BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049P14

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    337   6e-113   Nicotiana sylvestris
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    335   1e-112   Nicotiana tomentosiformis
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    333   9e-112   Solanum lycopersicum
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    333   2e-111   Solanum tuberosum [potatoes]
emb|CAA56601.1|  36kDa porin I                                          331   8e-111   Solanum tuberosum [potatoes]
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    327   2e-109   Nicotiana sylvestris
emb|CDP00288.1|  unnamed protein product                                325   3e-108   Coffea canephora [robusta coffee]
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    323   1e-107   Nicotiana tomentosiformis
emb|CDP00287.1|  unnamed protein product                                322   3e-107   Coffea canephora [robusta coffee]
emb|CBI32017.3|  unnamed protein product                                318   2e-106   Vitis vinifera
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    319   3e-106   Vitis vinifera
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    317   4e-105   Morus notabilis
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    316   7e-105   Eucalyptus grandis [rose gum]
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             312   3e-103   Citrus clementina [clementine]
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    311   9e-103   Nelumbo nucifera [Indian lotus]
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    311   9e-103   Citrus sinensis [apfelsine]
ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    310   2e-102   Morus notabilis
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    308   6e-102   Cucumis melo [Oriental melon]
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    307   2e-101   Populus euphratica
ref|XP_004147460.1|  PREDICTED: mitochondrial outer membrane prot...    306   3e-101   
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    306   4e-101   Populus euphratica
gb|KJB50696.1|  hypothetical protein B456_008G182700                    306   5e-101   Gossypium raimondii
gb|AAQ87021.1|  VDAC1.3                                                 306   6e-101   Lotus japonicus
ref|XP_002312708.1|  porin family protein                               305   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        303   5e-100   Theobroma cacao [chocolate]
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    303   5e-100   
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    303   1e-99    Nelumbo nucifera [Indian lotus]
ref|XP_006378154.1|  porin family protein                               303   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    302   2e-99    Sesamum indicum [beniseed]
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    302   2e-99    Nicotiana sylvestris
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    302   3e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            301   3e-99    Gossypium arboreum [tree cotton]
gb|AAA96275.1|  voltage-dependent anion channel protein                 301   4e-99    Spinacia oleracea
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             301   5e-99    Citrus clementina [clementine]
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    301   6e-99    Citrus sinensis [apfelsine]
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             302   7e-99    
gb|AAQ87020.1|  VDAC1.2                                                 301   7e-99    Lotus japonicus
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            300   9e-99    Gossypium arboreum [tree cotton]
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    300   9e-99    Nicotiana tomentosiformis
gb|AAB38498.1|  porin                                                   300   1e-98    Mesembryanthemum crystallinum
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                300   1e-98    Erythranthe guttata [common monkey flower]
gb|KJB30018.1|  hypothetical protein B456_005G139100                    300   1e-98    Gossypium raimondii
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    300   2e-98    Eucalyptus grandis [rose gum]
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    300   2e-98    Glycine max [soybeans]
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    300   2e-98    Glycine max [soybeans]
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    299   3e-98    Sesamum indicum [beniseed]
gb|KHN13242.1|  Outer plastidial membrane protein porin                 299   3e-98    Glycine soja [wild soybean]
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            299   3e-98    Gossypium arboreum [tree cotton]
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    299   3e-98    Malus domestica [apple tree]
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    299   4e-98    Glycine max [soybeans]
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    299   4e-98    Prunus mume [ume]
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             299   4e-98    Phaseolus vulgaris [French bean]
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    298   7e-98    Pyrus x bretschneideri [bai li]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    298   9e-98    Malus domestica [apple tree]
gb|ACU19720.1|  unknown                                                 296   1e-97    Glycine max [soybeans]
gb|KJB60742.1|  hypothetical protein B456_009G323300                    295   1e-97    Gossypium raimondii
gb|KJB33661.1|  hypothetical protein B456_006G024700                    297   2e-97    Gossypium raimondii
gb|AFK40985.1|  unknown                                                 297   2e-97    Lotus japonicus
ref|XP_007032450.1|  Voltage dependent anion channel 1                  297   2e-97    
gb|AID59897.1|  voltage-dependent anion channel protein                 297   2e-97    Prunus persica
gb|AAD38145.1|AF139498_1  porin                                         296   3e-97    Prunus armeniaca
gb|KJB60739.1|  hypothetical protein B456_009G323300                    296   3e-97    Gossypium raimondii
ref|NP_001241054.1|  uncharacterized protein LOC100805016               296   4e-97    Glycine max [soybeans]
gb|KDP21225.1|  hypothetical protein JCGZ_21696                         296   5e-97    Jatropha curcas
ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    296   5e-97    Solanum tuberosum [potatoes]
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             298   6e-97    
