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Phoenix dactylifera]
Length=153

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            L C CLFGLGVP LVVIAGV AL+FGPK+LPEIGR +GKT+KSFQ+AAKEFETELKK+ +
Sbjct  61   LGCRCLFGLGVPELVVIAGVAALVFGPKKLPEIGRSIGKTVKSFQEAAKEFETELKKDGE  120

Query  532  E  534
            +
Sbjct  121  D  121



>ref|XP_003562204.2| PREDICTED: CBL-interacting protein kinase 7-like [Brachypodium 
distachyon]
Length=536

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 10/80 (13%)
 Frame = +1

Query  358  CNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE-  534
            C CLFGLGVP +VVIAGV AL+FGPKQLPEIGR +GKT+KSFQQAAKEFE+ELKKEP++ 
Sbjct  446  CKCLFGLGVPEMVVIAGVAALLFGPKQLPEIGRSVGKTVKSFQQAAKEFESELKKEPEDG  505

Query  535  ---------LPVKEGGEEEK  567
                       V   GEE+K
Sbjct  506  GDQPPPATPTAVSSDGEEQK  525



>ref|XP_006432928.1| hypothetical protein CICLE_v10002770mg [Citrus clementina]
 ref|XP_006471679.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Citrus sinensis]
 gb|ESR46168.1| hypothetical protein CICLE_v10002770mg [Citrus clementina]
 gb|KDO48914.1| hypothetical protein CISIN_1g031919mg [Citrus sinensis]
Length=150

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
              C  LFGLGVP LVVIAGV AL+FGPK+LPE+G+ +GKT+KSFQQAAKEFE+ELKKEPD
Sbjct  61   FTCYALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKKEPD  120



>gb|EPS74317.1| hypothetical protein M569_00442, partial [Genlisea aurea]
Length=111

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 8/74 (11%)
 Frame = +1

Query  352  LYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
              CNCLFGLGVP LVVIAGV AL+FGPK+LPEIG+ +G+T+KSFQQAAKEFE+ELK    
Sbjct  42   FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEIGKSIGRTVKSFQQAAKEFESELK----  97

Query  532  ELPVKEGGEEEKPD  573
                K+GG++  P+
Sbjct  98   ----KDGGDDSAPE  107



>ref|XP_008786083.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Phoenix dactylifera]
Length=156

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDELPVK  546
            LFGLGVP LVVIAGV AL+FGPK+LPEIGR +GKT KSFQQAAKEFETELKK+ DE   K
Sbjct  67   LFGLGVPELVVIAGVAALVFGPKKLPEIGRSIGKTAKSFQQAAKEFETELKKD-DEDATK  125

Query  547  EGGEEEKPDAV  579
                 E P  V
Sbjct  126  PTPPAESPQVV  136



>gb|ABK21127.1| unknown [Picea sitchensis]
Length=146

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  292  GLKRSLGLRTCNV-RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGK  468
            G K  L  RT  V R   R  +    LFGLGVP L VIAGV ALIFGPK+LPEIG+ LGK
Sbjct  41   GGKDLLCTRTLRVSRREQRGGVRVTALFGLGVPELAVIAGVAALIFGPKKLPEIGKSLGK  100

Query  469  TLKSFQQAAKEFETELKKEPD  531
            T+KSFQ+AAKEFETE+KKE +
Sbjct  101  TVKSFQEAAKEFETEVKKENE  121



>gb|KIZ03129.1| hypothetical protein MNEG_4832 [Monoraphidium neglectum]
Length=143

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            ++ + C  LFGLGVP LVVIAGV AL+FGP +LPE+G+GLGKT+KSFQ AAKEFETELK+
Sbjct  57   QRTVACRGLFGLGVPELVVIAGVAALVFGPSKLPELGKGLGKTVKSFQTAAKEFETELKQ  116



>ref|XP_002976419.1| hypothetical protein SELMODRAFT_267974 [Selaginella moellendorffii]
 gb|EFJ22679.1| hypothetical protein SELMODRAFT_267974 [Selaginella moellendorffii]
Length=156

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +1

Query  307  LGLRTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQ  486
            L  R+ N     R+      LFGLGVP LVVIAGV AL+FGPK+LPEIG+ LGKT+KSFQ
Sbjct  54   LRARSGNSMLATRRTARVMALFGLGVPELVVIAGVAALVFGPKKLPEIGKSLGKTVKSFQ  113

Query  487  QAAKEFETELK-KEPDELPVKEGGEEEKPDAV  579
            QAA EF+TEL  K+  E   K  G  E+ +AV
Sbjct  114  QAADEFQTELTAKKSAEEEEKVPGSSEETEAV  145



>ref|XP_002987256.1| hypothetical protein SELMODRAFT_125456 [Selaginella moellendorffii]
 gb|EFJ11832.1| hypothetical protein SELMODRAFT_125456 [Selaginella moellendorffii]
Length=95

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  343  RKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK-  519
            R+      LFGLGVP LVVIAGV AL+FGPK+LPEIG+ LGKT+KSFQQAA EF+TEL  
Sbjct  5    RRTARVMALFGLGVPELVVIAGVAALVFGPKKLPEIGKSLGKTVKSFQQAADEFQTELTA  64

Query  520  KEPDELPVKEGGEEEKPDAV  579
            K+  E   K  G  E+ +AV
Sbjct  65   KKSAEEEEKVPGSSEETEAV  84



>ref|XP_001774935.1| predicted protein [Physcomitrella patens]
 gb|AAS47587.1| chloroplast Tha4-2 [Physcomitrella patens]
 gb|EDQ60201.1| predicted protein [Physcomitrella patens]
Length=159

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            LFGLGVP L VIAGV AL+FGPKQLP+IG+ LG+T+ SFQQAAKEFETE+KK+  E
Sbjct  77   LFGLGVPELAVIAGVAALLFGPKQLPQIGKKLGQTVTSFQQAAKEFETEVKKDSGE  132



>gb|KEH43019.1| twin arginine translocase [Medicago truncatula]
Length=107

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  304  SLGLRTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSF  483
            SL L+    R+   KR  CN  FGLGVP LVVIAGV AL+FGPK+LPE+GR +GKT+KSF
Sbjct  39   SLLLKKARTRTRSTKRFTCNAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSF  98

Query  484  QQ  489
            QQ
Sbjct  99   QQ  100



>ref|XP_001768091.1| predicted protein [Physcomitrella patens]
 gb|EDQ67163.1| predicted protein [Physcomitrella patens]
Length=171

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = +1

Query  283  NPGGLKRSLGLRTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGL  462
            N G +      R    R  GR  + C  LFGLGVP L VIAGV AL+FGPKQLP IG+ L
Sbjct  58   NDGRILLRTAARPVERRRQGRFEV-CG-LFGLGVPELAVIAGVAALVFGPKQLPAIGKSL  115

Query  463  GKTLKSFQQAAKEFETELKKEPDELPVKEGGEEEKPDAVV  582
            GKT+KSFQ AAKEFE+E+ K       KE GEE +    V
Sbjct  116  GKTVKSFQTAAKEFESEISK------AKESGEEGQDSTAV  149



>ref|XP_008804879.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Phoenix dactylifera]
Length=144

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  370  FGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            FGLGVP + VIAGV AL+FGP Q+P +G+  GKT+KSFQQAAKEFE ELKKE +++
Sbjct  59   FGLGVPEVAVIAGVAALVFGPSQIPVVGQSFGKTIKSFQQAAKEFEAELKKETEDV  114



>gb|AAS47586.1| chloroplast Tha4-1 [Physcomitrella patens]
Length=164

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = +1

Query  283  NPGGLKRSLGLRTCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGL  462
            N G +      R    R  GR  + C  LFGLGVP L VIAGV AL+FGPKQLP IG+ L
Sbjct  58   NDGRILLRTAARPVERRRQGRFEV-CG-LFGLGVPELAVIAGVAALVFGPKQLPAIGKSL  115

Query  463  GKTLKSFQQAAKEFETELKKEPDELPVKEGGEEEKPDAVV  582
            GKT+KSFQ AAKEFE+E+ K       KE GEE +    V
Sbjct  116  GKTVKSFQTAAKEFESEISK------AKESGEEGQDSTAV  149



>gb|EYU30524.1| hypothetical protein MIMGU_mgv1a0158101mg, partial [Erythranthe 
guttata]
Length=102

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = +1

Query  184  MAAIAS-AVSLSFAPKPTssvaafssssslffssNPGGLKRSLGLRTCNVRSNGRKRLYC  360
            MAAI+S  ++ S A  P+    + SSSSS+FFS N    +  LGL     R + R    C
Sbjct  1    MAAISSPTITASLATNPSLKFTSLSSSSSVFFSYNISN-RVKLGLDLDRPRRSNRNGFSC  59

Query  361  NCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQ  489
            NCLFGLGVP LVVIAGV  ++FGPKQLPE+GR +GKT+KSFQQ
Sbjct  60   NCLFGLGVPELVVIAGVAVILFGPKQLPEVGRSIGKTVKSFQQ  102



>emb|CEF96594.1| Sec-independent protein translocase protein TatA/E [Ostreococcus 
tauri]
Length=116

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  334  SNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETE  513
            ++ R R+    LFGLG+P +VVI GV A++FGP++LPE+G+ LGKT+KSFQ+AAKEF+ E
Sbjct  37   AHKRDRVVVRGLFGLGLPEIVVIGGVAAVLFGPQKLPELGKSLGKTVKSFQEAAKEFKDE  96

