BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050A07

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001142479.1|  uncharacterized protein LOC100274696               343   2e-115   
gb|KDO58184.1|  hypothetical protein CISIN_1g0453552mg                  342   5e-115   Citrus sinensis [apfelsine]
gb|KGN45336.1|  hypothetical protein Csa_7G440577                       340   4e-113   Cucumis sativus [cucumbers]
ref|XP_009778994.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    352   5e-112   Nicotiana sylvestris
ref|XP_009778993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    352   1e-111   Nicotiana sylvestris
ref|XP_010654709.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    349   1e-111   Vitis vinifera
ref|XP_002299630.2|  acetyltransferase-related family protein           350   3e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009623793.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    350   5e-111   Nicotiana tomentosiformis
ref|XP_009619830.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    349   5e-111   Nicotiana tomentosiformis
ref|XP_009802987.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    350   6e-111   Nicotiana sylvestris
ref|XP_011072284.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    350   6e-111   Sesamum indicum [beniseed]
ref|XP_011002722.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    349   8e-111   Populus euphratica
ref|XP_004235695.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    349   9e-111   Solanum lycopersicum
ref|XP_009619829.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    349   1e-110   Nicotiana tomentosiformis
ref|XP_010654708.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    349   1e-110   Vitis vinifera
gb|KJB70535.1|  hypothetical protein B456_011G078200                    348   2e-110   Gossypium raimondii
ref|XP_002284882.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    348   2e-110   Vitis vinifera
ref|XP_010249876.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    347   3e-110   Nelumbo nucifera [Indian lotus]
ref|XP_006343105.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    347   5e-110   Solanum tuberosum [potatoes]
gb|KDP37181.1|  hypothetical protein JCGZ_06237                         347   1e-109   Jatropha curcas
ref|XP_006356169.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    346   2e-109   Solanum tuberosum [potatoes]
ref|XP_010110300.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    346   2e-109   Morus notabilis
ref|XP_002304180.1|  acetyltransferase-related family protein           343   3e-109   
gb|EYU21564.1|  hypothetical protein MIMGU_mgv1a001105mg                345   4e-109   Erythranthe guttata [common monkey flower]
ref|XP_006465444.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    345   4e-109   Citrus sinensis [apfelsine]
ref|XP_004506868.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    345   5e-109   Cicer arietinum [garbanzo]
ref|XP_009358212.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    345   5e-109   Pyrus x bretschneideri [bai li]
ref|XP_006427096.1|  hypothetical protein CICLE_v10024839mg             343   5e-109   
ref|XP_009358213.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    345   5e-109   Pyrus x bretschneideri [bai li]
ref|XP_009358220.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    345   6e-109   
ref|XP_006427095.1|  hypothetical protein CICLE_v10024839mg             343   6e-109   
ref|XP_002517521.1|  NMDA receptor-regulated protein, putative          344   7e-109   Ricinus communis
ref|XP_009339003.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    344   8e-109   Pyrus x bretschneideri [bai li]
ref|XP_008373494.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    344   8e-109   
ref|XP_004241722.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    343   1e-108   Solanum lycopersicum
gb|KEH28765.1|  amino-terminal acetyltransferase, putative              343   1e-108   Medicago truncatula
ref|XP_006427097.1|  hypothetical protein CICLE_v10024839mg             343   2e-108   Citrus clementina [clementine]
ref|XP_011000818.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    343   2e-108   Populus euphratica
gb|KEH39579.1|  amino-terminal acetyltransferase, putative              342   3e-108   Medicago truncatula
gb|KHN01367.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    342   4e-108   Glycine soja [wild soybean]
ref|XP_003531689.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    342   4e-108   Glycine max [soybeans]
ref|XP_009416095.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    342   4e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003528376.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    342   4e-108   Glycine max [soybeans]
ref|XP_006583136.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    343   4e-108   Glycine max [soybeans]
ref|XP_003546283.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    342   5e-108   Glycine max [soybeans]
ref|XP_008672544.1|  PREDICTED: uncharacterized protein LOC100274...    342   5e-108   
ref|XP_008228606.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    342   6e-108   Prunus mume [ume]
ref|XP_008461048.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    342   6e-108   
ref|XP_002458160.1|  hypothetical protein SORBIDRAFT_03g027980          342   6e-108   Sorghum bicolor [broomcorn]
ref|XP_004135824.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    342   7e-108   
gb|KEH39578.1|  amino-terminal acetyltransferase, putative              342   7e-108   Medicago truncatula
ref|XP_008792977.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    342   7e-108   Phoenix dactylifera
ref|XP_007024039.1|  Tetratricopeptide repeat (TPR)-containing pr...    342   8e-108   
gb|KHN44136.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    341   1e-107   Glycine soja [wild soybean]
ref|XP_006644372.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    341   2e-107   Oryza brachyantha
ref|XP_007135709.1|  hypothetical protein PHAVU_010G151600g             340   2e-107   Phaseolus vulgaris [French bean]
gb|KHM98779.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    340   2e-107   Glycine soja [wild soybean]
ref|XP_010912607.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    340   2e-107   Elaeis guineensis
ref|XP_007217133.1|  hypothetical protein PRUPE_ppa001163m2g            318   2e-107   
ref|XP_003597797.1|  NMDA receptor-regulated protein                    342   2e-107   
ref|XP_004969173.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    340   3e-107   Setaria italica
ref|XP_003543657.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    340   3e-107   Glycine max [soybeans]
ref|XP_006389790.1|  hypothetical protein EUTSA_v10018100mg             340   4e-107   Eutrema salsugineum [saltwater cress]
gb|KHG11825.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    340   5e-107   Gossypium arboreum [tree cotton]
gb|KFK42434.1|  hypothetical protein AALP_AA2G256000                    339   5e-107   Arabis alpina [alpine rockcress]
gb|KJB56693.1|  hypothetical protein B456_009G132500                    339   6e-107   Gossypium raimondii
ref|XP_009385624.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    339   6e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56692.1|  hypothetical protein B456_009G132500                    339   7e-107   Gossypium raimondii
ref|XP_009385623.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    339   7e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010691269.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    339   9e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002887831.1|  EMB2753                                            339   9e-107   Arabidopsis lyrata subsp. lyrata
ref|NP_178157.2|  protein EMBRYO DEFECTIVE 2753                         338   1e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809145.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    338   1e-106   
ref|XP_010254211.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    338   1e-106   Nelumbo nucifera [Indian lotus]
ref|XP_006844401.1|  hypothetical protein AMTR_s00142p00102260          338   1e-106   Amborella trichopoda
gb|EEC71092.1|  hypothetical protein OsI_02873                          338   1e-106   Oryza sativa Indica Group [Indian rice]
ref|NP_001043582.1|  Os01g0617500                                       338   1e-106   
ref|XP_010539517.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    338   2e-106   Tarenaya hassleriana [spider flower]
ref|NP_001185448.1|  protein EMBRYO DEFECTIVE 2753                      338   2e-106   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38667.1|  BnaC02g23120D                                          338   2e-106   Brassica napus [oilseed rape]
ref|XP_010232026.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    338   3e-106   
ref|XP_003569365.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    338   3e-106   
ref|XP_004302931.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    337   3e-106   Fragaria vesca subsp. vesca
gb|EEE54991.1|  hypothetical protein OsJ_02617                          337   4e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006301121.1|  hypothetical protein CARUB_v10021530mg             337   4e-106   
emb|CDM83394.1|  unnamed protein product                                337   4e-106   Triticum aestivum [Canadian hard winter wheat]
emb|CDX67946.1|  BnaA07g19860D                                          337   6e-106   
ref|XP_010062441.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    336   9e-106   Eucalyptus grandis [rose gum]
ref|XP_010474515.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    314   1e-105   Camelina sativa [gold-of-pleasure]
gb|KHN47800.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    336   1e-105   Glycine soja [wild soybean]
ref|XP_010417709.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    335   1e-105   Camelina sativa [gold-of-pleasure]
emb|CDY39981.1|  BnaC06g40590D                                          337   1e-105   Brassica napus [oilseed rape]
ref|XP_010429971.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    335   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010537937.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    335   2e-105   Tarenaya hassleriana [spider flower]
emb|CDY37595.1|  BnaA02g19750D                                          335   2e-105   Brassica napus [oilseed rape]
ref|XP_009104460.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    335   2e-105   Brassica rapa
ref|XP_009128424.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    335   2e-105   Brassica rapa
ref|XP_010532133.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    335   2e-105   Tarenaya hassleriana [spider flower]
emb|CDX79387.1|  BnaC06g19160D                                          335   4e-105   
ref|XP_007150682.1|  hypothetical protein PHAVU_005G172700g             334   4e-105   Phaseolus vulgaris [French bean]
ref|XP_010925105.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    335   4e-105   Elaeis guineensis
ref|XP_010925104.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    335   4e-105   Elaeis guineensis
emb|CDO98079.1|  unnamed protein product                                332   6e-104   Coffea canephora [robusta coffee]
ref|XP_009106750.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    330   2e-103   Brassica rapa
emb|CDX87308.1|  BnaA07g35650D                                          326   6e-102   
ref|XP_009106749.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    316   5e-98    Brassica rapa
ref|XP_002961540.1|  hypothetical protein SELMODRAFT_164833             313   6e-97    
ref|XP_002971274.1|  hypothetical protein SELMODRAFT_94950              312   8e-97    
gb|AAF27136.1|AC018849_24  putative N-terminal acetyltransferase;...    306   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001764313.1|  predicted protein                                  306   2e-94    
ref|XP_001776114.1|  predicted protein                                  305   4e-94    
ref|XP_010474516.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    305   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_001783197.1|  predicted protein                                  303   4e-93    
gb|KHN20434.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    265   2e-86    Glycine soja [wild soybean]
gb|ETL77843.1|  hypothetical protein L917_21235                         275   4e-84    Phytophthora parasitica
gb|ETM31097.1|  hypothetical protein L914_21244                         276   7e-84    Phytophthora parasitica
gb|ETP28747.1|  hypothetical protein F442_21980                         276   7e-84    Phytophthora parasitica P10297
gb|ETP00579.1|  hypothetical protein F441_22010                         276   7e-84    Phytophthora parasitica CJ01A1
gb|ETI30789.1|  hypothetical protein F443_22116                         276   7e-84    Phytophthora parasitica P1569
gb|ETL24634.1|  hypothetical protein L916_21376                         274   8e-84    Phytophthora parasitica
gb|ETK71183.1|  hypothetical protein L915_21512                         273   1e-83    Phytophthora parasitica
ref|XP_008915357.1|  hypothetical protein PPTG_18551                    275   1e-83    Phytophthora parasitica INRA-310
ref|XP_008607810.1|  hypothetical protein SDRG_03939                    276   1e-83    Saprolegnia diclina VS20
gb|KDO25758.1|  hypothetical protein SPRG_09056                         276   2e-83    Saprolegnia parasitica CBS 223.65
ref|XP_002899585.1|  N-terminal acetyltransferase A complex subun...    274   3e-83    Phytophthora infestans T30-4
ref|XP_009526689.1|  hypothetical protein PHYSODRAFT_331569             272   2e-82    Phytophthora sojae
ref|XP_009834389.1|  hypothetical protein H257_09749                    273   3e-82    Aphanomyces astaci
ref|XP_008876110.1|  hypothetical protein H310_11284                    272   4e-82    Aphanomyces invadans
emb|CCI42224.1|  unnamed protein product                                266   5e-80    Albugo candida
gb|KJB13120.1|  hypothetical protein B456_002G058200                    262   2e-78    Gossypium raimondii
ref|XP_008342751.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    252   2e-78    
gb|KHG22454.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    243   2e-78    Gossypium arboreum [tree cotton]
ref|XP_005847916.1|  hypothetical protein CHLNCDRAFT_35269              257   5e-77    Chlorella variabilis
ref|XP_004173929.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   9e-77    
gb|EMS52083.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    258   4e-76    Triticum urartu
ref|XP_005827391.1|  hypothetical protein GUITHDRAFT_158303             253   5e-76    Guillardia theta CCMP2712
ref|XP_004376674.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   4e-75    
ref|XP_010574853.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   2e-74    Haliaeetus leucocephalus
ref|XP_011368048.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   2e-74    
ref|XP_004405382.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   2e-74    Odobenus rosmarus divergens
ref|XP_004274602.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   2e-74    
ref|XP_004433676.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   2e-74    
ref|XP_008996433.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   2e-74    
ref|XP_006076577.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   3e-74    