emb|CDP02196.1|  unnamed protein product                                296   6e-97    Coffea canephora [robusta coffee]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    295   7e-97    Solanum lycopersicum
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    295   1e-96    Prunus mume [ume]
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             295   1e-96    Phaseolus vulgaris [French bean]
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    295   1e-96    Tarenaya hassleriana [spider flower]
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    294   3e-96    Fragaria vesca subsp. vesca
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    294   3e-96    Phaseolus coccineus [scarlet runner bean]
gb|KHN11584.1|  Outer plastidial membrane protein porin                 293   6e-96    Glycine soja [wild soybean]
gb|ACU20122.1|  unknown                                                 293   7e-96    Glycine max [soybeans]
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    293   8e-96    Tarenaya hassleriana [spider flower]
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       295   1e-95    Cucumis sativus [cucumbers]
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    293   1e-95    Ricinus communis
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    292   2e-95    Glycine max [soybeans]
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    291   3e-95    Cucumis sativus [cucumbers]
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    291   3e-95    Cucumis melo [Oriental melon]
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            291   4e-95    Gossypium arboreum [tree cotton]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    291   5e-95    Glycine max [soybeans]
gb|AAQ87019.1|  VDAC1.1                                                 291   6e-95    Lotus japonicus
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    291   7e-95    Nicotiana sylvestris
dbj|BAF95070.1|  voltage-dependent anion channel                        290   8e-95    Nicotiana tabacum [American tobacco]
gb|KDO82798.1|  hypothetical protein CISIN_1g0238541mg                  286   8e-95    Citrus sinensis [apfelsine]
gb|EPS57816.1|  hypothetical protein M569_17001                         290   1e-94    Genlisea aurea
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                290   1e-94    Erythranthe guttata [common monkey flower]
ref|XP_006842115.1|  hypothetical protein AMTR_s00078p00100600          290   1e-94    Amborella trichopoda
ref|XP_007046222.1|  Mitochondrial outer membrane protein porin 1...    288   2e-94    
gb|ACU24178.1|  unknown                                                 289   2e-94    Glycine max [soybeans]
gb|AIL25718.1|  voltage-dependent anion channel                         289   3e-94    Nicotiana tabacum [American tobacco]
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    289   3e-94    Cicer arietinum [garbanzo]
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    288   5e-94    Sesamum indicum [beniseed]
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    288   8e-94    Vitis vinifera
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    288   9e-94    Sesamum indicum [beniseed]
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    288   9e-94    Sesamum indicum [beniseed]
gb|AFK39621.1|  unknown                                                 288   1e-93    Lotus japonicus
gb|KJB11402.1|  hypothetical protein B456_001G256800                    287   2e-93    Gossypium raimondii
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    287   2e-93    Nicotiana tomentosiformis
gb|EPS68383.1|  hypothetical protein M569_06388                         287   2e-93    Genlisea aurea
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    286   2e-93    Eucalyptus grandis [rose gum]
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    286   3e-93    Malus domestica [apple tree]
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             286   4e-93    Populus trichocarpa [western balsam poplar]
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    285   8e-93    Solanum tuberosum [potatoes]
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            285   9e-93    Solanum tuberosum [potatoes]
gb|AFK37646.1|  unknown                                                 281   1e-92    Lotus japonicus
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    285   1e-92    Solanum lycopersicum
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    285   1e-92    Populus euphratica
gb|KDP45473.1|  hypothetical protein JCGZ_09722                         283   6e-92    Jatropha curcas
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    282   1e-91    Pisum sativum [garden pea]
dbj|BAG09387.1|  peroxisomal voltage-dependent anion-selective ch...    278   2e-91    Glycine max [soybeans]
gb|KJB11404.1|  hypothetical protein B456_001G256800                    281   4e-91    Gossypium raimondii
gb|KJB30016.1|  hypothetical protein B456_005G139100                    277   6e-91    Gossypium raimondii
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    280   1e-90    Fragaria vesca subsp. vesca
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                279   2e-90    Erythranthe guttata [common monkey flower]
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                279   2e-90    Erythranthe guttata [common monkey flower]
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    279   3e-90    Cicer arietinum [garbanzo]
gb|KJB60740.1|  hypothetical protein B456_009G323300                    274   6e-90    Gossypium raimondii
gb|KJB11403.1|  hypothetical protein B456_001G256800                    277   9e-90    Gossypium raimondii
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    276   2e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    276   5e-89    Cicer arietinum [garbanzo]
emb|CAJ42303.1|  VDAC-like porin                                        273   2e-88    Plantago major [cart-track plant]
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    273   7e-88    Ricinus communis
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            271   3e-87    Gossypium arboreum [tree cotton]
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    271   3e-87    Medicago truncatula
gb|ACJ85279.1|  unknown                                                 271   4e-87    Medicago truncatula
gb|AFK34190.1|  unknown                                                 270   6e-87    Medicago truncatula
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    270   6e-87    Glycine soja [wild soybean]