Query  514  LKK--EPDELP--VKEGGEE  561
            ++   E DE P  ++E  EE
Sbjct  97   MQTEMEDDEEPKMIEEKKEE  116



>ref|XP_002946596.1| hypothetical protein VOLCADRAFT_120302 [Volvox carteri f. nagariensis]
 gb|EFJ52523.1| hypothetical protein VOLCADRAFT_120302 [Volvox carteri f. nagariensis]
Length=159

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = +1

Query  307  LGLR--TCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKS  480
            LGL    C  R+  R ++ C  LFGLG+P + VIAGV AL+FGP +LPE+G+ LGKT+KS
Sbjct  12   LGLHHFICARRTQSR-QVTCQGLFGLGLPEVAVIAGVAALVFGPSKLPELGKTLGKTVKS  70

Query  481  FQQAAKEFETELKKEPDELPVKEGGEEEK  567
            FQ AA EF  ELK    E P K   EE K
Sbjct  71   FQTAANEFSEELKAGMAEDPKKPAAEEPK  99



>ref|WP_006512458.1| twin arginine-targeting protein translocase, TatA/E family [Xenococcus 
sp. PCC 7305]
 gb|ELS00305.1| twin arginine-targeting protein translocase, TatA/E family [Xenococcus 
sp. PCC 7305]
Length=93

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VIA +  L+FGPK+LPEIGR LGK+L+SFQ+A+KEFETELKKE  ++
Sbjct  3    VFGIGLPEMAVIAVIALLVFGPKKLPEIGRSLGKSLRSFQEASKEFETELKKEAQKM  59



>ref|XP_006382793.1| hypothetical protein POPTR_0005s05490g, partial [Populus trichocarpa]
 gb|ERP60590.1| hypothetical protein POPTR_0005s05490g, partial [Populus trichocarpa]
Length=127

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  GRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEF  504
             +K L CN LFGLGVP LVVIAGV  L+FGPKQLPE+GR +GKT+KSFQQ +  F
Sbjct  55   AKKGLTCNALFGLGVPELVVIAGVATLLFGPKQLPEVGRSIGKTVKSFQQVSGSF  109



>ref|XP_002500552.1| twin arginine targeting family [Micromonas sp. RCC299]
 gb|ACO61810.1| twin arginine targeting family [Micromonas sp. RCC299]
Length=144

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +1

Query  319  TCNVRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAK  498
            T      G + +    LFGLG+P LVVI GV A++FGP +LPE+G+ LGKT+KSFQ AA 
Sbjct  57   TAGRSGAGTRSVATMGLFGLGLPELVVIGGVAAVLFGPSKLPELGKSLGKTVKSFQAAAN  116

Query  499  EFETELK--KEPDELPVKEGGEEEK  567
            EF+ ELK  KE +E P K+  E EK
Sbjct  117  EFQDELKSDKEGEEQPPKQIEEGEK  141



>ref|XP_005646948.1| twin arginine-targeting protein trans [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22404.1| twin arginine-targeting protein trans [Coccomyxa subellipsoidea 
C-169]
Length=79

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
            LFGLGVP + VIAGV  LIFGP +LPE+GR LGK++KSFQ AAKEFE+ELK
Sbjct  3    LFGLGVPEIAVIAGVAVLIFGPSKLPELGRELGKSVKSFQTAAKEFESELK  53



>ref|XP_001690564.1| TatA-like sec-independent protein translocator subunit [Chlamydomonas 
reinhardtii]
 gb|EDP05823.1| TatA-like sec-independent protein translocator subunit [Chlamydomonas 
reinhardtii]
Length=114

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  346  KRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK  519
            +++ C  LFGLG+P + VIAGV ALIFGP +LPE+G+ LGKT+KSFQ AA EF  ELK
Sbjct  35   RQVACQGLFGLGLPEVAVIAGVAALIFGPSKLPELGKSLGKTVKSFQTAASEFNDELK  92



>tpg|DAA50381.1| TPA: thylakoid assembly4 [Zea mays]
Length=125

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  358  CNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQ  489
            C CLFGLGVP L VIAGV AL+FGPKQLPEIGR +GKT+KSFQQ
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQ  125



>ref|WP_028083231.1| preprotein translocase subunit TatA [Dolichospermum circinale]
Length=86

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR LGKT++SFQ+A+ EF+TE K+E ++L
Sbjct  3    IFGIGLPEMAVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQTEFKRETEQL  59



>ref|WP_028089196.1| preprotein translocase subunit TatA [Dolichospermum circinale]
Length=86

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR LGKT++SFQ+A+ EF+TE K+E ++L
Sbjct  3    IFGIGLPEMAVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQTEFKRETEQL  59



>ref|WP_006275635.1| MULTISPECIES: primosome subunit DnaD [Nostocaceae]
 gb|EFA71396.1| Twin-arginine translocation protein TatA/E [Cylindrospermopsis 
raciborskii CS-505]
 gb|EFA71620.1| Twin-arginine translocation protein TatA/E [Raphidiopsis brookii 
D9]
Length=83

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +VVI  V  LIFGPK+LPEIGR L KT++SFQQA+ EF+ E KKE  +L
Sbjct  3    IFGIGLPEMVVIGVVALLIFGPKKLPEIGRSLAKTIRSFQQASSEFQNEFKKEVQQL  59



>ref|WP_012410656.1| primosome subunit DnaD [Nostoc punctiforme]
 gb|ACC82691.1| twin-arginine translocation protein, TatA/E family subunit [Nostoc 
punctiforme PCC 73102]
Length=91

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR +GKT++SFQ+A+KEF++E +KE ++L
Sbjct  3    IFGIGLPEMAVIMVVALLIFGPKKLPEIGRSVGKTIRSFQEASKEFQSEFQKEAEQL  59



>ref|XP_003056138.1| twin arginine targeting family [Micromonas pusilla CCMP1545]
 gb|EEH59514.1| twin arginine targeting family [Micromonas pusilla CCMP1545]
Length=144

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            LFGLG+P LVVI GV A++FGP +LPE+G+ LGKT+KSFQ AA EF+ ELK++ +E
Sbjct  73   LFGLGLPELVVIGGVAAVLFGPSKLPELGKSLGKTVKSFQAAANEFQDELKEKNEE  128



>gb|KEH24554.1| twin arginine translocase [Medicago truncatula]
Length=121

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 5/68 (7%)
 Frame = +1

Query  328  VRSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKE--  501
            + +NG     CN LFGLGVP LVVIAGV A++FGPK+LPE+GR +GKT+KSFQQ      
Sbjct  50   INNNG---FTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVKSFQQTKWRIP  106

Query  502  FETELKKE  525
            FET  + E
Sbjct  107  FETRTQLE  114



>ref|WP_015222444.1| Sec-independent protein translocase TatA [Cyanobacterium stanieri]
 gb|AFZ47126.1| Sec-independent protein translocase TatA [Cyanobacterium stanieri 
PCC 7202]
Length=90

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL---  537
            +FG+G+P ++VI  V  L+FGPK+LPEIGR LGKTLK FQ A+KEF+ E KKE  ++   
Sbjct  3    VFGIGLPEMIVIFVVALLVFGPKKLPEIGRTLGKTLKGFQDASKEFQDEFKKEAQQIEET  62

Query  538  -----PVKEGGEEEK  567
                  ++ G EEEK
Sbjct  63   ISMNAQIESGKEEEK  77



>ref|WP_013191028.1| primosome subunit DnaD [Trichormus azollae]
 gb|ADI64011.1| twin-arginine translocation protein, TatA/E family subunit ['Nostoc 
azollae' 0708]
Length=90

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGKT++SFQ+A+ EF+ E K+E +++
Sbjct  3    IFGIGLPEMAIIMVVAVLIFGPKKLPEIGRSLGKTIRSFQEASNEFQNEFKREAEQI  59



>ref|WP_036901406.1| translocase [Prochlorococcus sp. MIT 0601]
Length=72

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDELPVK  546
            +FG+G+P + VIAG+  +IFGPK+LPE+GR LGKTLKS QQA+ EFE+E+K    E   K
Sbjct  3    IFGVGLPEIAVIAGLALVIFGPKRLPELGRTLGKTLKSLQQASTEFESEIKNAMSESESK  62

Query  547  EGGEEEKP  570
            +  ++  P
Sbjct  63   DSEQKNDP  70



>ref|WP_015078234.1| twin-arginine translocation protein [Anabaena sp. 90]
 gb|AFW93070.1| twin-arginine translocation protein [Anabaena sp. 90]
Length=86

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR LGKT++SFQ+A+ EF++E KKE ++L
Sbjct  3    IFGIGLPEMGVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKKESEQL  59



>gb|ACZ26222.1| TatA/E [Aphanizomenon sp. NH-5]
Length=86

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR LGKT++SFQ+A+ EF++E KKE ++L
Sbjct  3    IFGIGLPEMGVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKKESEQL  59



>ref|WP_015167027.1| twin arginine-targeting protein translocase, TatA/E family [Synechococcus 
sp. PCC 7502]
 gb|AFY72368.1| twin arginine-targeting protein translocase, TatA/E family [Synechococcus 
sp. PCC 7502]
Length=90

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FGLG+P ++VI GV  LIFGPK+LPEIGR +GKT+K FQ A+++F+ E  KE ++L
Sbjct  3    IFGLGLPEMIVIMGVALLIFGPKKLPEIGRSVGKTIKGFQDASRDFQAEFTKEVEQL  59



>ref|WP_027402857.1| preprotein translocase subunit TatA [Aphanizomenon flos-aquae]
Length=84

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR LGKT++SFQ+A+ EF++E KKE ++L
Sbjct  3    IFGIGLPEMGVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKKESEQL  59



>ref|WP_010477319.1| MULTISPECIES: preprotein translocase subunit TatA [Acaryochloris]
 gb|ABW30467.1| twin-arginine translocation protein TatA/E family [Acaryochloris 
marina MBIC11017]
Length=106