ref|XP_010844474.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   3e-74    Bison bison bison
ref|XP_004054472.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   3e-74    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_009190099.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   3e-74    
ref|NP_060997.2|  N-alpha-acetyltransferase 16, NatA auxiliary su...    238   3e-74    Homo sapiens [man]
ref|XP_008166844.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   4e-74    Chrysemys picta bellii
ref|XP_010844470.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   5e-74    Bison bison bison
ref|XP_007186857.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   6e-74    Balaenoptera acutorostrata scammoni
ref|XP_007501585.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   6e-74    Monodelphis domestica
ref|XP_010254212.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    250   7e-74    Nelumbo nucifera [Indian lotus]
ref|XP_008166841.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   9e-74    Chrysemys picta bellii
ref|XP_007468672.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   1e-73    Lipotes vexillifer [baiji]
ref|XP_009033788.1|  hypothetical protein AURANDRAFT_36410              250   1e-73    Aureococcus anophagefferens
ref|XP_010844471.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   1e-73    Bison bison bison
ref|NP_001096570.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    239   1e-73    
ref|XP_004054473.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   2e-73    
ref|NP_001104268.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    240   2e-73    Homo sapiens [man]
ref|XP_005585790.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   3e-73    
ref|XP_004577510.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    236   4e-73    Ochotona princeps [southern American pika]
ref|XP_010844469.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   4e-73    Bison bison bison
ref|XP_010574846.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   1e-72    Haliaeetus leucocephalus
ref|XP_004433675.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   1e-72    
ref|XP_006076576.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   2e-72    Bubalus bubalis [domestic water buffalo]
ref|XP_007958425.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   2e-72    Chlorocebus sabaeus
ref|XP_005585789.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   2e-72    Macaca fascicularis [crab eating macaque]
ref|XP_010844468.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   2e-72    Bison bison bison
gb|EAX08658.1|  NMDA receptor regulated 1-like, isoform CRA_e           240   2e-72    Homo sapiens [man]
ref|XP_007958423.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   4e-72    Chlorocebus sabaeus
ref|XP_005585788.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   4e-72    
ref|XP_010372810.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   4e-72    Rhinopithecus roxellana
emb|CAE45801.1|  hypothetical protein                                   239   4e-72    Homo sapiens [man]
ref|XP_009438834.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   4e-72    Pan troglodytes
ref|XP_011368047.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   5e-72    
ref|XP_011368044.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   6e-72    Pteropus vampyrus
emb|CCA19584.1|  Nterminal acetyltransferase A complex subunit na...    244   6e-72    Albugo laibachii Nc14
ref|XP_011368046.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   7e-72    Pteropus vampyrus
ref|XP_006003551.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   7e-72    Latimeria chalumnae
ref|XP_006076575.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   8e-72    Bubalus bubalis [domestic water buffalo]
ref|XP_010844467.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   9e-72    Bison bison bison
ref|XP_007186856.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   9e-72    
ref|XP_007501584.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   1e-71    Monodelphis domestica
ref|XP_010372809.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-71    Rhinopithecus roxellana
ref|XP_009438833.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-71    
ref|XP_004462843.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   1e-71    
ref|XP_005266579.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-71    
ref|XP_006076574.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-71    
ref|XP_007501583.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   2e-71    Monodelphis domestica
ref|XP_002740751.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    243   2e-71    Saccoglossus kowalevskii
ref|XP_004462842.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-71    Dasypus novemcinctus
ref|XP_007501582.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-71    
ref|XP_010590885.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    243   5e-71    Loxodonta africana [African bush elephant]
ref|XP_004376673.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    243   5e-71    Trichechus manatus latirostris
ref|XP_005895886.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-71    Bos mutus
ref|XP_007523818.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-71    Erinaceus europaeus [common hedgehog]
ref|XP_004385540.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-71    
ref|XP_004426542.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-71    
ref|XP_006076572.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   6e-71    Bubalus bubalis [domestic water buffalo]
ref|XP_006887091.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-71    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004265192.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-71    Orcinus orca [Orca]
ref|XP_007939400.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-71    Orycteropus afer afer
gb|EAX08655.1|  NMDA receptor regulated 1-like, isoform CRA_b           240   6e-71    Homo sapiens [man]
ref|XP_007456941.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   7e-71    Lipotes vexillifer [baiji]
ref|XP_010590884.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    242   7e-71    Loxodonta africana [African bush elephant]
ref|XP_004405994.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-71    Odobenus rosmarus divergens
ref|XP_009438832.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   8e-71    Pan troglodytes
ref|XP_008471752.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    237   8e-71    
ref|XP_010844466.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Bison bison bison
ref|XP_006076573.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    
ref|XP_004462841.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Dasypus novemcinctus
ref|XP_006639086.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    242   1e-70    
ref|XP_009438831.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Pan troglodytes
ref|XP_006719929.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Homo sapiens [man]
ref|XP_011288389.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    
ref|XP_006741282.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Leptonychotes weddellii
ref|XP_006076571.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Bubalus bubalis [domestic water buffalo]
ref|XP_009438830.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Pan troglodytes
ref|XP_010844462.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Bison bison bison
ref|XP_003790194.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Otolemur garnettii
ref|XP_005301537.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    
ref|XP_004433674.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   1e-70    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008768346.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    231   2e-70    Rattus norvegicus [brown rat]
ref|XP_004680181.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Condylura cristata
ref|XP_010844463.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Bison bison bison
ref|XP_004405381.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Odobenus rosmarus divergens
ref|XP_006076570.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Bubalus bubalis [domestic water buffalo]
gb|EAX08660.1|  NMDA receptor regulated 1-like, isoform CRA_g           241   2e-70    Homo sapiens [man]
ref|XP_002749049.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Callithrix jacchus [common marmoset]
ref|XP_005585784.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    
ref|XP_011218870.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    
ref|NP_078837.3|  N-alpha-acetyltransferase 16, NatA auxiliary su...    241   2e-70    Homo sapiens [man]
ref|XP_001150675.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Pan troglodytes
ref|XP_002915916.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Ailuropoda melanoleuca
ref|XP_004462840.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   2e-70    Dasypus novemcinctus
ref|XP_011288295.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Felis catus [cat]
ref|XP_010372807.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Rhinopithecus roxellana
ref|XP_004759344.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Mustela putorius furo [black ferret]
ref|XP_009905882.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Picoides pubescens
ref|XP_001368680.3|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Monodelphis domestica
ref|XP_006003550.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   2e-70    Latimeria chalumnae
ref|XP_002196302.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Taeniopygia guttata
ref|XP_004274601.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Orcinus orca [Orca]
ref|XP_003913858.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Papio anubis [baboon]
ref|NP_001253545.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    241   2e-70    Macaca mulatta [rhesus macaque]
ref|XP_003806946.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    241   2e-70    Pan paniscus [bonobo]
ref|XP_009101228.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Serinus canaria [canary]
ref|XP_005230744.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Falco peregrinus [peregrine]
ref|XP_009556072.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Cuculus canorus
ref|XP_002713015.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Oryctolagus cuniculus [domestic rabbit]
ref|XP_005516456.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_011218869.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Ailuropoda melanoleuca
ref|XP_006124448.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   2e-70    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005301536.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   3e-70    Chrysemys picta bellii
ref|XP_007958420.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   3e-70    Chlorocebus sabaeus
ref|XP_007468671.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   3e-70    Lipotes vexillifer [baiji]
ref|XP_011288270.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   3e-70    Felis catus [cat]
gb|AAI26031.1|  Narg1l protein                                          237   3e-70    synthetic construct
ref|XP_010844461.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-70    Bison bison bison
ref|XP_011288330.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-70    
ref|XP_010343309.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-70    Saimiri boliviensis boliviensis
ref|XP_008258237.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-70    Oryctolagus cuniculus [domestic rabbit]
ref|XP_007186852.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-70    Balaenoptera acutorostrata scammoni
ref|XP_010574839.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   3e-70    Haliaeetus leucocephalus
gb|AAH32642.1|  NARG1 protein                                           236   4e-70    Homo sapiens [man]
ref|XP_002938092.2|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   4e-70    
ref|XP_007186851.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   4e-70    Balaenoptera acutorostrata scammoni
ref|XP_004911890.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    241   4e-70    Xenopus tropicalis [western clawed frog]
ref|XP_417028.2|  PREDICTED: N-alpha-acetyltransferase 16, NatA a...    240   4e-70    Gallus gallus [bantam]
gb|AAH39818.1|  NARG1 protein                                           236   4e-70    Homo sapiens [man]
ref|XP_004938719.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   4e-70    Gallus gallus [bantam]
ref|XP_007186850.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    240   4e-70    Balaenoptera acutorostrata scammoni
ref|XP_003482946.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    240   5e-70    Sus scrofa [pigs]
ref|XP_004322470.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    239   6e-70    
ref|XP_006003549.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   6e-70    Latimeria chalumnae
ref|XP_006884630.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   6e-70    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_009044896.1|  hypothetical protein LOTGIDRAFT_198658             239   6e-70    Lottia gigantea
ref|XP_007946370.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    239   7e-70    Orycteropus afer afer
gb|KFM72043.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    239   1e-69    
gb|KDR18769.1|  NMDA receptor-regulated protein 1                       234   1e-69    
ref|XP_420407.4|  PREDICTED: N-alpha-acetyltransferase 15, NatA a...    238   2e-69    
gb|AAH44392.1|  Narg1b protein                                          234   2e-69    
ref|XP_011401267.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    237   2e-69    
gb|AAH71438.1|  Narg1b protein                                          234   2e-69    
ref|XP_003218678.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   2e-69    
ref|XP_010886484.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   2e-69    
ref|XP_002946235.1|  hypothetical protein VOLCADRAFT_55571              236   3e-69    
gb|EFN82187.1|  NMDA receptor-regulated protein 1                       233   3e-69    
ref|XP_010351785.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   3e-69    
ref|XP_005336837.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    238   3e-69    
gb|EFZ17636.1|  hypothetical protein SINV_12886                         233   3e-69    
ref|XP_005386749.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   3e-69    
ref|XP_008212117.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   3e-69    
gb|EGI65509.1|  NMDA receptor-regulated protein 1                       233   4e-69    
ref|XP_007229932.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   4e-69    
ref|XP_006264092.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    237   4e-69    
ref|XP_007998021.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   4e-69    
gb|AAH45491.2|  NMDA receptor-regulated gene 1a                         237   4e-69    
gb|EFN64825.1|  NMDA receptor-regulated protein 1                       233   5e-69    
ref|XP_008768342.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    231   5e-69    
ref|XP_004577509.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    237   5e-69    
ref|XP_006837670.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    237   5e-69    
ref|XP_005102207.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   5e-69    
ref|XP_009205857.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   6e-69    