emb|CAN67632.1|  hypothetical protein VITISV_019646                     266   8e-87    Vitis vinifera
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       269   1e-86    Brassica rapa
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    269   1e-86    Arabis alpina [alpine rockcress]
emb|CDX85566.1|  BnaA02g02470D                                          269   2e-86    
ref|NP_186777.1|  voltage dependent anion channel 1                     268   3e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65525.1|  putative porin                                          268   4e-86    Arabidopsis thaliana [mouse-ear cress]
emb|CDY63765.1|  BnaCnng42590D                                          268   4e-86    Brassica napus [oilseed rape]
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             269   5e-86    
pir||B55017  porin, plastid - garden pea                                267   1e-85 
gb|ABK24200.1|  unknown                                                 266   2e-85    Picea sitchensis
emb|CDY28690.1|  BnaCnng05760D                                          266   3e-85    Brassica napus [oilseed rape]
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    265   6e-85    Brassica rapa
emb|CDX91952.1|  BnaC03g32540D                                          265   1e-84    
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    265   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    265   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    264   2e-84    Brassica rapa
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             264   2e-84    
emb|CDY66736.1|  BnaCnng52100D                                          264   2e-84    Brassica napus [oilseed rape]
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            264   2e-84    Brassica napus [oilseed rape]
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    264   2e-84    Brassica rapa
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    263   3e-84    Camelina sativa [gold-of-pleasure]
emb|CDY68122.1|  BnaA05g37480D                                          263   3e-84    Brassica napus [oilseed rape]
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    263   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             265   5e-84    
gb|KJB30017.1|  hypothetical protein B456_005G139100                    261   1e-83    Gossypium raimondii
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    261   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    261   2e-83    Brassica rapa
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             260   5e-83    Eutrema salsugineum [saltwater cress]
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    259   1e-82    Elaeis guineensis
emb|CDX74294.1|  BnaA03g27530D                                          259   2e-82    
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    257   1e-81    Phoenix dactylifera
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    257   1e-81    Camelina sativa [gold-of-pleasure]
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             256   2e-81    Capsella rubella
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    256   2e-81    Elaeis guineensis
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    256   3e-81    Phoenix dactylifera
ref|XP_003621109.1|  Outer plastidial membrane protein porin            256   3e-81    Medicago truncatula
gb|AFK38338.1|  unknown                                                 255   4e-81    Medicago truncatula
emb|CDY59668.1|  BnaCnng35410D                                          255   4e-81    Brassica napus [oilseed rape]
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    255   7e-81    Arabis alpina [alpine rockcress]
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    256   1e-80    Gossypium arboreum [tree cotton]
gb|ACJ85253.1|  unknown                                                 254   1e-80    Medicago truncatula
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    254   2e-80    Phoenix dactylifera
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    253   3e-80    Arabidopsis lyrata subsp. lyrata
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    253   3e-80    Elaeis guineensis
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    252   9e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    251   2e-79    Oryza brachyantha
gb|EAZ08792.1|  hypothetical protein OsI_31052                          251   2e-79    Oryza sativa Indica Group [Indian rice]
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          251   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062983.1|  Os09g0361400                                       250   3e-79    
gb|AAS48868.1|  voltage-dependent anion-selective channel               250   5e-79    Brassica rapa subsp. pekinensis [bai cai]
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    249   8e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    249   1e-78    Brassica rapa
ref|NP_197013.1|  voltage dependent anion channel 3                     247   5e-78    Arabidopsis thaliana [mouse-ear cress]
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    246   7e-78    Gossypium arboreum [tree cotton]
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    246   1e-77    Musa acuminata subsp. malaccensis [pisang utan]
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    244   6e-77    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    244   8e-77    Setaria italica
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          244   1e-76    Sorghum bicolor [broomcorn]
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      244   2e-76    Brachypodium distachyon [annual false brome]
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    241   2e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          241   2e-75    Zea mays [maize]
gb|ACF85328.1|  unknown                                                 239   6e-75    Zea mays [maize]
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    238   2e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    238   3e-74    Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    238   3e-74    
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     236   6e-74    Eucalyptus grandis [rose gum]
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          236   1e-73    
gb|EMS51310.1|  Mitochondrial outer membrane porin                      244   3e-73    Triticum urartu
gb|EMS47295.1|  Outer plastidial membrane protein porin                 233   1e-72    Triticum urartu