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR +GK LKSFQ+A+KEFE E KKE D +
Sbjct  3    VFGIGLPEMALIMVIALLVFGPKKLPEIGRSMGKALKSFQEASKEFENEFKKEADRI  59



>ref|WP_017718938.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=89

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI GV  LIFGPK+LPEIGR LGK ++ FQ+A+++FE ELK+E ++L
Sbjct  3    IFGIGLPEMAVILGVALLIFGPKKLPEIGRSLGKAIRGFQEASRDFENELKREVEQL  59



>ref|XP_007515120.1| twin arginine translocase protein A [Bathycoccus prasinos]
 emb|CCO13999.1| twin arginine translocase protein A [Bathycoccus prasinos]
Length=145

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  331  RSNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFE  507
            R+N  + +  N LFGLG+P LVVI GVTAL+FGP +LPE+G+ LGKT+KSFQ AA EF 
Sbjct  62   RNNRGELVVSNGLFGLGLPELVVIGGVTALLFGPSKLPELGKSLGKTVKSFQSAANEFN  120



>ref|WP_011127144.1| primosome subunit DnaD [Synechococcus sp. WH 8102]
 emb|CAE06785.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=77

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 3/61 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K   EP++L
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPEQL  62

Query  538  P  540
            P
Sbjct  63   P  63



>ref|WP_044106578.1| preprotein translocase subunit SecA [cyanobacterium endosymbiont 
of Epithemia turgida]
 dbj|BAP17800.1| twin arginine translocase protein A [cyanobacterium endosymbiont 
of Epithemia turgida isolate EtSB Lake Yunoko]
Length=94

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +V+I  V+ LIFGPK+LPEIGR LGK ++ FQ+A+KEFE E K+E  +L
Sbjct  3    VFGIGLPEMVLIFAVSLLIFGPKKLPEIGRSLGKAIRGFQEASKEFENEFKREAQKL  59



>ref|WP_015129400.1| Sec-independent protein translocase TatA [Calothrix sp. PCC 7507]
 gb|AFY33591.1| Sec-independent protein translocase TatA [Calothrix sp. PCC 7507]
Length=90

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR LGKTL+SFQ+A+ EF++E K+E ++L
Sbjct  3    IFGIGLPEMGVIFVVALLIFGPKKLPEIGRSLGKTLRSFQEASNEFQSEFKREAEQL  59



>ref|WP_011932240.1| primosome subunit DnaD [Synechococcus sp. WH 7803]
 emb|CAK22740.1| Sec-independent protein translocase protein TatA [Synechococcus 
sp. WH 7803]
Length=82

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K   EP+ L
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPERL  62

Query  538  P  540
            P
Sbjct  63   P  63



>ref|WP_036486219.1| preprotein translocase subunit SecA [Myxosarcina sp. GI1]
Length=98

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK ++ FQ A+KEFETE K+E  +L
Sbjct  3    IFGIGLPEMALIMVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFETEFKREAQQL  59



>ref|WP_015218443.1| Sec-independent protein translocase TatA [Cyanobacterium aponinum]
 gb|AFZ52712.1| Sec-independent protein translocase TatA [Cyanobacterium aponinum 
PCC 10605]
Length=89

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +++I  V  LIFGPK+LPEIG+ LGKTLK FQ+A+KEF+ E KKE +++
Sbjct  3    VFGIGLPEMILIFVVALLIFGPKKLPEIGKSLGKTLKGFQEASKEFQEEFKKEAEKI  59



>ref|WP_017296345.1| hypothetical protein [Geminocystis herdmanii]
Length=87

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +++I  V  LIFGPK+LPEIGR LGKT+K FQ+A+KEF+ E KKE +++
Sbjct  3    VFGIGLPEMILIFVVALLIFGPKKLPEIGRSLGKTIKGFQEASKEFQEEFKKEVEQV  59



>ref|WP_011243599.1| MULTISPECIES: preprotein translocase subunit TatA [Synechococcus]
 sp|Q5N2J3.1|TATA_SYNP6 RecName: Full=Sec-independent protein translocase protein TatA 
[Synechococcus elongatus PCC 6301]
 sp|Q31RR1.1|TATA_SYNE7 RecName: Full=Sec-independent protein translocase protein TatA 
[Synechococcus elongatus PCC 7942]
 dbj|BAD79477.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB56258.1| Sec-independent protein translocase TatA [Synechococcus elongatus 
PCC 7942]
 gb|AJD56693.1| preprotein translocase subunit TatA [Synechococcus sp. UTEX 2973]
Length=91

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDELP  540
             FG+G+P ++VI  +  L+FGPK+LPEIGR LGK L+ FQ A++EFE+E+K+E D  P
Sbjct  3    FFGIGLPEMLVILAIALLVFGPKKLPEIGRSLGKALRGFQDASREFESEIKREIDRTP  60



>ref|WP_022607742.1| twin arginine-targeting protein translocase, TatA/E family [Rubidibacter 
lacunae]
 gb|ERN40968.1| twin arginine-targeting protein translocase, TatA/E family [Rubidibacter 
lacunae KORDI 51-2]
Length=98

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +V+I  +  L+FGPK+LPEIGR LGK ++ FQ A+KEFE E K+E  EL
Sbjct  3    VFGIGLPEMVLILAIALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKRESQEL  59



>ref|WP_017655009.1| primosome subunit DnaD [Microchaete sp. PCC 7126]
Length=90

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR LGKT++SFQ+A+ EF++E K+E ++L
Sbjct  3    IFGIGLPEMGVIFVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKREAEQL  59



>ref|WP_015135395.1| Sec-independent protein translocase TatA [Leptolyngbya sp. PCC 
7376]
 gb|AFY39655.1| Sec-independent protein translocase TatA [Leptolyngbya sp. PCC 
7376]
Length=94

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKTLKSFQ A+ EF+ E+KKE D++
Sbjct  3    VFGIGLPEMALIFVIALLVFGPKKLPEIGRTLGKTLKSFQAASNEFQEEIKKETDKI  59



>ref|WP_016952632.1| primosome subunit DnaD [Anabaena sp. PCC 7108]
Length=90

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPE+GR LGKT++SFQ+A+ EF+TE K+E ++L
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEVGRSLGKTIRSFQEASNEFQTEFKRETEQL  59



>ref|WP_010314490.1| primosome subunit DnaD [Synechococcus sp. CB0205]
Length=83

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD--ELP  540
            +FG+G+P + VIA V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E +K  D  E  
Sbjct  3    VFGIGLPEMAVIAAVGLLVFGPKRLPELGRTLGKTLKGFQSASKEFEQEFRKAVDTVEAE  62

Query  541  VKEGGEEEKP  570
            V +   E +P
Sbjct  63   VTQASSEPQP  72



>ref|WP_009788805.1| primosome subunit DnaD [Synechococcus sp. BL107]
 gb|EAU71447.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
BL107]
Length=77

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPE+G+ LGKTLK FQ A+KEFE E+ K   EP+ L
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGKTLGKTLKGFQSASKEFEREINKAMAEPEAL  62

Query  538  PVKEGGEEEKP  570
            P  E    E+P
Sbjct  63   PSTEQQANEEP  73



>ref|WP_015142774.1| twin arginine-targeting protein translocase, TatA/E family [Pleurocapsa 
minor]
 gb|AFY76466.1| twin arginine-targeting protein translocase, TatA/E family [Pleurocapsa 
sp. PCC 7327]
Length=90

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
             FG+G+P +++I  +  LIFGPK+LPEIGR +GK ++SFQ+A+KEFE E K+E  +L
Sbjct  3    FFGIGLPEMILIMVIALLIFGPKKLPEIGRSVGKAIRSFQEASKEFENEFKREAQQL  59



>ref|WP_019502800.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=82

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 8/78 (10%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL---  537
            +FG+G+P ++VI  V  LIFGPK+LPEIGR +GK +K FQ A++EFE+E K+E + L   
Sbjct  3    IFGIGLPEMIVIMVVALLIFGPKKLPEIGRSVGKAIKGFQDASREFESEFKREAELLEES  62

Query  538  -----PVKEGGEEEKPDA  576
                  V+   E  KP A
Sbjct  63   TKPSTTVETSSESSKPSA  80



>ref|WP_025956123.1| hypothetical protein [Prochlorococcus sp. scB243_498I20]
Length=89

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK---KEPDEL  537
            +FG+G+P + VI  +  LIFGPK+LPE+GR +GKTLKSFQQA+ EF+ E++   KE DE 
Sbjct  3    IFGVGIPEIAVIFVLALLIFGPKKLPELGRSIGKTLKSFQQASGEFQKEIEKAVKETDEE  62

Query  538  PVKEGGE  558
             + +G E
Sbjct  63   VINDGSE  69



>ref|WP_037218329.1| preprotein translocase subunit TatA [Richelia intracellularis]
Length=82

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI GV  LIFGPK+LPEIGR +GK ++ FQ+A+ EF+ E +KE ++L
Sbjct  3    IFGIGLPEMAVIMGVALLIFGPKKLPEIGRSVGKAIRGFQEASNEFQNEFQKEAEQL  59



>ref|WP_015214503.1| Sec-independent protein translocase TatA [Anabaena cylindrica]
 gb|AFZ57867.1| Sec-independent protein translocase TatA [Anabaena cylindrica 
PCC 7122]
Length=90

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR +GKT++SFQ+A+ EF+ E K+E ++L
Sbjct  3    IFGIGLPEMALIMVVALLIFGPKKLPEIGRSVGKTIRSFQEASNEFQNEFKREAEQL  59