ref|NP_956940.1|  N-alpha-acetyltransferase 15, NatA auxiliary su...    237   6e-69    
ref|XP_007063799.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   6e-69    
ref|XP_008144565.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    236   6e-69    
ref|XP_008405679.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   6e-69    
gb|ETN66349.1|  NMDA receptor-regulated protein 1                       237   6e-69    
ref|XP_004855042.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   6e-69    
ref|XP_005344013.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   6e-69    
ref|XP_007544683.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   7e-69    
ref|XP_003129234.2|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   7e-69    
ref|XP_004855043.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   7e-69    
ref|XP_005102206.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   7e-69    
ref|XP_005386746.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   7e-69    
ref|XP_005386747.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   7e-69    
ref|NP_001104184.1|  N(alpha)-acetyltransferase 15, NatA auxiliar...    237   7e-69    
ref|XP_004643687.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    237   7e-69    
ref|XP_005458909.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   7e-69    
ref|XP_005710461.1|  unnamed protein product                            236   7e-69    
ref|XP_005803075.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   7e-69    
ref|XP_005327627.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   7e-69    
ref|XP_007939399.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   7e-69    
ref|XP_007523816.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_004426541.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|NP_001126952.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    236   8e-69    
ref|XP_005656593.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_005263293.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_004643688.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_006906280.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_005607893.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_006906281.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_005737422.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|NP_001178248.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    236   8e-69    
ref|XP_006079327.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_008972362.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_008265652.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_006079328.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_005217625.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|NP_001017001.2|  N(alpha)-acetyltransferase 15, NatA auxiliar...    236   8e-69    
ref|XP_005737421.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_002745391.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_002716918.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_006872287.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
dbj|BAG37192.1|  unnamed protein product                                236   8e-69    
gb|AAM48746.1|  transcriptional coactivator tubedown-100                236   8e-69    
ref|XP_001502546.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|NP_001245032.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    236   8e-69    
ref|XP_010336960.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_007998019.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_008841645.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   8e-69    
ref|XP_003476834.2|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    236   8e-69    
ref|XP_003928083.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_008990937.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_006766120.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_005458908.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   9e-69    
ref|NP_476516.1|  N-alpha-acetyltransferase 15, NatA auxiliary su...    236   9e-69    
ref|XP_006261776.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_002916186.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
gb|AAO33713.1|AF510858_1  N-terminal aceyltransferase 1                 236   9e-69    
ref|XP_006766119.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_001138279.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_006977653.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_004768548.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_004265191.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_004538871.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_007456940.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|NP_444319.3|  N-alpha-acetyltransferase 15, NatA auxiliary su...    236   9e-69    
ref|XP_010588868.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_007496372.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_006081762.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_003448033.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_006144689.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_005470119.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|NP_001101144.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    236   9e-69    
ref|XP_007496371.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_007172398.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    236   9e-69    
ref|XP_004405993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_004385539.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_004768547.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   9e-69    
ref|XP_006887090.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_010734112.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_005919210.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_006081761.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_003264721.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_005919211.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
gb|ETE66923.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    236   1e-68    
ref|XP_010727180.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    221   1e-68    
sp|Q80UM3.1|NAA15_MOUSE  RecName: Full=N-alpha-acetyltransferase ...    236   1e-68    
ref|XP_007103889.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_005284399.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_007103888.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_005492227.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_007430434.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_009567336.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|XP_005458907.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   1e-68    
ref|XP_010749869.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   1e-68    
ref|NP_976066.1|  N(alpha)-acetyltransferase 15, NatA auxiliary s...    236   2e-68    
ref|XP_002191713.2|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   2e-68    
ref|XP_005458906.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   2e-68    
ref|XP_008852913.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    230   2e-68    
ref|XP_005458905.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   2e-68    
ref|XP_008315924.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   2e-68    
ref|XP_006930914.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   2e-68    
ref|XP_003985042.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   2e-68    
ref|XP_005458904.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   2e-68    
ref|XP_008302622.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   2e-68    
ref|XP_006629684.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   2e-68    
ref|XP_001632534.1|  predicted protein                                  235   2e-68    
ref|XP_011442207.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   2e-68    
ref|XP_005458903.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   2e-68    
ref|XP_003221704.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   3e-68    
ref|XP_307895.3|  AGAP002284-PA                                         235   3e-68    
ref|XP_005751906.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   3e-68    
ref|XP_005945000.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   3e-68    
ref|XP_005944999.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   3e-68    
ref|XP_004566664.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   3e-68    
ref|XP_005996676.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    235   3e-68    
ref|XP_005751907.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    235   4e-68    
ref|XP_002287119.1|  predicted protein                                  231   4e-68    
ref|XP_002112930.1|  hypothetical protein TRIADDRAFT_25871              234   4e-68    
ref|XP_003454358.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   4e-68    
ref|XP_009291037.1|  PREDICTED: N(alpha)-acetyltransferase 15, Na...    234   4e-68    
gb|EFX89563.1|  hypothetical protein DAPPUDRAFT_190829                  234   4e-68    
ref|XP_003454359.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   4e-68    
ref|XP_005525673.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    236   4e-68    
ref|XP_004065604.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   4e-68    
ref|XP_011499374.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   5e-68    
ref|XP_005366096.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    234   5e-68    
ref|XP_007253759.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   5e-68    
ref|XP_005704292.1|  peptide alpha-N-acetyltransferase                  234   5e-68    
ref|XP_010634573.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   5e-68    
ref|XP_011054404.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   6e-68    
ref|XP_002611320.1|  hypothetical protein BRAFLDRAFT_120339             234   6e-68    
ref|XP_011160699.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   7e-68    
ref|XP_008288099.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   7e-68    
ref|XP_394637.2|  PREDICTED: N-alpha-acetyltransferase 15, NatA a...    234   7e-68    
ref|XP_011261421.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   7e-68    
ref|XP_006613796.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   8e-68    
gb|EMT02816.1|  NMDA receptor-regulated 1-like protein                  234   8e-68    
ref|XP_003491306.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   8e-68    
ref|XP_003396013.1|  PREDICTED: n-alpha-acetyltransferase 15, Nat...    233   9e-68    
ref|XP_010634561.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    234   9e-68    
ref|XP_003693881.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   9e-68    
ref|XP_003703292.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   1e-67    
ref|XP_011142993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   1e-67    
ref|XP_010634568.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   1e-67    
ref|XP_003972011.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   1e-67    
emb|CDQ77423.1|  unnamed protein product                                233   1e-67    
ref|XP_011297851.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   1e-67    
ref|NP_001133628.1|  NMDA receptor-regulated protein 1                  233   1e-67    
gb|EZA46879.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    233   1e-67    
emb|CDQ78745.1|  unnamed protein product                                233   1e-67    
ref|XP_010900584.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    233   2e-67    
ref|XP_011350705.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   2e-67    
ref|XP_001657405.1|  AAEL006087-PA                                      233   2e-67    
ref|XP_002168214.2|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    220   2e-67    
gb|ACN10545.1|  NMDA receptor-regulated protein 1                       233   2e-67    
ref|XP_008418207.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    233   2e-67    
ref|XP_001073064.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    233   2e-67    
ref|XP_002181258.1|  predicted protein                                  231   3e-67    
ref|XP_005652238.1|  N-terminal acetyltransferase A, auxiliary su...    232   4e-67    
ref|XP_009020584.1|  hypothetical protein HELRODRAFT_112750             232   4e-67    
ref|XP_008852912.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    231   6e-67    
ref|XP_008545894.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    229   8e-67    
ref|XP_005027188.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    217   8e-67    
ref|XP_010078080.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    218   8e-67    
ref|XP_005809050.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    231   8e-67    
ref|XP_005809049.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    231   9e-67    
ref|XP_001949207.2|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    231   1e-66    
ref|XP_007576184.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    231   1e-66    
ref|XP_010794132.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    230   2e-66    
ref|XP_008192284.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    230   2e-66    
ref|XP_005789742.1|  hypothetical protein EMIHUDRAFT_454943             228   2e-66    
ref|XP_975602.1|  PREDICTED: N-alpha-acetyltransferase 16, NatA a...    230   2e-66    
ref|XP_010118297.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    218   2e-66    
ref|XP_010293448.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    220   2e-66    
ref|XP_002424197.1|  NMDA receptor-regulated protein, putative          229   5e-66    
ref|NP_080108.1|  N-alpha-acetyltransferase 16, NatA auxiliary su...    229   5e-66    
gb|KFB46843.1|  AGAP002284-PA-like protein                              229   7e-66    
ref|XP_003977076.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    228   7e-66    
ref|XP_007895872.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    228   7e-66    
ref|XP_002131267.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    228   1e-65    
ref|XP_004922640.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    228   1e-65    
ref|XP_007640049.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    227   2e-65    
gb|EWM30147.1|  tetratricopeptide repeat-containing protein             227   2e-65    
ref|XP_006124451.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    217   3e-65    
ref|XP_011142992.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    226   4e-65    
emb|CBN77876.1|  acetyltransferase 1-like                               226   4e-65    
ref|XP_009895032.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    225   9e-65    
ref|XP_002057998.1|  GJ15841                                            225   9e-65    
ref|XP_010208791.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    217   1e-64    
ref|XP_004017576.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    225   1e-64    
gb|KGL91174.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    219   1e-64    
ref|XP_005891905.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    225   1e-64    
ref|XP_005139429.1|  PREDICTED: LOW QUALITY PROTEIN: N(alpha)-ace...    213   2e-64    
ref|XP_011405204.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    224   2e-64    
ref|XP_001995651.1|  GH17872                                            224   3e-64    