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 233   1e-72    Triticum aestivum [Canadian hard winter wheat]
emb|CDM83072.1|  unnamed protein product                                233   3e-72    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001043433.1|  Os01g0588200                                       233   4e-72    
dbj|BAJ99489.1|  predicted protein                                      232   5e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT02908.1|  Mitochondrial outer membrane porin                      243   6e-72    
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    231   1e-71    Oryza brachyantha
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    231   1e-71    Setaria italica
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    230   3e-71    Brachypodium distachyon [annual false brome]
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             229   5e-71    
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          228   2e-70    Sorghum bicolor [broomcorn]
gb|AFW83107.1|  outer plastidial membrane protein porin                 227   6e-70    
gb|KDO82799.1|  hypothetical protein CISIN_1g0238541mg                  223   6e-70    Citrus sinensis [apfelsine]
gb|ACG45954.1|  outer plastidial membrane protein porin                 226   1e-69    Zea mays [maize]
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    226   2e-69    Zea mays [maize]
ref|NP_001278544.1|  outer plastidial membrane protein porin            225   3e-69    Zea mays [maize]
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    223   2e-68    Setaria italica
dbj|BAL41368.1|  porin                                                  219   3e-68    Arum maculatum [cuckoo-pint]
ref|NP_001141587.1|  outer plastidial membrane protein porin            222   4e-68    Zea mays [maize]
gb|ACG25664.1|  outer plastidial membrane protein porin                 221   1e-67    Zea mays [maize]
gb|ABK23226.1|  unknown                                                 218   1e-66    Picea sitchensis
ref|XP_001781995.1|  predicted protein                                  217   4e-66    
ref|NP_001056162.1|  Os05g0536200                                       217   5e-66    
ref|XP_001779057.1|  predicted protein                                  216   1e-65    
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...    213   2e-64    Oryza brachyantha
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    212   3e-64    Setaria italica
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          211   1e-63    Sorghum bicolor [broomcorn]
gb|KJB30164.1|  hypothetical protein B456_005G132100                    209   2e-62    Gossypium raimondii
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    206   5e-62    Brachypodium distachyon [annual false brome]
ref|XP_006845625.1|  hypothetical protein AMTR_s00019p00217910          202   2e-60    Amborella trichopoda
gb|ADE77918.1|  unknown                                                 202   2e-60    Picea sitchensis
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790          201   5e-60    Sorghum bicolor [broomcorn]
ref|NP_001104949.1|  voltage-dependent anion channel protein2           201   1e-59    Zea mays [maize]
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)                 197   1e-58    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             197   2e-58    Selaginella moellendorffii
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             197   2e-58    Selaginella moellendorffii
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    196   4e-58    
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    196   6e-58    Pyrus x bretschneideri [bai li]
ref|NP_001152335.1|  outer mitochondrial membrane protein porin         197   7e-58    Zea mays [maize]
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...    197   8e-58    Brachypodium distachyon [annual false brome]
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    196   8e-58    Phoenix dactylifera
dbj|BAJ99317.1|  predicted protein                                      196   1e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    195   2e-57    
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    194   2e-57    Malus domestica [apple tree]
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             194   2e-57    Selaginella moellendorffii
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    194   3e-57    Brassica rapa
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             194   3e-57    Prunus persica
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...    195   4e-57    Oryza sativa Japonica Group [Japonica rice]
emb|CDY08723.1|  BnaA06g25010D                                          194   5e-57    Brassica napus [oilseed rape]
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    192   1e-56    Prunus mume [ume]
ref|XP_006841082.1|  hypothetical protein AMTR_s00086p00035910          192   2e-56    Amborella trichopoda
emb|CDY36497.1|  BnaC03g48560D                                          191   4e-56    Brassica napus [oilseed rape]
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...    192   7e-56    Oryza brachyantha
gb|KJB50697.1|  hypothetical protein B456_008G182700                    188   9e-56    Gossypium raimondii
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    189   2e-55    Vitis vinifera
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    189   2e-55    Vitis vinifera
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    189   4e-55    Oryza brachyantha
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    189   4e-55    Tarenaya hassleriana [spider flower]
emb|CAA63968.1|  pom30                                                  189   4e-55    Solanum tuberosum [potatoes]
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    190   5e-55    
ref|NP_001048902.1|  Os03g0137500                                       188   7e-55    
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    188   9e-55    Phoenix dactylifera
gb|EEC74475.1|  hypothetical protein OsI_09925                          187   1e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_006381815.1|  VDAC3.1 family protein                             186   3e-54    Populus trichocarpa [western balsam poplar]
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    186   4e-54    Phoenix dactylifera
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     187   5e-54    Eucalyptus grandis [rose gum]
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    186   5e-54    Eucalyptus grandis [rose gum]
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     187   6e-54    Eucalyptus grandis [rose gum]