>ref|WP_027840950.1| preprotein translocase subunit TatA [Mastigocoleus testarum]
Length=92

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPEIGR LGK LK FQ+A+++F+ E KKE  EL
Sbjct  3    IFGIGLPEMAVIMVVALLVFGPKKLPEIGRSLGKALKGFQEASQDFQEEFKKEASEL  59



>ref|WP_015188791.1| Sec-independent protein translocase TatA [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30919.1| Sec-independent protein translocase TatA [Gloeocapsa sp. PCC 
7428]
Length=90

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR +GK ++ FQ+A+KEFE E K+E +++
Sbjct  3    IFGIGLPEMAVIMIVALLIFGPKKLPEIGRSMGKAVRGFQEASKEFENEFKREAEQI  59



>ref|WP_017327885.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=108

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P  +VI  V  L+FGPK+LPEIGR + KT+KS Q A+KEFE E+K+E +++
Sbjct  3    IFGVGLPEAIVILAVALLVFGPKKLPEIGRTVAKTIKSLQDASKEFEAEIKREAEQV  59



>gb|ELS32305.1| Sec-independent protein translocase protein tatA/E-like protein 
[Pseudanabaena biceps PCC 7429]
Length=107

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +++I  V  LIFGPK+LPEIGR +GK +K FQ A++EFE+E K+E + L
Sbjct  3    IFGIGLPEMILIMLVALLIFGPKKLPEIGRSMGKAIKGFQDASREFESEFKREAERL  59



>ref|WP_044195831.1| preprotein translocase subunit TatA [Oscillatoria acuminata]
Length=83

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P ++VI  +  LIFGPK+LPEIGR +GK ++ FQ A++EFE+E+K+E +++
Sbjct  3    IFGMGLPEIMVILTIALLIFGPKKLPEIGRSMGKAIRGFQDASREFESEIKREAEQI  59



>ref|WP_040054321.1| preprotein translocase subunit SecA [Candidatus Atelocyanobacterium 
thalassa]
 gb|KFF41861.1| twin arginine-targeting protein translocase, TatA/E family [Candidatus 
Atelocyanobacterium thalassa isolate SIO64986]
Length=90

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEP----DE  534
            +FG+G+P + +I  ++ L+FGPK+LPEIGR LGK ++ FQ A+KEFE E K+E     D 
Sbjct  3    IFGIGLPEMALILIISLLVFGPKKLPEIGRSLGKAVRGFQDASKEFEDEFKRETQHLQDS  62

Query  535  LPVKEGGEEEKPDA  576
            L +    E+ K D+
Sbjct  63   LSINAELEDNKTDS  76



>ref|WP_026787063.1| MULTISPECIES: hypothetical protein [Planktothrix]
 gb|KEI65479.1| TatA [Planktothrix agardhii NIVA-CYA 126/8]
Length=86

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  +  LIFGPK+LPEIG  LGK LK FQQA+KEFE E KKE  +L
Sbjct  3    IFGIGLPEMAVILVLALLIFGPKKLPEIGSSLGKALKGFQQASKEFEDEFKKEAQKL  59



>ref|XP_010917651.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like isoform X1 [Elaeis guineensis]
Length=144

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  370  FGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEF  504
            FGLGVP + VIAGV AL+FGP Q+P IG+  GKT+KSFQQAAKEF
Sbjct  59   FGLGVPEVAVIAGVAALVFGPSQMPAIGQSFGKTIKSFQQAAKEF  103



>ref|WP_012628897.1| preprotein translocase subunit TatA [Cyanothece sp. PCC 7425]
 gb|ACL45837.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 7425]
Length=104

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 6/68 (9%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDELPVK  546
            +FG+G+P +V+I  +  LIFGPK+LPEIGR LGK L+ FQ A+KEFE+ELK++ + L   
Sbjct  3    VFGIGLPEMVLILVIALLIFGPKKLPEIGRSLGKALRGFQDASKEFESELKRQAELL---  59

Query  547  EGGEEEKP  570
               E+E+P
Sbjct  60   ---EQERP  64



>ref|WP_006042329.1| primosome subunit DnaD [Synechococcus sp. WH 7805]
 gb|EAR19205.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
WH 7805]
Length=81

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 3/61 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPE GR LGKTLK FQ A+KEFE E+ K   EP+ L
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPEFGRTLGKTLKGFQSASKEFEREINKAMAEPEVL  62

Query  538  P  540
            P
Sbjct  63   P  63



>ref|WP_036531210.1| preprotein translocase subunit TatA [Neosynechococcus sphagnicola]
 gb|KGF73481.1| hypothetical protein DO97_18365 [Neosynechococcus sphagnicola 
sy1]
Length=115

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR +GK ++ FQ+A+KEFETE K+E D L
Sbjct  3    VFGIGLPEMALIMVLALLVFGPKKLPEIGRSMGKAIRGFQEASKEFETEFKREADRL  59



>ref|WP_035997640.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=104

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  LIFGPK+LPEIGR LGK ++ FQ+A+KEFETE KKE + +
Sbjct  3    IFGIGLPEMALIMILALLIFGPKKLPEIGRSLGKAIRGFQEASKEFETEFKKEAERI  59



>ref|WP_006516772.1| twin arginine-targeting protein translocase, TatA/E family [Leptolyngbya 
sp. PCC 7375]
 gb|EKV02389.1| twin arginine-targeting protein translocase, TatA/E family [Leptolyngbya 
sp. PCC 7375]
Length=105

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE  525
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK LK FQ A+KEFE E KKE
Sbjct  3    IFGIGLPEMALIMMVALLVFGPKKLPEIGRSLGKALKGFQDASKEFEDEFKKE  55



>ref|WP_040688524.1| preprotein translocase subunit TatA, partial [Pseudanabaena biceps]
Length=67

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +++I  V  LIFGPK+LPEIGR +GK +K FQ A++EFE+E K+E + L
Sbjct  3    IFGIGLPEMILIMLVALLIFGPKKLPEIGRSMGKAIKGFQDASREFESEFKREAERL  59



>ref|WP_012194832.1| translocase [Prochlorococcus marinus]
 gb|ABX08207.1| Sec-independent protein secretion pathway component [Prochlorococcus 
marinus str. MIT 9211]
Length=83

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 5/71 (7%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPD--  531
            +FG+G+P + VI G+  +IFGPK+LPE+GR LGKTLK  Q+A+ EFE+E++K   EPD  
Sbjct  3    IFGVGLPEIAVIVGLALVIFGPKRLPELGRTLGKTLKGLQKASTEFESEIQKAMTEPDNS  62

Query  532  ELPVKEGGEEE  564
            E   KEG + +
Sbjct  63   ESATKEGADNQ  73



>ref|WP_011360824.1| primosome subunit DnaD [Synechococcus sp. CC9902]
 gb|ABB27038.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
CC9902]
Length=77

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPE+G+ LGKTLK FQ A+KEFE E+ K   EP+ L
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGKTLGKTLKGFQSASKEFEREINKAMAEPEAL  62

Query  538  PVKE  549
            P  E
Sbjct  63   PSAE  66



>gb|AAP79161.1| Tha4 plastid transport protein [Bigelowiella natans]
Length=201

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = +1

Query  346  KRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE  525
            + +  N LFGLG+P LVVI GV ALIFGP +LPE G+ LG T KS   A KEF  ELK  
Sbjct  117  REVSVNSLFGLGLPELVVIGGVAALIFGPSKLPEFGKQLGVTAKSLGSAVKEFNEELK--  174

Query  526  PDELPVKEGGEEEKPDAV  579
             DEL  +E     K DAV
Sbjct  175  -DELKTEEENAAAK-DAV  190



>ref|WP_006853679.1| prohead protease [Synechococcus sp. WH 8016]
 gb|EHA62246.1| twin-arginine translocation protein, TatA/E family subunit [Synechococcus 
sp. WH 8016]
Length=98

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VIA V  L+FGPK+LPE GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    VFGIGLPEMAVIAAVALLVFGPKRLPEFGRTLGKTLKGFQSASKEFEREINK  54



>ref|WP_028948124.1| preprotein translocase subunit SecA [Synechocystis sp. PCC 6714]
 gb|AIE74360.1| Twin-arginine translocation protein TatB [Synechocystis sp. PCC 
6714]
Length=83

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P L +I  +  L+FGPK+LPE+GR LGK L+ FQ+A+KEFETELK+E   L
Sbjct  3    IFGIGLPELGLIFVIALLVFGPKKLPEVGRSLGKALRGFQEASKEFETELKREAQNL  59



>ref|WP_019509197.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=89

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIGR + KTL+SFQ A+KEFE E K+E  ++
Sbjct  3    IFGIGLPEMALILIVALLVFGPKKLPEIGRSVAKTLRSFQDASKEFENEFKREAQKI  59



>ref|WP_040932916.1| hypothetical protein [Prochloron didemni]
Length=92

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGK ++ FQ+A+KEFE+E K++ +EL
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQEASKEFESEFKRQAEEL  59



>ref|WP_012954283.1| primosome subunit DnaD [Candidatus Atelocyanobacterium thalassa]
 gb|ADB95596.1| twin arginine-targeting protein translocase, TatA/E family [Candidatus 
Atelocyanobacterium thalassa isolate ALOHA]
Length=90

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEP----DE  534
            +FG+G+P + VI  ++ L+FGPK+LPEIG+ LGK +K FQ A+KEFE E K+E     D 
Sbjct  3    IFGIGLPEMAVILIISLLVFGPKKLPEIGKSLGKAVKGFQDASKEFEDEFKRETQHLQDS  62

Query  535  LPVKEGGEEEKPD  573
            L +    E++K D
Sbjct  63   LSMNAELEDDKVD  75