>ref|NP_001142479.1| uncharacterized protein LOC100274696 [Zea mays]
 gb|ACG24261.1| hypothetical protein [Zea mays]
Length=287

 Score =   343 bits (879),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN SKAV++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAVEVLEAYEGTL  175



>gb|KDO58184.1| hypothetical protein CISIN_1g0453552mg, partial [Citrus sinensis]
Length=302

 Score =   342 bits (878),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTL  175



>gb|KGN45336.1| hypothetical protein Csa_7G440577 [Cucumis sativus]
Length=372

 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLSMKGLTLNCMDRKA  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLKGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNPSKAVEILEAYEGTL  175



>ref|XP_009778994.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Nicotiana sylvestris]
Length=876

 Score =   352 bits (903),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_009778993.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Nicotiana sylvestris]
Length=902

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_010654709.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X3 [Vitis vinifera]
Length=801

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KA++ILEAYEGTL
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAIEILEAYEGTL  175



>ref|XP_002299630.2| acetyltransferase-related family protein [Populus trichocarpa]
 gb|EEE84435.2| acetyltransferase-related family protein [Populus trichocarpa]
Length=900

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSNGSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNGSKAVEILEAYEGTL  175



>ref|XP_009623793.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nicotiana tomentosiformis]
Length=899

 Score =   350 bits (898),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ +LKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTVLKKFPDHGETLAMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_009619830.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Nicotiana tomentosiformis]
Length=875

 Score =   349 bits (896),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKF DHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFSDHGETLAMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_009802987.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nicotiana sylvestris]
Length=899

 Score =   350 bits (897),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ +LKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTVLKKFPDHGETLAMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_011072284.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Sesamum indicum]
Length=899

 Score =   350 bits (897),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAQHLNSNGSKAVDILEAYEGTL  175



>ref|XP_011002722.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Populus euphratica]
Length=900

 Score =   349 bits (896),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSNGSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNGSKAVEILEAYEGTL  175



>ref|XP_004235695.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Solanum lycopersicum]
Length=897

 Score =   349 bits (896),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPNHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_009619829.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Nicotiana tomentosiformis]
Length=901

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKF DHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFSDHGETLAMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_010654708.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Vitis vinifera]
Length=899

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KA++ILEAYEGTL
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAIEILEAYEGTL  175



>gb|KJB70535.1| hypothetical protein B456_011G078200 [Gossypium raimondii]
Length=891

 Score =   348 bits (894),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAVEILEAYEGTL  175



>ref|XP_002284882.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X1 [Vitis vinifera]
 emb|CBI36188.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   348 bits (894),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KA++ILEAYEGTL
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAIEILEAYEGTL  175



>ref|XP_010249876.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nelumbo nucifera]
Length=888

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAIEILEAYEGTL  175



>ref|XP_006343105.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Solanum tuberosum]
Length=897

 Score =   347 bits (891),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKA + ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKATDTILKKFPNHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  175



>gb|KDP37181.1| hypothetical protein JCGZ_06237 [Jatropha curcas]
Length=901

 Score =   347 bits (889),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN +KAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNATKAVEILEAYEGTL  175



>ref|XP_006356169.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Solanum tuberosum]
Length=903

 Score =   346 bits (888),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNC+ RKS
Sbjct  1    MGASLPAKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCVDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTL  175



>ref|XP_010110300.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Morus notabilis]
 gb|EXC25820.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Morus notabilis]
Length=901

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNALKAVEILEAYEGTL  175



>ref|XP_002304180.1| acetyltransferase-related family protein [Populus trichocarpa]
 gb|EEE79159.1| acetyltransferase-related family protein [Populus trichocarpa]
Length=796

 Score =   343 bits (879),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR +LL+LKPNHRMNWIGFAVAHHLNS+GSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQKLLSLKPNHRMNWIGFAVAHHLNSDGSKAVEILEAYEGTL  175



>gb|EYU21564.1| hypothetical protein MIMGU_mgv1a001105mg [Erythranthe guttata]
Length=888

 Score =   345 bits (884),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKG+KAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGIKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLN NGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAQHLNYNGSKAVDILEAYEGTL  175



>ref|XP_006465444.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Citrus sinensis]
Length=900

 Score =   345 bits (884),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTL  175



>ref|XP_004506868.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Cicer arietinum]
Length=899

 Score =   345 bits (884),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHV+GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTL  175



>ref|XP_009358212.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Pyrus x bretschneideri]
Length=898

 Score =   345 bits (884),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTL  175



>ref|XP_006427096.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40336.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=842

 Score =   343 bits (881),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTL  175



>ref|XP_009358213.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Pyrus x bretschneideri]
Length=897

 Score =   345 bits (884),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTL  175



>ref|XP_009358220.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 15, 
NatA auxiliary subunit-like [Pyrus x bretschneideri]
Length=897

 Score =   345 bits (884),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTL  175



>ref|XP_006427095.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40335.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=851

 Score =   343 bits (881),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTL  175



>ref|XP_002517521.1| NMDA receptor-regulated protein, putative [Ricinus communis]
 gb|EEF44685.1| NMDA receptor-regulated protein, putative [Ricinus communis]
Length=901

 Score =   344 bits (883),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREY+EAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYKEAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQ+RDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN SKAVDILEAYEGTL
Sbjct  121  QAQIRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNASKAVDILEAYEGTL  175



>ref|XP_009339003.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Pyrus x bretschneideri]
Length=899

 Score =   344 bits (883),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTL  175



>ref|XP_008373494.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Malus domestica]
Length=898

 Score =   344 bits (882),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTL  175



>ref|XP_004241722.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Solanum lycopersicum]
Length=903

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNC+ RKS
Sbjct  1    MGASLPAKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCVDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKN+LKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNNLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTL  175



>gb|KEH28765.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=900

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+NIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTL  175



>ref|XP_006427097.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40337.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=900

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTL  175



>ref|XP_011000818.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Populus euphratica]
Length=900

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR +LL+LKPNHRMNWIGFAVAHHLNS+GSKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQKLLSLKPNHRMNWIGFAVAHHLNSDGSKAVEILEAYEGTL  175



>gb|KEH39579.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=854

 Score =   342 bits (876),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAV+HHLNSN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVSHHLNSNASKAIEILEAYEGTL  175



>gb|KHN01367.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNSFKAVEILEAYEGTL  175



>ref|XP_003531689.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Glycine max]
Length=901

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTL  175



>ref|XP_009416095.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Musa acuminata subsp. malaccensis]
Length=903

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPP+EANLFKVIVKSYETKQYKKGLK+A++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPREANLFKVIVKSYETKQYKKGLKSADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            Q QMRDLIGFVETR QLL LKPNHRMNWIGFAVAHHLNSN SKA+DILEAYEGTL
Sbjct  121  QVQMRDLIGFVETRQQLLALKPNHRMNWIGFAVAHHLNSNASKAIDILEAYEGTL  175



>ref|XP_003528376.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Glycine max]
Length=901

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNSFKAVEILEAYEGTL  175



>ref|XP_006583136.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Glycine max]
Length=951

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNSFKAVEILEAYEGTL  175



>ref|XP_003546283.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Glycine max]
Length=901

 Score =   342 bits (878),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTL  175



>ref|XP_008672544.1| PREDICTED: uncharacterized protein LOC100274696 isoform X1 [Zea 
mays]
 gb|ACN33851.1| unknown [Zea mays]
 tpg|DAA58577.1| TPA: putative tetratricopeptide repeat (TPR)-containing protein 
[Zea mays]
Length=908

 Score =   342 bits (878),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN SKAV++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAVEVLEAYEGTL  175



>ref|XP_008228606.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Prunus mume]
Length=897

 Score =   342 bits (877),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLN+N  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAQHLNANALKAVEILEAYEGTL  175



>ref|XP_008461048.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 16, 
NatA auxiliary subunit [Cucumis melo]
Length=887

 Score =   342 bits (876),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLSMKGLTLNCMDRKA  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLKGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNPSKAVEILEAYEGTL  175



>ref|XP_002458160.1| hypothetical protein SORBIDRAFT_03g027980 [Sorghum bicolor]
 gb|EES03280.1| hypothetical protein SORBIDRAFT_03g027980 [Sorghum bicolor]
Length=908

 Score =   342 bits (877),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAIEVLEAYEGTL  175



>ref|XP_004135824.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Cucumis sativus]
Length=896

 Score =   342 bits (876),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLSMKGLTLNCMDRKA  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLKGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNPSKAVEILEAYEGTL  175



>gb|KEH39578.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=908

 Score =   342 bits (877),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAV+HHLNSN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVSHHLNSNASKAIEILEAYEGTL  175



>ref|XP_008792977.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Phoenix dactylifera]
Length=901

 Score =   342 bits (876),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGL LNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLILNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKA++ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAIEILEAYEGTL  175



>ref|XP_007024039.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY26661.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
Length=898

 Score =   342 bits (876),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLL+RSDREYREAIKCYRNAL+ DPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDVKSHVCWHVYGLLHRSDREYREAIKCYRNALKRDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAVEILEAYEGTL  175



>gb|KHN44136.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=893

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTL  175



>ref|XP_006644372.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Oryza brachyantha]
Length=908

 Score =   341 bits (874),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNSSKAIEVLEAYEGTL  175



>ref|XP_007135709.1| hypothetical protein PHAVU_010G151600g [Phaseolus vulgaris]
 gb|ESW07703.1| hypothetical protein PHAVU_010G151600g [Phaseolus vulgaris]
Length=892

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTL  175



>gb|KHM98779.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWH YGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHAYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTL  175



>ref|XP_010912607.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Elaeis guineensis]
Length=901

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLK+A+AIL+KFP+HGETL+MKGL LNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKSADAILRKFPEHGETLSMKGLILNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAIEILEAYEGTL  175



>ref|XP_007217133.1| hypothetical protein PRUPE_ppa001163m2g, partial [Prunus persica]
 gb|EMJ18332.1| hypothetical protein PRUPE_ppa001163m2g, partial [Prunus persica]
Length=190

 Score =   318 bits (816),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 163/175 (93%), Gaps = 5/175 (3%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLK+      CWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKS-----CCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  115

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLN+N  KAV+ILEAYEGTL
Sbjct  116  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAQHLNANALKAVEILEAYEGTL  170



>ref|XP_003597797.1| NMDA receptor-regulated protein [Medicago truncatula]
Length=952

 Score =   342 bits (876),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAV+HHLNSN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVSHHLNSNASKAIEILEAYEGTL  175



>ref|XP_004969173.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Setaria italica]
Length=905

 Score =   340 bits (873),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLL+LKP+HRMNWIGFAVAHHLNSN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPSHRMNWIGFAVAHHLNSNSSKAIEVLEAYEGTL  175



>ref|XP_003543657.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Glycine max]
Length=900

 Score =   340 bits (872),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTL  175



>ref|XP_006389790.1| hypothetical protein EUTSA_v10018100mg [Eutrema salsugineum]
 gb|ESQ27076.1| hypothetical protein EUTSA_v10018100mg [Eutrema salsugineum]
Length=897

 Score =   340 bits (871),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTL  175



>gb|KHG11825.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Gossypium 
arboreum]
Length=897

 Score =   340 bits (871),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA+HL SN +KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVANHLCSNVAKAVEILEAYEGTL  175



>gb|KFK42434.1| hypothetical protein AALP_AA2G256000 [Arabis alpina]
Length=891

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  175



>gb|KJB56693.1| hypothetical protein B456_009G132500 [Gossypium raimondii]
Length=897

 Score =   339 bits (870),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA+HL SN +KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVANHLCSNVAKAVEILEAYEGTL  175



>ref|XP_009385624.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=889

 Score =   339 bits (869),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            Q QMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN  KAVDILEAYEGTL
Sbjct  121  QVQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNALKAVDILEAYEGTL  175



>gb|KJB56692.1| hypothetical protein B456_009G132500 [Gossypium raimondii]
Length=894

 Score =   339 bits (869),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA+HL SN +KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVANHLCSNVAKAVEILEAYEGTL  175



>ref|XP_009385623.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=902

 Score =   339 bits (870),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            Q QMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN  KAVDILEAYEGTL
Sbjct  121  QVQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNALKAVDILEAYEGTL  175



>ref|XP_010691269.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Beta vulgaris subsp. vulgaris]
Length=895

 Score =   339 bits (869),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK 
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKP  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR +LL+LKPNHRMNWIGFAV+HHLNSN  KA++ILEAYEGTL
Sbjct  121  QAQMRDLAGFVETRQRLLSLKPNHRMNWIGFAVSHHLNSNALKAIEILEAYEGTL  175



>ref|XP_002887831.1| EMB2753 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64090.1| EMB2753 [Arabidopsis lyrata subsp. lyrata]
Length=897

 Score =   339 bits (869),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  175



>ref|NP_178157.2| protein EMBRYO DEFECTIVE 2753 [Arabidopsis thaliana]
 gb|AAL36371.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 gb|AAM14358.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 dbj|BAC42757.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 gb|AEE36399.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=897

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  175



>ref|XP_008809145.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 15, 
NatA auxiliary subunit-like [Phoenix dactylifera]
Length=901

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA+A+LKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADAVLKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRD  GF+ETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA+DILEAYEGTL
Sbjct  121  QAQMRDHTGFIETRQQLLTLKPNHRMNWIGFAVSHHLSSNVSKAIDILEAYEGTL  175



>ref|XP_010254211.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Nelumbo nucifera]
Length=903

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGSSLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKA  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID DNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDADNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR +LLTLKPNHRMNWIGFAVAHHLNS+GSKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQKLLTLKPNHRMNWIGFAVAHHLNSSGSKAIEILEAYEGTL  175



>ref|XP_006844401.1| hypothetical protein AMTR_s00142p00102260 [Amborella trichopoda]
 gb|ERN06076.1| hypothetical protein AMTR_s00142p00102260 [Amborella trichopoda]
Length=901

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG SLP KEANLFK+IVKSYETKQYKKGLKAA++ILKKFPDHGETL+MKGLTLNCM RK 
Sbjct  1    MGTSLPSKEANLFKLIVKSYETKQYKKGLKAADSILKKFPDHGETLSMKGLTLNCMDRKP  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNASKAVEILEAYEGTL  175



>gb|EEC71092.1| hypothetical protein OsI_02873 [Oryza sativa Indica Group]
Length=909

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTL  175



>ref|NP_001043582.1| Os01g0617500 [Oryza sativa Japonica Group]
 dbj|BAD61289.1| acetyltransferase 1-like [Oryza sativa Japonica Group]
 dbj|BAF05496.1| Os01g0617500 [Oryza sativa Japonica Group]
Length=909

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTL  175



>ref|XP_010539517.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Tarenaya hassleriana]
Length=892

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRD+ GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKAV+ILEA+EGTL
Sbjct  121  QAQMRDVSGFVETRQQLLTLKPNHRMNWIGFAVAHHLHSNASKAVEILEAFEGTL  175



>ref|NP_001185448.1| protein EMBRYO DEFECTIVE 2753 [Arabidopsis thaliana]
 gb|AEE36400.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=911

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  175



>emb|CDY38667.1| BnaC02g23120D [Brassica napus]
Length=898

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTL  175



>ref|XP_010232026.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Brachypodium distachyon]
Length=914

 Score =   338 bits (866),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            M +SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MDSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTL  175



>ref|XP_003569365.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Brachypodium distachyon]
Length=907

 Score =   338 bits (866),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            M +SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MDSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTL  175



>ref|XP_004302931.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Fragaria vesca subsp. vesca]
Length=898

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNC+ RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCLDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR+GLK+DLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+ DPDNIEILRDLSLL
Sbjct  61   EAYELVRMGLKHDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKRDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTL  175



>gb|EEE54991.1| hypothetical protein OsJ_02617 [Oryza sativa Japonica Group]
Length=909

 Score =   337 bits (865),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+S+P KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSVPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTL  175



>ref|XP_006301121.1| hypothetical protein CARUB_v10021530mg [Capsella rubella]
 gb|EOA34019.1| hypothetical protein CARUB_v10021530mg [Capsella rubella]
Length=907

 Score =   337 bits (865),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  175



>emb|CDM83394.1| unnamed protein product [Triticum aestivum]
Length=907

 Score =   337 bits (865),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA+++LEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLSSNSSKAIEVLEAYEGTL  175



>emb|CDX67946.1| BnaA07g19860D [Brassica napus]
Length=894

 Score =   337 bits (863),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+N+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNASKAVEILEAFEGTL  175



>ref|XP_010062441.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Eucalyptus grandis]
 gb|KCW69583.1| hypothetical protein EUGRSUZ_F03005 [Eucalyptus grandis]
Length=900

 Score =   336 bits (862),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RK 
Sbjct  1    MGASLPQKEANLFKLIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKG  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKA+DILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNPSKAIDILEAYEGTL  175



>ref|XP_010474515.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Camelina sativa]
Length=177

 Score =   314 bits (804),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAV  610
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAV  165



>gb|KHN47800.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   336 bits (861),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVC  VYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCCIVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTL  175



>ref|XP_010417709.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=896

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNTNASKAVEILEAYEGTL  175



>emb|CDY39981.1| BnaC06g40590D [Brassica napus]
Length=971

 Score =   337 bits (864),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   YFPFSSTTPCSATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLA  256
            +F  +S+   S  MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+
Sbjct  62   FFFVASSLSKSKKMGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLS  121

Query  257  MKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  436
            MKGLTLNCM RK+EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRID
Sbjct  122  MKGLTLNCMDRKTEAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRID  181

Query  437  PDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDI  616
            PDN+EILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKAV+I
Sbjct  182  PDNLEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNASKAVEI  241

Query  617  LEAYEGTL  640
            LEA+EGTL
Sbjct  242  LEAFEGTL  249



>ref|XP_010429971.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=896

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  175



>ref|XP_010537937.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Tarenaya hassleriana]
Length=895

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPNHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPN RMNWIGFAVA HL+SN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNQRMNWIGFAVAQHLHSNASKAVEILEAYEGTL  175



>emb|CDY37595.1| BnaA02g19750D [Brassica napus]
Length=898

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGA LPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGAPLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTL  175



>ref|XP_009104460.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Brassica rapa]
Length=894

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+N+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTL  175



>ref|XP_009128424.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Brassica rapa]
Length=898

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGA LPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGAPLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTL  175



>ref|XP_010532133.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Tarenaya hassleriana]
Length=894

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRD+ GFVETR QLLTLKPNHRMNWIGFAVA HL+SN SKAV+ILEAYEGTL
Sbjct  121  QAQMRDVSGFVETRQQLLTLKPNHRMNWIGFAVAQHLHSNASKAVEILEAYEGTL  175



>emb|CDX79387.1| BnaC06g19160D [Brassica napus]
Length=908

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+N+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTL  175



>ref|XP_007150682.1| hypothetical protein PHAVU_005G172700g [Phaseolus vulgaris]
 gb|ESW22676.1| hypothetical protein PHAVU_005G172700g [Phaseolus vulgaris]
Length=893

 Score =   334 bits (857),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANL K+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLLKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            +AY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   DAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNS+ SKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSSASKAIEILEAYEGTL  175



>ref|XP_010925105.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Elaeis guineensis]
Length=901

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA+AIL+KFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPQKEANLFKVIVKSYETKQYKKGLKAADAILRKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GF+ETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFIETRQQLLTLKPNHRMNWIGFAVSHHLSSNVSKAIEILEAYEGTL  175



>ref|XP_010925104.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Elaeis guineensis]
Length=902

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA+AIL+KFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPQKEANLFKVIVKSYETKQYKKGLKAADAILRKFPEHGETLSMKGLTLNCMDRKS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GF+ETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA++ILEAYEGTL
Sbjct  121  QAQMRDLTGFIETRQQLLTLKPNHRMNWIGFAVSHHLSSNVSKAIEILEAYEGTL  175



>emb|CDO98079.1| unnamed protein product [Coffea canephora]
Length=909

 Score =   332 bits (850),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG SLP +E NLFK+IVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNC+ RK 
Sbjct  1    MGTSLPSREGNLFKLIVKSYETKQYKKGLKAADSILKKFPNHGETLSMKGLTLNCLDRKP  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR +LLTLKPNHRMNWIGFAVAHHLNSNGSKA +ILEAYEGTL
Sbjct  121  QAQMRDLDGFVETRQRLLTLKPNHRMNWIGFAVAHHLNSNGSKATEILEAYEGTL  175



>ref|XP_009106750.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Brassica rapa]
Length=897

 Score =   330 bits (845),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSD EYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDIEYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNASKAVEILEAFEGTL  175



>emb|CDX87308.1| BnaA07g35650D [Brassica napus]
Length=910

 Score =   326 bits (836),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLG+KND+KSHVCWHV GLLYRSD EYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDIEYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            QAQMRDL GFVETR QLLTLKPN RMNWIGFAV+ HLNSN SKAV+ILEA+EGTL
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNRRMNWIGFAVSQHLNSNASKAVEILEAFEGTL  175



>ref|XP_009106749.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Brassica rapa]
Length=922

 Score =   316 bits (810),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 166/200 (83%), Gaps = 25/200 (13%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIV-------------------------KSYETKQYKKGLKAAEAI  220
            MGASLP KEANLFK+IV                         KSYETKQYKKGLKAA+AI
Sbjct  1    MGASLPTKEANLFKLIVTLVTLIAASYISLLPLFVSQLLGKLKSYETKQYKKGLKAADAI  60

Query  221  LKKFPDHGETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYRE  400
            LKKFP HGETL+MKGLTLNCM RK+EAY+LVRLG+KND+KSHVCWHV GLLYRSD EYRE
Sbjct  61   LKKFPSHGETLSMKGLTLNCMDRKTEAYELVRLGVKNDIKSHVCWHVLGLLYRSDIEYRE  120

Query  401  AIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAH  580
            AIKCYRNALRIDPDN+EILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ 
Sbjct  121  AIKCYRNALRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQ  180

Query  581  HLNSNGSKAVDILEAYEGTL  640
            HLNSN SKAV+ILEA+EGTL
Sbjct  181  HLNSNASKAVEILEAFEGTL  200



>ref|XP_002961540.1| hypothetical protein SELMODRAFT_164833 [Selaginella moellendorffii]
 gb|EFJ36800.1| hypothetical protein SELMODRAFT_164833 [Selaginella moellendorffii]
Length=886

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG SLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETLAMKGLTLNCM RK+
Sbjct  1    MGTSLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLAMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN--IEILRDLS  469
            EAY+LVR GLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDP+N  I+ILRDLS
Sbjct  61   EAYELVRKGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPENKPIQILRDLS  120

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GFVETR QLLTLKPNHR NWI FA+A HLNS    AV+IL+AYEGTL
Sbjct  121  LLQVQMRDLDGFVETRRQLLTLKPNHRNNWICFAIAQHLNSRADIAVEILQAYEGTL  177



>ref|XP_002971274.1| hypothetical protein SELMODRAFT_94950 [Selaginella moellendorffii]
 gb|EFJ27872.1| hypothetical protein SELMODRAFT_94950 [Selaginella moellendorffii]
Length=887