>ref|WP_011936751.1| primosome subunit DnaD [Synechococcus sp. RCC307]
 emb|CAK29242.1| Sec-independent protein translocase protein TatA [Synechococcus 
sp. RCC307]
Length=89

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD--ELP  540
            +FG+G+P + VIA +  L+FGPK+LPE+GR LGKTLK FQ A+ EFE E +K  D  ELP
Sbjct  3    VFGVGLPEMAVIAVIGLLVFGPKKLPELGRSLGKTLKGFQAASSEFEQEFRKAVDSVELP  62

Query  541  VKEGGEEEKPDA  576
              +       DA
Sbjct  63   AGQTDATSSQDA  74



>ref|WP_011124437.1| MULTISPECIES: translocase [Prochlorococcus]
 ref|NP_874676.1| Sec-independent protein secretion pathway component TatA [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|AAP99328.1| Sec-independent protein secretion pathway component TatA [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|KGG11400.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. LG]
 gb|KGG18644.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. SS2]
 gb|KGG22917.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. SS35]
 gb|KGG34021.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. SS51]
 gb|KGG37478.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
SS52]
Length=84

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VIA +   IFGPK+LP +GRGLGKTL+S Q+A+ EFE EL+K
Sbjct  3    IFGIGLPEIAVIAAIALFIFGPKKLPALGRGLGKTLRSLQKASSEFENELQK  54



>ref|WP_011618288.1| prohead protease [Synechococcus sp. CC9311]
 gb|ABI45131.1| twin-arginine translocation protein TatA [Synechococcus sp. CC9311]
Length=92

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VIA V  L+FGPK+LPE GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    VFGIGLPEMAVIAAVALLVFGPKRLPEFGRTLGKTLKGFQSASKEFEREINK  54



>ref|WP_008235394.1| Twin-arginine translocation protein TatA [Richelia intracellularis]
 emb|CCH68073.1| Twin-arginine translocation protein TatA [Richelia intracellularis 
HH01]
Length=83

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR +GK ++ FQ+A+KEF+ E  KE   L
Sbjct  3    IFGIGLPEMAVIMSVALLIFGPKKLPEIGRSMGKAIRGFQEASKEFQDEFHKESAHL  59



>ref|WP_009632533.1| twin arginine-targeting protein translocase, TatA/E family [Synechocystis 
sp. PCC 7509]
Length=104

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR +GK ++SFQ A+K+FE E K+E +++
Sbjct  3    VFGIGLPEMALIMVVALLIFGPKKLPEIGRSMGKAIRSFQDASKDFENEFKREAEQI  59



>ref|WP_024546019.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=92

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  LIFGPK+LPEIGR LGKT++SFQ A+ EF+ E KKE +++
Sbjct  3    IFGIGLPEMALIFIIALLIFGPKKLPEIGRSLGKTIRSFQDASNEFQEEFKKEAEKI  59



>gb|EDX84644.1| twin arginine-targeting protein translocase, TatA/E family, putative 
[Synechococcus sp. PCC 7335]
Length=145

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK +K FQ A KEFETE KKE + +
Sbjct  3    IFGIGLPEMGLIMIVALLVFGPKKLPEIGRSLGKAMKGFQDATKEFETEFKKEAERI  59



>ref|WP_012594970.1| MULTISPECIES: primosome subunit DnaD [Cyanothece]
 gb|ACK65697.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 8801]
 gb|ACV00578.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 8802]
Length=91

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +V+I  +  L+FGPK+LPEIGR LGK ++ FQ+A+KEFE E K+E  +L
Sbjct  3    VFGIGLPEMVLILVIALLVFGPKKLPEIGRSLGKAIRGFQEASKEFENEFKREAQQL  59



>ref|WP_039895374.1| preprotein translocase subunit TatA [Lyngbya sp. PCC 8106]
Length=86

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  364  CLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
             +FG+G+P + VI  +  LIFGPK+LPEIGR +GK ++ FQ+A+KEFE E K+E  +L
Sbjct  2    SIFGMGLPEIAVILVLALLIFGPKKLPEIGRSMGKAIRGFQEASKEFENEFKREAKQL  59



>ref|WP_012267736.1| primosome subunit DnaD [Microcystis aeruginosa]
 dbj|BAG05223.1| putative TatA protein [Microcystis aeruginosa NIES-843]
Length=82

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKT++ FQ+A+KEFE+E K+E +++
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAEQI  59



>ref|WP_038542939.1| primosome subunit DnaD [Synechococcus sp. KORDI-100]
 gb|AII42304.1| primosome subunit DnaD [Synechococcus sp. KORDI-100]
Length=77

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINK  54



>ref|WP_017316132.1| primosome subunit DnaD [Mastigocladopsis repens]
Length=90

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPE+GR LGK ++SFQQA+ EF++E +KE  +L
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEVGRSLGKAIRSFQQASSEFQSEFQKEAVQL  59



>ref|WP_002762408.1| primosome subunit DnaD [Microcystis aeruginosa]
 emb|CCH99140.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI22743.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9809]
Length=82

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKT++ FQ+A+KEFE+E K+E +++
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAEQI  59



>ref|XP_005846144.1| hypothetical protein CHLNCDRAFT_25319 [Chlorella variabilis]
 gb|EFN54042.1| hypothetical protein CHLNCDRAFT_25319 [Chlorella variabilis]
Length=56

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAK  498
            LFGLGVP L VIAGVTALIFGP +LPE+G+GLGKT+++FQ AAK
Sbjct  3    LFGLGVPELAVIAGVTALIFGPSKLPELGKGLGKTVRNFQSAAK  46



>ref|WP_015118028.1| twin arginine-targeting protein translocase, TatA/E family [Rivularia 
sp. PCC 7116]
 gb|AFY54452.1| twin arginine-targeting protein translocase, TatA/E family [Rivularia 
sp. PCC 7116]
Length=83

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPEIGR +GK L+ FQ+A+++F+ E KKE  +L
Sbjct  3    IFGIGLPEMAVIMAVALLVFGPKKLPEIGRSMGKALRGFQEASQDFQDEFKKEASQL  59



>ref|WP_041425909.1| preprotein translocase subunit SecA [Synechocystis sp. PCC 6803]
Length=85

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P L +I  +  L+FGPK+LPE+GR LGK L+ FQ+A+KEFETELK+E   L
Sbjct  3    IFGIGLPELGLIFVIALLVFGPKKLPEVGRSLGKALRGFQEASKEFETELKREAQNL  59



>ref|WP_023067361.1| twin arginine-targeting translocase, TatA/E family protein [Lyngbya 
aestuarii]
 gb|ERT06391.1| twin arginine-targeting translocase, TatA/E family protein [Lyngbya 
aestuarii BL J]
Length=85

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  +  LIFGPK+LPEIGR +GK ++ FQ+A+KEFE E K+E  +L
Sbjct  3    IFGIGLPEMAVILVLALLIFGPKKLPEIGRSMGKAIRGFQEASKEFENEFKREAKQL  59



>ref|WP_038019212.1| hypothetical protein, partial [Synechococcus sp. PCC 7335]
Length=86

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK +K FQ A KEFETE KKE + +
Sbjct  3    IFGIGLPEMGLIMIVALLVFGPKKLPEIGRSLGKAMKGFQDATKEFETEFKKEAERI  59



>ref|WP_023071402.1| sec-independent protein translocase [Leptolyngbya sp. Heron Island 
J]
 gb|ESA37819.1| sec-independent protein translocase [Leptolyngbya sp. Heron Island 
J]
Length=104

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE  525
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK +K FQ A+KEFE E KKE
Sbjct  3    IFGIGLPEMALIMMVALLVFGPKKLPEIGRSLGKAIKGFQDASKEFEDEFKKE  55



>ref|WP_010871658.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_440350.1| hypothetical protein slr1046 [Synechocystis sp. PCC 6803]
 dbj|BAA17030.1| slr1046 [Synechocystis sp. PCC 6803]
 dbj|BAK49202.1| hypothetical protein SYNGTS_0454 [Synechocystis sp. PCC 6803]
 dbj|BAL28201.1| hypothetical protein SYNGTI_0454 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31371.1| hypothetical protein SYNPCCN_0454 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34540.1| hypothetical protein SYNPCCP_0454 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM50745.1| hypothetical protein BEST7613_1814 [Synechocystis sp. PCC 6803]
 gb|AGF50720.1| hypothetical protein MYO_14600 [Synechocystis sp. PCC 6803]
Length=126

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P L +I  +  L+FGPK+LPE+GR LGK L+ FQ+A+KEFETELK+E   L
Sbjct  44   IFGIGLPELGLIFVIALLVFGPKKLPEVGRSLGKALRGFQEASKEFETELKREAQNL  100



>ref|WP_028953506.1| primosome subunit DnaD [Synechococcus sp. CC9616]
Length=77

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINK  54



>ref|WP_012306345.1| MULTISPECIES: primosome subunit DnaD [Synechococcus]
 gb|ACA98721.1| twin-arginine translocation protein [Synechococcus sp. PCC 7002]
Length=98

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  LIFGPK+LPEIGR LGKT++SFQ A+ EF+ E KKE +++
Sbjct  3    IFGIGLPEMALIFIIALLIFGPKKLPEIGRSLGKTIRSFQDASNEFQEEFKKEAEKI  59



>ref|WP_017307186.1| hypothetical protein [Spirulina subsalsa]
Length=91

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGK L+SFQ+A+ EF+ E+K+E ++
Sbjct  3    IFGIGLPEMALIFVVALLIFGPKKLPEIGRSLGKALRSFQEASNEFQKEIKREAEQ  58



>ref|WP_002735474.1| MULTISPECIES: primosome subunit DnaD [Microcystis]
 emb|CCH93470.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9432]
 emb|CCI13596.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9806]
 emb|CCI31330.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
sp. T1-4]
 gb|ELP53414.1| twin arginine-targeting translocase, TatA/E family protein [Microcystis 
aeruginosa TAIHU98]
Length=82

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKT++ FQ+A+KEFE+E K+E  ++
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQI  59



>emb|CAO89342.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
Length=121

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKT++ FQ+A+KEFE+E K+E  ++
Sbjct  42   IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQI  98



>ref|WP_015956190.1| primosome subunit DnaD [Cyanothece sp. PCC 7424]
 gb|ACK72605.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 7424]
Length=92

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P +++I  V  LIFGPK+LPEIGR LGK ++ FQ+A+KEFE+E  +E  ++
Sbjct  3    IFGIGLPEMMLILVVALLIFGPKKLPEIGRSLGKAIRGFQEASKEFESEFNREAQQI  59



>ref|WP_006172416.1| prohead protease [Synechococcus sp. WH 5701]
 gb|EAQ75466.1| twin-arginine translocation protein, TatA/E family protein [Synechococcus 
sp. WH 5701]
Length=125

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
             FG+G+P + VIA +  L+FGPK+LPE+GR LG+TLK FQ A++EFE E +K  D
Sbjct  3    FFGIGLPEMAVIAAIGLLVFGPKRLPELGRTLGRTLKGFQSASREFEQEFRKAVD  57



>dbj|GAL93280.1| twin-arginine translocation protein TatB [Microcystis aeruginosa 
NIES-44]
Length=82

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKT++ FQ+A+KEFE+E K+E  ++
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQI  59



>ref|WP_002743526.1| primosome subunit DnaD [Microcystis aeruginosa]
 emb|CCI09330.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 7941]
 emb|CCI16179.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9807]
 emb|CCI27315.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI38137.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELS48172.1| twin arginine-targeting translocase, TatA/E family protein [Microcystis 
aeruginosa DIANCHI905]
 gb|EPF17324.1| Sec-independent protein translocase protein TatAd [Microcystis 
aeruginosa SPC777]
Length=82

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKT++ FQ+A+KEFE+E K+E  ++
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQI  59



>ref|WP_011377062.1| MULTISPECIES: twin arginine-targeting protein translocase [Prochlorococcus]
 gb|ABB50579.1| twin-arginine translocation protein, TatA/E family [Prochlorococcus 
marinus str. MIT 9312]
 gb|KGG01480.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. MIT 9311]
Length=89

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK---KEPDEL  537
            +FG+G+P + VI  +  LIFGPK+LPE+GR +GKTLKS QQA+ EF+ E++   KE DE 
Sbjct  3    IFGVGIPEIAVIFVLALLIFGPKKLPELGRSIGKTLKSLQQASGEFQKEIEKAVKETDEE  62

Query  538  PVKEGGE  558
             + +G E
Sbjct  63   VINDGSE  69



>ref|WP_015161113.1| twin arginine-targeting protein translocase, TatA/E family [Chamaesiphon 
minutus]
 gb|AFY95001.1| twin arginine-targeting protein translocase, TatA/E family [Chamaesiphon 
minutus PCC 6605]
Length=83

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
             FG+G+P  + IA V  L+FGPK+LPEIG+ LGK +K FQ+A+ +F++E KKE D +
Sbjct  3    FFGIGLPETIAIAVVVLLVFGPKKLPEIGKSLGKAIKGFQEASNDFQSEFKKEVDAI  59



>ref|WP_041034563.1| preprotein translocase subunit TatA [Tolypothrix campylonemoides]
 gb|KIJ77162.1| preprotein translocase subunit TatA [Tolypothrix campylonemoides 
VB511288]
Length=90

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPE+GR LGK ++SFQQA+ EF+ E +KE  +L
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEVGRSLGKAIRSFQQASNEFQNEFQKEAVQL  59



>ref|WP_002765259.1| primosome subunit DnaD [Microcystis aeruginosa]
 emb|CCI05126.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9443]
Length=82

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGKT++ FQ+A+KEFE+E K+E  ++
Sbjct  3    IFGIGLPEMGLIFLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQI  59



>ref|WP_015136549.1| twin arginine-targeting protein translocase, TatA/E family [Nostoc 
sp. PCC 7524]
 gb|AFY46081.1| twin arginine-targeting protein translocase, TatA/E family [Nostoc 
sp. PCC 7524]
Length=90

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGK ++ FQ+A+ EF++E K+E ++L
Sbjct  3    IFGIGLPEMALIMVVALLIFGPKKLPEIGRSLGKAIRGFQEASNEFQSEFKREAEQL  59



>ref|XP_003074238.1| chloroplast Tha4-2 (ISS) [Ostreococcus tauri]
Length=125

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  334  SNGRKRLYCNCLFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAK  498
            ++ R R+    LFGLG+P +VVI GV A++FGP++LPE+G+ LGKT+KSFQ+AAK
Sbjct  37   AHKRDRVVVRGLFGLGLPEIVVIGGVAAVLFGPQKLPELGKSLGKTVKSFQEAAK  91



>ref|WP_011612401.1| preprotein translocase subunit TatA [Trichodesmium erythraeum]
 sp|Q110N2.1|TATA_TRIEI RecName: Full=Sec-independent protein translocase protein TatA 
[Trichodesmium erythraeum IMS101]
 gb|ABG52042.1| Sec-independent protein translocase TatA [Trichodesmium erythraeum 
IMS101]
Length=87

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDELP--  540
            +FG+G+P ++VI  V  LIFGPK+LPEIGR LG+ + SF+  A++FE E K+E   L   
Sbjct  3    IFGIGLPEMIVILVVALLIFGPKKLPEIGRSLGQAINSFKAGARDFENEFKREAKHLEEG  62

Query  541  VKEGGEEEKPDAVV  582
            VK      +P+ VV
Sbjct  63   VKVSTSASEPEKVV  76



>ref|WP_038551417.1| primosome subunit DnaD [Synechococcus sp. KORDI-52]
 gb|AII47775.1| primosome subunit DnaD [Synechococcus sp. KORDI-52]
Length=76

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINK  54



>gb|AHF62674.1| twin-arginine translocation protein, TatA/E family [Synechococcus 
sp. WH 8109]
Length=76

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDELPVK  546
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K   E  V 
Sbjct  3    IFGVGLPEVAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPEVS  62

Query  547  EGGEEEKP  570
              GE  KP
Sbjct  63   --GEASKP  68



>ref|WP_009546094.1| MULTISPECIES: primosome subunit DnaD [Cyanothece]
 gb|ACB50212.1| putative twin-arginine translocation protein TatA/E [Cyanothece 
sp. ATCC 51142]
Length=89

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGK ++ FQ A+KEFE E K+E  +L
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKREAQQL  59



>ref|WP_011363292.1| primosome subunit DnaD [Synechococcus sp. CC9605]
 gb|ABB34040.1| twin-arginine translocation protein, TatA/E family [Synechococcus 
sp. CC9605]
Length=76

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINK  54



>ref|WP_011429652.1| prohead protease [Synechococcus sp. JA-3-3Ab]
 gb|ABC98968.1| twin-arginine translocation protein TatA [Synechococcus sp. JA-3-3Ab]
Length=112

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
              G+G+P ++VI  V  L+FGP++LPEIGR L KTL+S Q AA+EFE +L +E  EL
Sbjct  3    FLGVGLPEMLVIFAVALLVFGPRKLPEIGRALAKTLRSLQDAAREFEAQLNQEAQEL  59



>ref|WP_008275801.1| primosome subunit DnaD [Cyanothece sp. CCY0110]
 gb|EAZ91191.1| hypothetical protein CY0110_13027 [Cyanothece sp. CCY0110]
Length=89

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGK ++ FQ A+KEFE E K+E  +L
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKREAQQL  59



>gb|AFY67086.1| Sec-independent protein translocase TatA [Geitlerinema sp. PCC 
7407]
Length=105

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK ++ FQ A+KEFE E ++E +++
Sbjct  3    VFGVGLPEMAIIMVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFRREAEQI  59



>ref|WP_032515366.1| hypothetical protein [Prochlorococcus marinus]
 gb|KGG02345.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. MIT 9314]
Length=88

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK---KEPDEL  537
            +FG+G+P + VI  +  LIFGPK+LPE+GR +GKTLKS QQA+ EF+ E++   KE DE 
Sbjct  3    IFGVGIPEIAVIFVLALLIFGPKKLPELGRSIGKTLKSLQQASGEFQKEIEKAVKETDEE  62

Query  538  PVKEGGE  558
             +  G E
Sbjct  63   VINNGSE  69



>ref|WP_006099206.1| primosome subunit DnaD [Coleofasciculus chthonoplastes]
 gb|EDX77093.1| twin arginine-targeting protein translocase, TatA/E family, putative 
[Coleofasciculus chthonoplastes PCC 7420]
Length=95

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIG+ LGK ++ FQ A++EFETE K+E  +L
Sbjct  3    VFGIGLPEMALILIVALLVFGPKKLPEIGQSLGKAIRGFQDASREFETEFKREAQQL  59



>ref|WP_029977877.1| hypothetical protein [Prochlorococcus sp. scB245a_518A17]
Length=71

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELK---KEPDEL  537
            +FG+G+P + VI  +  LIFGPK+LPE+GR +GKTLKS QQA+ EF+ E++   KE DE 
Sbjct  3    IFGVGIPEIAVIFVLALLIFGPKKLPELGRSIGKTLKSLQQASGEFQKEIEKAVKETDEE  62