 Score =   312 bits (800),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MG SLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETLAMKGLTLNCM RK+
Sbjct  1    MGTSLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLAMKGLTLNCMDRKT  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN--IEILRDLS  469
            EAY+LVR GLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDP+N  I+ILRDLS
Sbjct  61   EAYELVRKGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPENKPIQILRDLS  120

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GFVETR QLLTLKPNHR NWI FA+A HLNS    AV+IL+AYEGTL
Sbjct  121  LLQVQMRDLDGFVETRRQLLTLKPNHRNNWICFAIAQHLNSRADIAVEILQAYEGTL  177



>gb|AAF27136.1|AC018849_24 putative N-terminal acetyltransferase; 84330-89402 [Arabidopsis 
thaliana]
Length=683

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  KSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSH  346
            KSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+EAY+LVRLG+KND+KSH
Sbjct  3    KSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKTEAYELVRLGVKNDIKSH  62

Query  347  VCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQL  526
            VCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLLQAQMRDL GFVETR QL
Sbjct  63   VCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQL  122

Query  527  LTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  123  LTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  160



>ref|XP_001764313.1| predicted protein [Physcomitrella patens]
 gb|EDQ70867.1| predicted protein [Physcomitrella patens]
Length=920

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE  298
            G  LPPKEANLFK+IVKSYETKQYKKGLKA++ IL+KFP+HGETLAMKGLTLNCM RK E
Sbjct  3    GPVLPPKEANLFKLIVKSYETKQYKKGLKASDQILRKFPEHGETLAMKGLTLNCMDRKPE  62

Query  299  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  478
            AY+LVR GLKNDLKSHVCWHVYGLLYRSDR+YREAIKCYR ALRIDP+NI+ILRDLSLLQ
Sbjct  63   AYELVRKGLKNDLKSHVCWHVYGLLYRSDRDYREAIKCYRCALRIDPENIQILRDLSLLQ  122

Query  479  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            AQMR+L GFVETR QLLTLKP+HR NWIGFA+AHH+N   + AV+IL+AYEGTL
Sbjct  123  AQMRELPGFVETRRQLLTLKPSHRNNWIGFAIAHHVNQQPAMAVNILDAYEGTL  176



>ref|XP_001776114.1| predicted protein [Physcomitrella patens]
 gb|EDQ59025.1| predicted protein [Physcomitrella patens]
Length=905

 Score =   305 bits (782),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE  298
            G +LPPKE NLFK+IVKSYETKQYKKGLKA++ IL+KFP+HGETLAMKGL LNCM RK+E
Sbjct  3    GPALPPKENNLFKLIVKSYETKQYKKGLKASDQILRKFPEHGETLAMKGLILNCMDRKAE  62

Query  299  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  478
            A++LVR GLKNDLKSHVCWHVYGLLYRSDR+YREAIKCYR ALRIDP+NI+ILRDLSLLQ
Sbjct  63   AFELVRKGLKNDLKSHVCWHVYGLLYRSDRDYREAIKCYRCALRIDPENIQILRDLSLLQ  122

Query  479  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            AQMR+L+GFVETR QLLTLKP+HR NWIGFA+AHH+N   + AV+IL+AYEGTL
Sbjct  123  AQMRELVGFVETRRQLLTLKPSHRNNWIGFAIAHHINHEPAMAVNILDAYEGTL  176



>ref|XP_010474516.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=995

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  KSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSH  346
            KSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+EAY+LVRLG+KND+KSH
Sbjct  3    KSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKTEAYELVRLGVKNDIKSH  62

Query  347  VCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQL  526
            VCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLLQAQMRDL GFVETR QL
Sbjct  63   VCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQL  122

Query  527  LTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTL
Sbjct  123  LTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTL  160


 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 2/79 (3%)
 Frame = +2

Query  410  CYRNA--LRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHH  583
            C R    LRIDPDN+EILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ H
Sbjct  196  CLRRVVXLRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQH  255

Query  584  LNSNGSKAVDILEAYEGTL  640
            LN+N SKAV+ILEAYEGTL
Sbjct  256  LNANASKAVEILEAYEGTL  274



>ref|XP_001783197.1| predicted protein [Physcomitrella patens]
 gb|EDQ51965.1| predicted protein [Physcomitrella patens]
Length=902

 Score =   303 bits (775),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE  298
            G  LPPKEANLFK+IVKSYETKQYKKGLKA++ IL+KFP+HGETLAMKGLTLNCM RKSE
Sbjct  3    GQVLPPKEANLFKLIVKSYETKQYKKGLKASDQILRKFPEHGETLAMKGLTLNCMDRKSE  62

Query  299  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  478
            AY+LVR GLKND+KSHVCWHVYGLLYRSDR+YREAIKCYR ALRID  NI+ILRDLSLLQ
Sbjct  63   AYELVRKGLKNDVKSHVCWHVYGLLYRSDRDYREAIKCYRCALRIDSQNIQILRDLSLLQ  122

Query  479  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            AQMR+L GFVETR QLLTLKP+HR NWIGFA+AHH+N   + AV IL+AYEGTL
Sbjct  123  AQMRELPGFVETRRQLLTLKPSHRNNWIGFAIAHHVNHEPAMAVSILDAYEGTL  176



>gb|KHN20434.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=192

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 142/192 (74%), Gaps = 36/192 (19%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGA LPPKEANLFK+IVKSYETKQYKKGLKAA  ILKKFPDHGETL+MKGLTLNCM   S
Sbjct  1    MGAFLPPKEANLFKLIVKSYETKQYKKGLKAANTILKKFPDHGETLSMKGLTLNCMDHGS  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVR GLKNDLKSHVCW+VYGLLYRS+REYREAIKCYRNA +IDPDNIEI RDL LL
Sbjct  61   EAYELVRQGLKNDLKSHVCWYVYGLLYRSNREYREAIKCYRNAHKIDPDNIEISRDLLLL  120

Query  476  QA------------------------------------QMRDLIGFVETRLQLLTLKPNH  547
            QA                                    QM+DL GFVETR QLL LK NH
Sbjct  121  QARLTIKVEGKSLSSLLPFGIFHYIAKGHITGELEGCTQMQDLTGFVETRQQLLMLKSNH  180

Query  548  RMNWIGFAVAHH  583
            RMNWIGFAVAHH
Sbjct  181  RMNWIGFAVAHH  192



>gb|ETL77843.1| hypothetical protein L917_21235 [Phytophthora parasitica]
Length=698

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL  178



>gb|ETM31097.1| hypothetical protein L914_21244 [Phytophthora parasitica]
Length=785

 Score =   276 bits (706),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL  178



>gb|ETP28747.1| hypothetical protein F442_21980 [Phytophthora parasitica P10297]
Length=785

 Score =   276 bits (706),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL  178



>gb|ETP00579.1| hypothetical protein F441_22010 [Phytophthora parasitica CJ01A1]
Length=785

 Score =   276 bits (705),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL  178



>gb|ETI30789.1| hypothetical protein F443_22116 [Phytophthora parasitica P1569]
Length=785

 Score =   276 bits (705),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL  178



>gb|ETL24634.1| hypothetical protein L916_21376, partial [Phytophthora parasitica]
Length=683

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA++HHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAISHHLVGNYQMAIDIIEKYFSTL  178



>gb|ETK71183.1| hypothetical protein L915_21512 [Phytophthora parasitica]
Length=698

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA++HHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAISHHLVGNYQMAIDIIEKYFSTL  178



>ref|XP_008915357.1| hypothetical protein PPTG_18551 [Phytophthora parasitica INRA-310]
 gb|ETM99316.1| hypothetical protein PPTG_18551 [Phytophthora parasitica INRA-310]
 gb|ETO74485.1| hypothetical protein F444_09820 [Phytophthora parasitica P1976]
Length=785

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPVKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL  178



>ref|XP_008607810.1| hypothetical protein SDRG_03939 [Saprolegnia diclina VS20]
 gb|EQC38986.1| hypothetical protein SDRG_03939 [Saprolegnia diclina VS20]
Length=841

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            M   LP KE+ LF+ IVK YE KQYKKGLKAA+AILKKFP+HGETLAMKGLTLNCMG+K 
Sbjct  1    MSKQLPSKESTLFRSIVKYYEIKQYKKGLKAADAILKKFPEHGETLAMKGLTLNCMGKKE  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDN +ILRDL LL
Sbjct  61   EAYEFVRQGVKRDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNAQILRDLYLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            Q QMRDL G+ ETR   LTLKPN+R NWIG A+AHHL+     A+DIL+ Y  TL
Sbjct  121  QVQMRDLKGYCETRRMFLTLKPNNRNNWIGLAIAHHLHGTHQTAIDILDKYSATL  175



>gb|KDO25758.1| hypothetical protein SPRG_09056 [Saprolegnia parasitica CBS 223.65]
Length=841

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            M   LP KE+ LF+ IVK YE KQYKKGLKAA+AILKKFP+HGETLAMKGLTLNCMG+K 
Sbjct  1    MSKQLPSKESTLFRSIVKYYEIKQYKKGLKAADAILKKFPEHGETLAMKGLTLNCMGKKE  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDN +ILRDL LL
Sbjct  61   EAYEFVRQGVKRDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNAQILRDLYLL  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            Q QMRDL G+ ETR   LTLKPN+R NWIG A+AHHL+     A+DIL+ Y  TL
Sbjct  121  QVQMRDLKGYCETRRMFLTLKPNNRNNWIGLAIAHHLHGTHQTAIDILDKYSATL  175



>ref|XP_002899585.1| N-terminal acetyltransferase A complex subunit nat1-like protein 
[Phytophthora infestans T30-4]
 gb|EEY61945.1| N-terminal acetyltransferase A complex subunit nat1-like protein 
[Phytophthora infestans T30-4]
Length=785

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  289
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK PDHGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPDHGETLAMKGLTLNCMGR  61

Query  290  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  469
            K EAY+ V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYEFVKNGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  470  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI++ Y  TL
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIDKYFSTL  178



>ref|XP_009526689.1| hypothetical protein PHYSODRAFT_331569 [Phytophthora sojae]
 gb|EGZ17631.1| hypothetical protein PHYSODRAFT_331569 [Phytophthora sojae]
Length=785

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAYD  307
            LP KE+ LF+ IVK+YE KQYKKGLKAA+ ILKK+P+HGETLAMKGLTLNCMGRK EAY+
Sbjct  7    LPAKESALFRSIVKNYEIKQYKKGLKAADTILKKYPEHGETLAMKGLTLNCMGRKEEAYE  66

Query  308  LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQM  487
             V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL LLQ QM
Sbjct  67   FVKSGLRHDLRSHVCWHVFGLLYRSDRNYPEAIKCYRNAIRIDPENLQILRDLYLLQVQM  126

Query  488  RDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            RDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL
Sbjct  127  RDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL  177



>ref|XP_009834389.1| hypothetical protein H257_09749 [Aphanomyces astaci]
 gb|ETV76264.1| hypothetical protein H257_09749 [Aphanomyces astaci]
Length=837