Query  538  PVKEGGE  558
             + +G E
Sbjct  63   VINDGSE  69



>ref|WP_007100743.1| preprotein translocase subunit TatA [Synechococcus sp. RS9917]
 gb|EAQ68671.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
RS9917]
Length=91

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINK  54



>ref|WP_036913569.1| MULTISPECIES: preprotein translocase subunit TatA [Prochlorococcus]
 gb|KGG26560.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
MIT 0701]
 gb|KGG30115.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
MIT 0702]
 gb|KGG33228.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
MIT 0703]
Length=91

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  +  L+FGPK+LPE GR LGKTLK FQ A+KEFE E+ K   EP+ +
Sbjct  3    VFGIGLPEMAVIGAIALLVFGPKRLPEFGRTLGKTLKGFQAASKEFEREIHKTMAEPESI  62



>ref|WP_015202296.1| Sec-independent protein translocase TatA [Crinalium epipsammum]
 gb|AFZ12174.1| Sec-independent protein translocase TatA [Crinalium epipsammum 
PCC 9333]
Length=89

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGK ++ FQQA+ +FE E K+E +++
Sbjct  3    IFGVGLPEMAIIMVIALLVFGPKKLPEIGRSLGKGIRGFQQASSDFEAEFKREAEQI  59



>ref|WP_041269048.1| preprotein translocase subunit TatA, partial [Geitlerinema sp. 
PCC 7407]
Length=86

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK ++ FQ A+KEFE E ++E +++
Sbjct  3    VFGVGLPEMAIIMVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFRREAEQI  59



>ref|WP_015191613.1| Sec-independent protein translocase protein tatA/E-like protein 
[Stanieria cyanosphaera]
 gb|AFZ33940.1| Sec-independent protein translocase protein tatA/E-like protein 
[Stanieria cyanosphaera PCC 7437]
Length=91

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  L+FGPK+LPEIGR LGK ++ FQ A+KEFE E K+E  ++
Sbjct  3    IFGIGLPEMALILVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKREAQQI  59



>ref|WP_024124248.1| twin-arginine protein translocation system component MttA [Thermosynechococcus 
sp. NK55a]
 gb|AHB87835.1| twin-arginine protein translocation system component MttA [Thermosynechococcus 
sp. NK55a]
Length=77

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE  525
            +FG+G+P L+VI  V  LIFGPK+LPEIGR LGKT ++F++A++EF+ E+K++
Sbjct  3    VFGIGLPELIVILVVALLIFGPKKLPEIGRSLGKTKRAFEEASREFQDEMKRQ  55



>ref|WP_013323574.1| primosome subunit DnaD [Cyanothece sp. PCC 7822]
 gb|ADN15505.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 7822]
Length=94

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDELPVK  546
            +FG+G+P +++I  V  LIFGPK+LPEIGR LGK ++ FQ A+KEFE E ++   +  ++
Sbjct  3    IFGIGLPEMILILVVALLIFGPKKLPEIGRSLGKAIRGFQDASKEFENEFQRATQDQEIE  62

Query  547  E  549
            E
Sbjct  63   E  63



>ref|WP_007099747.1| primosome subunit DnaD [Synechococcus sp. RS9916]
 gb|EAU72692.1| twin-arginine translocation protein, TatA/E family [Synechococcus 
sp. RS9916]
Length=86

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  V  L+FGPK+LPE+GR LGKTLK FQ A+KEFE E+ K
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQAASKEFEREINK  54



>ref|WP_017322731.1| primosome subunit DnaD [cyanobacterium PCC 7702]
Length=82

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGK ++SFQ A++EF+ E +KE  +L
Sbjct  3    IFGIGLPEMALIMIVALLIFGPKKLPEIGRSLGKAIRSFQDASREFQNEFQKEAVQL  59



>ref|WP_006530590.1| twin arginine-targeting protein translocase, TatA/E family [Gloeocapsa 
sp. PCC 73106]
 gb|ELR96558.1| twin arginine-targeting protein translocase, TatA/E family [Gloeocapsa 
sp. PCC 73106]
Length=89

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIG+ LGK ++ FQ+A++EFETE +KE  +L
Sbjct  3    IFGIGLPEMALILVIALLVFGPKKLPEIGQSLGKAIRGFQEASREFETEFQKEARQL  59



>ref|WP_015184092.1| Sec-independent protein translocase TatA [Microcoleus sp. PCC 
7113]
 gb|AFZ19956.1| Sec-independent protein translocase TatA [Microcoleus sp. PCC 
7113]
Length=95

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGK ++ FQ A++EFE+E K+E +++
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQDASREFESEFKREAEQI  59



>ref|WP_011131203.1| preprotein translocase subunit TatA [Prochlorococcus marinus]
 emb|CAE22011.1| mttA/Hcf106 family [Prochlorococcus marinus str. MIT 9313]
Length=91

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  +  L+FGPK+LPE GR LGKTLK FQ A+KEFE E+ K   EP+ +
Sbjct  3    VFGIGLPEMAVIGAIALLVFGPKRLPEFGRTLGKTLKGFQAASKEFEREIHKTMAEPESI  62



>ref|WP_015157036.1| Sec-independent protein translocase TatA [Chroococcidiopsis thermalis]
 gb|AFY90498.1| Sec-independent protein translocase TatA [Chroococcidiopsis thermalis 
PCC 7203]
Length=95

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGK ++SFQ A+ EF++E K+E +++
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEIGRSLGKAIRSFQDASSEFQSEFKREAEQI  59



>ref|WP_007354006.1| MULTISPECIES: preprotein translocase subunit TatA [Kamptonema]
 emb|CBN54781.1| Sec-independent protein translocase protein tatA/E homolog [ 
[[Oscillatoria] sp. PCC 6506]
Length=84

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR +GK L+ FQ A+++FE+E K+E  +L
Sbjct  3    IFGIGLPEMGVILVVALLIFGPKKLPEIGRSMGKALRGFQDASRDFESEFKREAQQL  59



>ref|WP_039713404.1| preprotein translocase subunit TatA [Scytonema millei]
 gb|KIF21063.1| preprotein translocase subunit TatA [Scytonema millei VB511283]
Length=95

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGK ++SFQ A+ EF++E K+E +++
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEIGRSLGKAIRSFQDASNEFQSEFKREAEQI  59



>ref|WP_044259952.1| preprotein translocase subunit TatA, partial [Richelia intracellularis]
Length=71

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR +GK ++ FQ+A+KEF+ E  KE   L
Sbjct  3    IFGIGLPEMAVIMSVALLIFGPKKLPEIGRSMGKAIRGFQEASKEFQDEFHKESAHL  59



>ref|WP_011057225.1| preprotein translocase subunit TatA [Thermosynechococcus elongatus]
 ref|NP_682175.1| hypothetical protein tsl1385 [Thermosynechococcus elongatus BP-1]
 sp|Q8DJ44.1|TATA_THEEB RecName: Full=Sec-independent protein translocase protein TatA 
[Thermosynechococcus elongatus BP-1]
 dbj|BAC08937.1| tsl1385 [Thermosynechococcus elongatus BP-1]
Length=77

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKE  525
            +FG+G+P L+VI  V  LIFGPK+LPEIGR LGKT ++F++A++EF+ E+K++
Sbjct  3    VFGIGLPELIVILVVALLIFGPKKLPEIGRSLGKTKRAFEEASREFQDEIKRQ  55



>ref|WP_011827044.1| preprotein translocase subunit TatA [Prochlorococcus marinus]
 gb|ABM79192.1| mttA/Hcf106 family protein [Prochlorococcus marinus str. MIT 
9303]
Length=91

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK---EPDEL  537
            +FG+G+P + VI  +  L+FGPK+LPE GR LGKTLK FQ A+KEFE E+ K   EP+ +
Sbjct  3    VFGIGLPEMAVIGAIALLVFGPKRLPEFGRTLGKTLKGFQAASKEFEREIHKTMAEPESI  62



>gb|AFY70239.1| Sec-independent protein translocase protein tatA/E-like protein 
[Pseudanabaena sp. PCC 7367]
Length=133

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETEL  516
            +FG+G+P +VVI  V  LIFGPK+LPEIGR +GK +KSFQ A++EF+ E+
Sbjct  3    IFGIGLPEMVVIMVVALLIFGPKKLPEIGRSMGKAIKSFQDASREFQDEI  52



>ref|WP_015209228.1| twin arginine-targeting protein translocase, TatA/E family [Cylindrospermum 
stagnale]
 gb|AFZ25985.1| twin arginine-targeting protein translocase, TatA/E family [Cylindrospermum 
stagnale PCC 7417]
Length=90

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGKT++ FQ+A+ EF++E K+E + +
Sbjct  3    IFGIGLPEMGLIMIVALLIFGPKKLPEIGRSLGKTIRGFQEASNEFQSEFKREAENI  59



>ref|WP_036029486.1| hypothetical protein, partial [Leptolyngbya sp. PCC 6406]
Length=82

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 6/77 (8%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL---  537
             FG+G+P + +I  +  L+FGPK+LPEIG  L K LKSFQ+A ++FE E K+E +EL   
Sbjct  3    FFGIGLPEMALILVIALLVFGPKKLPEIGSSLAKALKSFQKAQQDFEAEFKREAEELQKS  62

Query  538  ---PVKEGGEEEKPDAV  579
               P+K   E+ +P A+
Sbjct  63   VTEPMKASLEKPEPKAL  79



>ref|WP_016858680.1| MULTISPECIES: primosome subunit DnaD [Stigonematales]
 gb|KIY09317.1| preprotein translocase subunit TatA [Mastigocladus laminosus 
UU774]
Length=82

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  LIFGPK+LPEIGR +GK ++ FQ A+KEF+ E +KE  ++
Sbjct  3    VFGIGLPEMAVIMVVALLIFGPKKLPEIGRSMGKAIRGFQDASKEFQNEFQKEAAQI  59



>ref|WP_043694585.1| primosome subunit DnaD [Synechococcus sp. KORDI-49]
 gb|AII46826.1| primosome subunit DnaD [Synechococcus sp. KORDI-49]
Length=77

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  V  L+FGPK+LPE+G+ LGKTLK FQ A+KEFE E+ K
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGKTLGKTLKGFQSASKEFEREINK  54



>ref|WP_011321124.1| primosome subunit DnaD [Anabaena variabilis]
 gb|ABA24047.1| Sec-independent protein translocase TatA [Anabaena variabilis 
ATCC 29413]
Length=90

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGK ++ FQ+A+ EF++E K+E ++L
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSLGKAIRGFQEASNEFQSEFKREAEQL  59



>ref|WP_011434012.1| prohead protease [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03383.1| twin-arginine translocation protein TatA [Synechococcus sp. JA-2-3B'a(2-13)]
Length=114

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
              G+G+P ++VI  V  L+FGP++LPEIGR L KTL+S Q A++EFE +L KE  EL
Sbjct  3    FLGVGLPEMLVIFAVALLVFGPRKLPEIGRTLAKTLRSLQDASREFEAQLNKEAQEL  59



>ref|WP_010312066.1| primosome subunit DnaD [Synechococcus sp. CB0101]
Length=87

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPD  531
            +FG+G+P L VIA +  L+FGPK+LPE+G+ LG+TLK FQ A+ EFE E +K  D
Sbjct  3    VFGVGLPELAVIAAIGLLVFGPKRLPELGKTLGRTLKGFQSASSEFEKEFRKAVD  57



>ref|WP_010995019.1| primosome subunit DnaD [Nostoc sp. PCC 7120]
 dbj|BAB72802.1| asl0845 [Nostoc sp. PCC 7120]
Length=90

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR +GK ++ FQ+A+ EF++E K+E ++L
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASNEFQSEFKREAEQL  59



>ref|WP_016875716.1| primosome subunit DnaD [Chlorogloeopsis fritschii]
Length=82

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR +GK ++ FQ+A+KEF+ E +KE  ++
Sbjct  3    VFGIGLPEMALIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASKEFQNEFQKEAAQI  59



>ref|WP_007306580.1| primosome subunit DnaD [Crocosphaera watsonii]
 gb|EAM49731.1| Twin-arginine translocation protein TatA/E [Crocosphaera watsonii 
WH 8501]
 gb|EHJ11573.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0003]
 emb|CCQ62909.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0401]
 emb|CCQ53221.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 8502]
 emb|CCQ55142.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0005]
 emb|CCQ66787.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0402]
Length=95

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGK ++ FQ A+KEFE E K+E  +L
Sbjct  3    VFGIGLPEMGLILVIALLVFGPKKLPEIGRSLGKAVRGFQDASKEFENEFKREAQQL  59



>ref|WP_015111805.1| Sec-independent protein translocase TatA [Nostoc sp. PCC 7107]
 gb|AFY41566.1| Sec-independent protein translocase TatA [Nostoc sp. PCC 7107]
Length=85

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  V  L+FGPK+LPEIGR +GK ++ FQ+A+ EF+ E K+E +++
Sbjct  3    IFGIGLPEMAVIMIVALLVFGPKKLPEIGRSVGKAIRGFQEASNEFQNEFKREAEQI  59



>gb|KIJ84523.1| preprotein translocase subunit TatA [Scytonema tolypothrichoides 
VB-61278]
Length=98

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPE+GR LGK ++ FQ+A+KEF+ E +KE  +L
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEVGRSLGKAIRGFQEASKEFQNEFQKEAIQL  59



>ref|WP_036916527.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
Length=77

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKK  522
            +FG+G+P + VI  +  ++FGPK+LPE+GR +GKTLKS Q+A+ EFE EL+K
Sbjct  3    IFGVGLPEIAVIVALALVVFGPKKLPELGRNIGKTLKSLQKASSEFENELQK  54



>ref|WP_009459239.1| MULTISPECIES: primosome subunit DnaD [Fischerella]
 gb|EHC09741.1| Sec-independent protein translocase protein tatA/E-like protein 
[Fischerella sp. JSC-11]
Length=82

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR LGK ++ FQ A+KEF+ E +KE  ++
Sbjct  3    VFGIGLPEMALIMMVALLIFGPKKLPEIGRSLGKAIRGFQDASKEFQNEFQKEAAQI  59



>ref|WP_006633691.1| preprotein translocase subunit TatA [Microcoleus vaginatus]
 gb|EGK86699.1| Sec-independent protein translocase protein tatA/E-like protein 
[Microcoleus vaginatus FGP-2]
Length=86

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  +  L+FGPK+LPEIGR +GK ++ FQ A+++FE+E  +E  +L
Sbjct  3    IFGIGLPEMAVIFTIALLVFGPKKLPEIGRSMGKAIRGFQDASRDFESEFTREAKQL  59



>ref|WP_015176008.1| Sec-independent protein translocase TatA [Oscillatoria nigro-viridis]
 gb|AFZ06707.1| Sec-independent protein translocase TatA [Oscillatoria nigro-viridis 
PCC 7112]
Length=86

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  +  L+FGPK+LPEIGR +GK ++ FQ A+++FE+E  +E  +L
Sbjct  3    IFGIGLPEMAVIFTIALLVFGPKKLPEIGRSMGKAIRGFQDASRDFESEFTREAKQL  59



>ref|WP_011294250.1| translocase [Prochlorococcus marinus]
 gb|AAZ59105.1| Twin-arginine translocation protein TatA/E [Prochlorococcus marinus 
str. NATL2A]
Length=71

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            +FG+G+P + VIAG+  +IFGPK+LPE+GR +GKTLK  Q A+ EFE E+K    E
Sbjct  3    IFGVGLPEIAVIAGLALVIFGPKRLPELGRTIGKTLKGLQSASTEFEREIKNAMTE  58



>ref|WP_029637480.1| preprotein translocase subunit TatA [[Scytonema hofmanni] UTEX 
B 1581]
Length=90

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR +GK ++ FQ+A+ EF+ E K+E ++L
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASSEFQNEFKREAEKL  59



>ref|WP_006618394.1| MULTISPECIES: preprotein translocase subunit TatA [Arthrospira]
 gb|EDZ92615.1| twin-arginine translocation protein, TatA/E family subunit [Arthrospira 
maxima CS-328]
 dbj|BAI91441.1| hypothetical protein [Arthrospira platensis NIES-39]
 emb|CCE16819.1| Sec-independent protein translocase protein tatA/E homolog [Arthrospira 
sp. PCC 8005]
 gb|EKD07416.1| twin-arginine translocation protein TatA/E family subunit [Arthrospira 
platensis C1]
 emb|CDM96340.1| Sec-independent protein translocase protein tatA/E homolog [Arthrospira 
sp. PCC 8005]
 gb|KDR57224.1| preprotein translocase subunit TatA [Arthrospira platensis str. 
Paraca]
Length=75

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + VI  +  LIFGPK+LPE+GR LG+ ++ FQ+A++EF+TE  +E +++
Sbjct  3    IFGMGLPEMAVILVLALLIFGPKKLPEMGRSLGEAIRKFQEASQEFKTEFNREAEQI  59



>ref|WP_011823102.1| translocase [Prochlorococcus marinus]
 gb|ABM74893.1| Hypothetical protein NATL1_03291 [Prochlorococcus marinus str. 
NATL1A]
 gb|KGG20273.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. PAC1]
Length=71

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDE  534
            +FG+G+P + VIAG+  +IFGPK+LPE+GR +GKTLK  Q A+ EFE E+K    E
Sbjct  3    IFGVGLPEIAVIAGLALVIFGPKRLPELGRTIGKTLKGLQSASTEFEREIKNAMTE  58



>ref|WP_041699455.1| preprotein translocase subunit TatA, partial [Pseudanabaena sp. 
PCC 7367]
Length=51

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETE  513
            +FG+G+P +VVI  V  LIFGPK+LPEIGR +GK +KSFQ A++EF+ E
Sbjct  3    IFGIGLPEMVVIMVVALLIFGPKKLPEIGRSMGKAIKSFQDASREFQDE  51



>ref|WP_039739679.1| preprotein translocase subunit TatA [Hassallia byssoidea]
 gb|KIF37065.1| preprotein translocase subunit TatA [Hassallia byssoidea VB512170]
Length=90

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  V  LIFGPK+LPEIGR +GK ++ FQ+A+ EF+ E K+E ++L
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASSEFQNEFKQEAEKL  59



>ref|WP_036617295.1| preprotein translocase subunit TatA, partial [Oscillatoriales 
cyanobacterium JSC-12]
Length=72

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  367  LFGLGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +FG+G+P + +I  +  L+FGPK+LPEIGR LGK ++ FQ+A+ EF+ E K+E +++
Sbjct  3    IFGIGLPEMALIFVIALLVFGPKKLPEIGRSLGKAIRGFQEASNEFQNEFKREAEQI  59



>gb|AFY84251.1| twin arginine-targeting protein translocase, TatA/E family [Oscillatoria 
acuminata PCC 6304]
Length=78

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  376  LGVPXLVVIAGVTALIFGPKQLPEIGRGLGKTLKSFQQAAKEFETELKKEPDEL  537
            +G+P ++VI  +  LIFGPK+LPEIGR +GK ++ FQ A++EFE+E+K+E +++
Sbjct  1    MGLPEIMVILTIALLIFGPKKLPEIGRSMGKAIRGFQDASREFESEIKREAEQI  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960