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            M   LP KE  LF+ IVK YE KQYKKGLKAA+AILKKFPDHGETLAMKGLTLNCMG+K 
Sbjct  1    MANKLPSKENALFRSIVKCYEIKQYKKGLKAADAILKKFPDHGETLAMKGLTLNCMGKKE  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDNI+ILRDL L 
Sbjct  61   EAYEFVRQGVKQDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNIQILRDLYLQ  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            Q QMRDL G+ ETR Q L+LKP +R NWIG A+AH LN     A+DI++ Y  TL
Sbjct  121  QVQMRDLKGYAETRRQFLSLKPTNRNNWIGLAIAHQLNGTHETAIDIIDQYNETL  175



>ref|XP_008876110.1| hypothetical protein H310_11284 [Aphanomyces invadans]
 gb|ETV95409.1| hypothetical protein H310_11284 [Aphanomyces invadans]
Length=842

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            M   LP KE  LF+ IVK YE KQYKKGLKAA+AILKKFPDHGETLAMKGLTLNCMG+K 
Sbjct  1    MANKLPSKENALFRSIVKCYEIKQYKKGLKAADAILKKFPDHGETLAMKGLTLNCMGKKE  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDNI+ILRDL L 
Sbjct  61   EAYEFVRQGVKQDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNIQILRDLYLQ  120

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            Q QMRDL G+ ETR Q L LKP +R NWIG A+AH LN     A+DIL+ Y  TL
Sbjct  121  QVQMRDLKGYAETRRQFLALKPTNRNNWIGLAIAHQLNGTYDTAIDILDQYNDTL  175



>emb|CCI42224.1| unnamed protein product [Albugo candida]
Length=794

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCM-GRKSEAY  304
            LP KEA+LF+ IVK YE KQYKKGLK ++ ILKK+P+HGETLAMKGL L+CM GRK EAY
Sbjct  8    LPSKEASLFRSIVKHYELKQYKKGLKTSDLILKKYPEHGETLAMKGLLLSCMNGRKEEAY  67

Query  305  DLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQ  484
            +  RLGLKNDLKSHVCWHVYGLLYRSDR Y EAIKCYRNA+R+DP N++ILRDL LLQ Q
Sbjct  68   EFARLGLKNDLKSHVCWHVYGLLYRSDRNYHEAIKCYRNAIRLDPQNVQILRDLYLLQVQ  127

Query  485  MRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            MRDL GF ETR  +LTL PN+R NWIGFA+AHHL  N   A+DI++ Y GTL
Sbjct  128  MRDLRGFAETRRAILTLMPNNRNNWIGFAIAHHLLGNYQMAIDIIKKYVGTL  179



>gb|KJB13120.1| hypothetical protein B456_002G058200, partial [Gossypium raimondii]
Length=797

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  242  GETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRN  421
             ETL+MKGLTLNCM RK+EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRN
Sbjct  16   SETLSMKGLTLNCMDRKTEAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRN  75

Query  422  ALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGS  601
            ALRIDPDNIEILRDLSLLQAQMRDL GFVETR QLLTLKPN RMNWIGFAVAHHLNSNG+
Sbjct  76   ALRIDPDNIEILRDLSLLQAQMRDLAGFVETRQQLLTLKPNQRMNWIGFAVAHHLNSNGA  135

Query  602  KAVDILEAYEGTL  640
            KA +ILEAYEGTL
Sbjct  136  KAAEILEAYEGTL  148



>ref|XP_008342751.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Malus domestica]
Length=398

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  MKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  436
            MKGLTLNCM RKSEAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID
Sbjct  1    MKGLTLNCMDRKSEAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  60

Query  437  PDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDI  616
            PDNIEILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+I
Sbjct  61   PDNIEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEI  120

Query  617  LEAYEGTL  640
            LEAYEGTL
Sbjct  121  LEAYEGTL  128



>gb|KHG22454.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Gossypium 
arboreum]
Length=138

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAAEAILKKFPDHGETL+MKGLTLNCM RK 
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAAEAILKKFPDHGETLSMKGLTLNCMDRKI  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  476  QAQMRDLIGFV  508
            Q   R    F+
Sbjct  121  QFDARIYAKFM  131



>ref|XP_005847916.1| hypothetical protein CHLNCDRAFT_35269 [Chlorella variabilis]
 gb|EFN55814.1| hypothetical protein CHLNCDRAFT_35269 [Chlorella variabilis]
Length=736

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  125  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAY  304
            +LP KEA LF+ + K YETKQYKKG+K A+AILKKFP+HGETLAMKGL LNC+ RK EAY
Sbjct  12   TLPSKEAGLFRQLAKQYETKQYKKGVKNADAILKKFPEHGETLAMKGLLLNCLERKEEAY  71

Query  305  DLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQ  484
            +LV+ G+KNDL+SHVCWHVYGLLYRSDREY EAIKCY+NALR+D +N+ ++RDL+LLQ Q
Sbjct  72   ELVKRGVKNDLRSHVCWHVYGLLYRSDREYDEAIKCYKNALRMDKENLTVMRDLALLQIQ  131

Query  485  MRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            MRDL GF+ETR  LL LK N++ NWI FA+AHHLN +   A  +LE+Y  T+
Sbjct  132  MRDLPGFLETRQTLLELKSNNKHNWISFALAHHLNGHHEVAAKVLESYAATV  183



>ref|XP_004173929.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like, 
partial [Cucumis sativus]
Length=121

 Score =   238 bits (608),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  116  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  295
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLSMKGLTLNCMDRKA  60

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  476  Q  478
            Q
Sbjct  121  Q  121



>gb|EMS52083.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Triticum 
urartu]
Length=1034

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +2

Query  245  ETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNA  424
            ETL+MKGLTLNCM RKSEAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNA
Sbjct  16   ETLSMKGLTLNCMDRKSEAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNA  75

Query  425  LRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSK  604
            LRIDPDNIEILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHL+SN SK
Sbjct  76   LRIDPDNIEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLSSNSSK  135

Query  605  AVDILEAYEGTL  640
            A+++LEAYEGTL
Sbjct  136  AIEVLEAYEGTL  147



>ref|XP_005827391.1| hypothetical protein GUITHDRAFT_158303 [Guillardia theta CCMP2712]
 gb|EKX40411.1| hypothetical protein GUITHDRAFT_158303 [Guillardia theta CCMP2712]
Length=706

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 141/174 (81%), Gaps = 3/174 (2%)
 Frame = +2

Query  128  LPPKEANLFKVIV---KSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE  298
            LP KEA +FK IV   K YETKQYKKGLKAA++ILKK+P+HGETLAMKGLTLNCM RK E
Sbjct  9    LPQKEAAVFKTIVVRLKFYETKQYKKGLKAADSILKKYPEHGETLAMKGLTLNCMDRKQE  68

Query  299  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  478
            AYD VRL LK ++ SHVCWHVYGLLYRSDR+Y+EAIKCY+ ALR D DN +ILRDL LLQ
Sbjct  69   AYDFVRLALKKNMLSHVCWHVYGLLYRSDRDYKEAIKCYKQALRRDKDNGQILRDLCLLQ  128

Query  479  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
             Q R+L GF+ETR QLL + P +R NW+GFAV+HH   +   A+ +LE+YEGTL
Sbjct  129  IQTRELTGFIETRRQLLAINPKNRNNWVGFAVSHHAAGDLDMALKVLESYEGTL  182



>ref|XP_004376674.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Trichechus manatus latirostris]
Length=306

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+GRK
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGRK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_010574853.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Haliaeetus leucocephalus]
Length=304

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_011368048.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Pteropus vampyrus]
 ref|XP_011368049.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Pteropus vampyrus]
Length=311

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = +2

Query  122  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  295
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004405382.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Odobenus rosmarus divergens]
Length=313

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004274602.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Orcinus orca]
Length=311

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKLILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004433676.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 3 [Ceratotherium simum simum]
 ref|XP_004433677.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 4 [Ceratotherium simum simum]
Length=311

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_008996433.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Callithrix jacchus]
Length=324

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006076577.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Bubalus bubalis]
Length=311

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_010844474.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X11 [Bison bison bison]
 ref|XP_010844475.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X11 [Bison bison bison]
Length=311

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_004054472.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Gorilla gorilla gorilla]
 ref|XP_009438835.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Pan troglodytes]
Length=311

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_009190099.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Papio anubis]
Length=339

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|NP_060997.2| N-alpha-acetyltransferase 16, NatA auxiliary subunit isoform 
2 [Homo sapiens]
 gb|AAH32318.1| NMDA receptor regulated 1-like [Homo sapiens]
 gb|EAX08657.1| NMDA receptor regulated 1-like, isoform CRA_d [Homo sapiens]
 gb|ADQ32355.1| NMDA receptor regulated 1-like [synthetic construct]
 gb|AIC63563.1| NAA16, partial [synthetic construct]
Length=311

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_008166844.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Chrysemys picta bellii]
Length=320

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_010844470.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X9 [Bison bison bison]
Length=365

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_007186857.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Balaenoptera acutorostrata scammoni]
Length=311

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_007501585.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Monodelphis domestica]
Length=340

 Score =   239 bits (609),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_010254212.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Nelumbo nucifera]
Length=856

 Score =   250 bits (639),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  MKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  436
            MKGLTLNCM RK+EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID
Sbjct  1    MKGLTLNCMDRKAEAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  60

Query  437  PDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDI  616
             DNIEILRDLSLLQAQMRDL GFVETR +LLTLKPNHRMNWIGFAVAHHLNS+GSKA++I
Sbjct  61   ADNIEILRDLSLLQAQMRDLTGFVETRQKLLTLKPNHRMNWIGFAVAHHLNSSGSKAIEI  120

Query  617  LEAYEGTL  640
            LEAYEGTL
Sbjct  121  LEAYEGTL  128



>ref|XP_008166841.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Chrysemys picta bellii]
Length=365

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_007468672.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Lipotes vexillifer]
Length=396

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKLILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_009033788.1| hypothetical protein AURANDRAFT_36410 [Aureococcus anophagefferens]
 gb|EGB11418.1| hypothetical protein AURANDRAFT_36410 [Aureococcus anophagefferens]
Length=881

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +2

Query  125  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAY  304
            +LP KEA+LFK IVK YETKQYKKGLKA++A+L+KFP+HGETLAM+GL LNC+ RK EAY
Sbjct  8    NLPRKEADLFKSIVKFYETKQYKKGLKASDAVLRKFPNHGETLAMRGLVLNCLERKEEAY  67

Query  305  DLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQ  484
            D V+ GLK D++SHVCWHVYGLLYRSDR+Y +AIK Y+ AL+IDPDN++ILRDLSLLQ Q
Sbjct  68   DYVKKGLKADMRSHVCWHVYGLLYRSDRQYPQAIKSYKQALKIDPDNVQILRDLSLLQVQ  127

Query  485  MRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            +RD  GF+ETR +LL LKPN++M+W+ +A+++HL   G+ A+ +++AY  T+
Sbjct  128  LRDGRGFLETRRKLLQLKPNNKMHWVAYALSNHLAGLGATAIQVIDAYGETI  179



>ref|XP_010844471.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X10 [Bison bison bison]
 ref|XP_010844472.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X10 [Bison bison bison]
Length=345

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|NP_001096570.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Bos taurus]
 gb|AAI42457.1| NARG1L protein [Bos taurus]
 tpg|DAA23950.1| TPA: NMDA receptor regulated 1-like protein [Bos taurus]
Length=396

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_004054473.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Gorilla gorilla gorilla]
Length=429

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|NP_001104268.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit isoform 
3 [Homo sapiens]
 gb|AAH64592.1| NARG1L protein [Homo sapiens]
 gb|EAX08654.1| NMDA receptor regulated 1-like, isoform CRA_a [Homo sapiens]
Length=429

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_005585790.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Macaca fascicularis]
Length=382

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004577510.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Ochotona princeps]
Length=311

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK ++K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRVLKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
              AY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EAAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +W+G+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWVGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_010844469.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Bison bison bison]
Length=402

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_010574846.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Haliaeetus leucocephalus]
Length=477

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_004433675.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Ceratotherium simum simum]
Length=515

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006076576.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Bubalus bubalis]
Length=517

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_007958425.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Chlorocebus sabaeus]
Length=516

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_005585789.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Macaca fascicularis]
Length=516

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_010844468.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Bison bison bison]
Length=517

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>gb|EAX08658.1| NMDA receptor regulated 1-like, isoform CRA_e [Homo sapiens]
Length=516

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_007958423.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Chlorocebus sabaeus]
Length=530

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_005585788.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Macaca fascicularis]
Length=530

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_010372810.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Rhinopithecus roxellana]
Length=530

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>emb|CAE45801.1| hypothetical protein [Homo sapiens]
 gb|EAX08659.1| NMDA receptor regulated 1-like, isoform CRA_f [Homo sapiens]
Length=530

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_009438834.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Pan troglodytes]
Length=530

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_011368047.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Pteropus vampyrus]
Length=530

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = +2

Query  122  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  295
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_011368044.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Pteropus vampyrus]
 ref|XP_011368045.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Pteropus vampyrus]
Length=542

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = +2

Query  122  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  295
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>emb|CCA19584.1| Nterminal acetyltransferase A complex subunit nat1like protein 
putative [Albugo laibachii Nc14]
Length=816

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  173  YETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCM-GRKSEAYDLVRLGLKNDLKSHV  349
            Y  KQYKKGLK +++ILKK+P+HGETL+MKGL L+CM GRK EAYD  RLGLKNDLKSHV
Sbjct  46   YCVKQYKKGLKTSDSILKKYPEHGETLSMKGLLLSCMNGRKEEAYDFARLGLKNDLKSHV  105

Query  350  CWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLL  529
            CWHVYGLLYRSDR Y EAIKCYRNA+R+DP N++ILRDL LLQ QMRDL GF ETR  +L
Sbjct  106  CWHVYGLLYRSDRNYNEAIKCYRNAIRLDPQNVQILRDLYLLQVQMRDLRGFAETRRAIL  165

Query  530  TLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL  640
            TL PN+R NWIGFA+AHHL  N   A+DI+  Y GTL
Sbjct  166  TLMPNNRNNWIGFAIAHHLLGNYQMAIDIINKYVGTL  202



>ref|XP_011368046.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Pteropus vampyrus]
Length=539

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = +2

Query  122  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  295
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  296  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  475
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  476  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006003551.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Latimeria chalumnae]
Length=520

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRD  G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDFEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_006076575.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Bubalus bubalis]
Length=555

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_010844467.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Bison bison bison]
Length=555

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_007186856.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Balaenoptera acutorostrata scammoni]
Length=530

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_007501584.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Monodelphis domestica]
Length=553

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_010372809.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Rhinopithecus roxellana]
Length=653

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_009438833.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Pan troglodytes]
Length=653

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004462843.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 4 [Dasypus novemcinctus]
Length=562

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK ++K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRVLKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_005266579.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Homo sapiens]
Length=653

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006076574.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Bubalus bubalis]
Length=652

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_007501583.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Monodelphis domestica]
Length=653

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_002740751.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Saccoglossus kowalevskii]
Length=857

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE  LFK I+K YE KQYK  LK A+AIL   K+ DHGETLAMKGLT+NCMGRK EA
Sbjct  7    LPPKENTLFKRILKCYEQKQYKNSLKFAKAILTNPKYCDHGETLAMKGLTMNCMGRKEEA  66

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            YD VR GL+NDL+SHVCWHVYGLL RSDR+Y EAIKCYRNAL+ D DNI+ILRDLSLLQ 
Sbjct  67   YDYVRRGLRNDLQSHVCWHVYGLLQRSDRKYDEAIKCYRNALKWDKDNIQILRDLSLLQI  126

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R++WIG+A++HHL+     A+ +LE +  T
Sbjct  127  QMRDLEGYRETRFQLLQLRPAQRVSWIGYAMSHHLSKEYDMALRVLEEFRKT  178



>ref|XP_004462842.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 3 [Dasypus novemcinctus]
Length=662

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK ++K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRVLKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_007501582.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Monodelphis domestica]
Length=686

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_010590885.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Loxodonta africana]
Length=865

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+GRK
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGRK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004376673.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Trichechus manatus latirostris]
Length=865

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+GRK
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGRK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_005895886.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Bos mutus]
 ref|XP_006200156.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Vicugna pacos]
 ref|XP_006872288.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Chrysochloris asiatica]
 dbj|BAB14562.1| unnamed protein product [Homo sapiens]
 gb|EAX05120.1| NMDA receptor regulated 1, isoform CRA_b [Homo sapiens]
Length=526

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_007523818.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X3 [Erinaceus europaeus]
Length=526

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_004385540.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Trichechus manatus latirostris]
Length=526

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_004426542.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Ceratotherium simum simum]
Length=526

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_006076572.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Bubalus bubalis]
Length=791

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_006887091.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Elephantulus edwardii]
Length=526

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_004265192.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Orcinus orca]
Length=526

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_007939400.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Orycteropus afer afer]
Length=526

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>gb|EAX08655.1| NMDA receptor regulated 1-like, isoform CRA_b [Homo sapiens]
Length=730

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_007456941.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Lipotes vexillifer]
Length=526

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_010590884.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Loxodonta africana]
Length=874

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+GRK
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGRK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004405994.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Odobenus rosmarus divergens]
Length=526

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKT  177



>ref|XP_009438832.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Pan troglodytes]
Length=772

 Score =   241 bits (615),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_008471752.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Diaphorina citri]
Length=586

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE +LFK I+K YE KQYK GLK A+ IL   K+ +HGETLAMKGLTLNC+GRK EA
Sbjct  7    LPPKENSLFKRILKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEA  66

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ + DNI+I+RDLSLLQ 
Sbjct  67   YEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQI  126

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QL  L+P  R +WIGFA+A+HL  +   A +ILEA+  T
Sbjct  127  QMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKT  178



>ref|XP_010844466.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Bison bison bison]
Length=791

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_006076573.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Bubalus bubalis]
Length=777

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_004462841.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Dasypus novemcinctus]
Length=784

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK ++K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRVLKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006639086.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Lepisosteus oculatus]
Length=865

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
              SLPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVSLPPKESNLFKRILKCYEQKQYKNGLKFCKMILANPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             +AY+ VR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   DDAYEFVRKGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDTALRLLEEFRKT  177



>ref|XP_009438831.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Pan troglodytes]
Length=804

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006719929.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Homo sapiens]
Length=804

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_011288389.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Felis catus]
Length=832

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006741282.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Leptonychotes weddellii]
Length=832

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006076571.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Bubalus bubalis]
Length=823

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_009438830.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Pan troglodytes]
Length=832

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_010844462.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Bison bison bison]
Length=831

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_003790194.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Otolemur garnettii]
Length=864

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +2

Query  125  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  298
             LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    QLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEE  64

Query  299  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  478
            AY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ
Sbjct  65   AYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQ  124

Query  479  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
             QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  125  IQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_005301537.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Chrysemys picta bellii]
Length=833

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_004433674.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Ceratotherium simum simum]
Length=864

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_008768346.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Rattus norvegicus]
 ref|XP_008769148.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Rattus norvegicus]
Length=372

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  101  PCSATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTL  274
            PC       LP KE+ LFK ++K YE KQYK GLK  + IL   KF DHGETLAMKGLTL
Sbjct  2    PC-----VQLPAKESALFKRVLKCYEQKQYKNGLKFCKMILSNPKFADHGETLAMKGLTL  56

Query  275  NCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEI  454
            NC+G++ EAY+ VR GL++D++SHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++I
Sbjct  57   NCLGKREEAYEFVRKGLRSDVRSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQI  116

Query  455  LRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEG  634
            LRDLSLLQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  
Sbjct  117  LRDLSLLQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDTALKLLEEFRQ  176

Query  635  T  637
            T
Sbjct  177  T  177



>ref|XP_004680181.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Condylura cristata]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFTEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_010844463.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Bison bison bison]
Length=823

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>ref|XP_004405381.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Odobenus rosmarus divergens]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_006076570.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Bubalus bubalis]
Length=863

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT  177



>gb|EAX08660.1| NMDA receptor regulated 1-like, isoform CRA_g [Homo sapiens]
Length=856

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_002749049.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Callithrix jacchus]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_005585784.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Macaca fascicularis]
Length=856

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_011218870.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Ailuropoda melanoleuca]
Length=841

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|NP_078837.3| N-alpha-acetyltransferase 16, NatA auxiliary subunit isoform 
1 [Homo sapiens]
 sp|Q6N069.2|NAA16_HUMAN RecName: Full=N-alpha-acetyltransferase 16, NatA auxiliary subunit; 
AltName: Full=NMDA receptor-regulated 1-like protein; 
Short=NARG1-like protein [Homo sapiens]
 gb|EAX08656.1| NMDA receptor regulated 1-like, isoform CRA_c [Homo sapiens]
 gb|AAI01720.1| NMDA receptor regulated 1-like [Homo sapiens]
 gb|AAI01722.1| NMDA receptor regulated 1-like [Homo sapiens]
 dbj|BAF83937.1| unnamed protein product [Homo sapiens]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_001150675.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Pan troglodytes]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_002915916.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Ailuropoda melanoleuca]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004462840.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Dasypus novemcinctus]
Length=793

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK ++K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRVLKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_011288295.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Felis catus]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_010372807.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Rhinopithecus roxellana]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_004759344.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Mustela putorius furo]
Length=864

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_009905882.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Picoides pubescens]
 gb|KFV73586.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Picoides 
pubescens]
Length=865

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_001368680.3| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Monodelphis domestica]
Length=865

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_006003550.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Latimeria chalumnae]
Length=729

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRD  G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDFEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_002196302.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Taeniopygia guttata]
Length=865

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_004274601.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Orcinus orca]
Length=864

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  119  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  292
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKLILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  293  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  472
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  473  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_003913858.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Papio anubis]
Length=864

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|NP_001253545.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Macaca 
mulatta]
 ref|XP_005585783.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Macaca fascicularis]
 gb|EHH28978.1| NMDA receptor-regulated 1-like protein [Macaca mulatta]
 gb|EHH58560.1| NMDA receptor-regulated 1-like protein [Macaca fascicularis]
Length=864

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_003806946.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 16, 
NatA auxiliary subunit [Pan paniscus]
Length=864

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT  177



>ref|XP_009101228.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Serinus canaria]
Length=865

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_005230744.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Falco peregrinus]
Length=865

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



>ref|XP_009556072.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Cuculus canorus]
 gb|KFO73848.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Cuculus 
canorus]
Length=865

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  128  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  301
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  302  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  481
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  482  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  637
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750