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    185   9e-54    Cucumis melo [Oriental melon]
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    185   1e-53    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    185   1e-53    Nicotiana sylvestris
ref|NP_001149108.1|  outer mitochondrial membrane protein porin         185   1e-53    Zea mays [maize]
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    184   1e-53    Brassica rapa
gb|AAW22622.1|  porin-like protein                                      184   2e-53    Brassica napus [oilseed rape]
gb|KJB48714.1|  hypothetical protein B456_008G082900                    184   2e-53    Gossypium raimondii
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    184   2e-53    Nicotiana tomentosiformis
emb|CDY18662.1|  BnaA09g07330D                                          184   2e-53    Brassica napus [oilseed rape]
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    184   2e-53    Populus euphratica
ref|XP_010551867.1|  PREDICTED: mitochondrial outer membrane prot...    181   3e-53    Tarenaya hassleriana [spider flower]
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    184   3e-53    Fragaria vesca subsp. vesca
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    183   5e-53    Cucumis sativus [cucumbers]
ref|XP_007047520.1|  Voltage dependent anion channel 2                  183   6e-53    
emb|CDP02599.1|  unnamed protein product                                183   6e-53    
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             184   6e-53    
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    183   7e-53    
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             183   7e-53    
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    182   8e-53    
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...    182   8e-53    
emb|CDX81312.1|  BnaC09g07230D                                          182   1e-52    
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    182   2e-52    
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             182   2e-52    
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    182   2e-52    
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             182   2e-52    
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    182   2e-52    
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    182   2e-52    
gb|KJB31318.1|  hypothetical protein B456_005G186100                    181   3e-52    
ref|NP_201551.1|  voltage dependent anion channel 2                     181   3e-52    
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    181   3e-52    
gb|KJB11405.1|  hypothetical protein B456_001G256800                    179   3e-52    
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    181   3e-52    
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    181   3e-52    
emb|CDP02971.1|  unnamed protein product                                182   5e-52    
gb|EEC71387.1|  hypothetical protein OsI_03508                          181   6e-52    
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      180   7e-52    
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    180   7e-52    
emb|CDY11866.1|  BnaC03g12920D                                          180   8e-52    
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             180   8e-52    
emb|CDX88625.1|  BnaA03g10240D                                          180   8e-52    
gb|EMT32910.1|  Mitochondrial outer membrane protein porin              180   9e-52    
gb|KDP32072.1|  hypothetical protein JCGZ_12533                         180   9e-52    
gb|ABB16970.1|  POM30-like protein                                      180   1e-51    
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...    179   1e-51    
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       179   1e-51    
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             179   2e-51    
ref|NP_001242630.1|  uncharacterized protein LOC100797369               179   2e-51    
ref|NP_001239899.1|  uncharacterized protein LOC100790578               179   2e-51    
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g             179   2e-51    
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             179   2e-51    
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    179   2e-51    
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    179   2e-51    
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    179   3e-51    
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    179   3e-51    
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             180   3e-51    
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    179   3e-51    
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    179   3e-51    
gb|KJB58633.1|  hypothetical protein B456_009G219700                    178   6e-51    
ref|XP_007018499.1|  Voltage dependent anion channel 2                  178   6e-51    
ref|NP_200557.1|  voltage dependent anion channel 4                     177   8e-51    
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    177   9e-51    
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    177   1e-50    
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...    177   1e-50    
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...    177   1e-50    
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    177   1e-50    
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...    177   1e-50    
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    177   2e-50    
ref|NP_001049301.1|  Os03g0202200                                       177   2e-50    
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...    176   2e-50    
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    176   2e-50    
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    176   2e-50    
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...    176   3e-50    
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...    176   4e-50    
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            176   4e-50    
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    176   4e-50    
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg             176   4e-50    
ref|NP_001242891.1|  uncharacterized protein LOC100790270               176   4e-50    
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...    176   4e-50    
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    176   5e-50    
gb|EMT20213.1|  Mitochondrial outer membrane porin                      185   5e-50    
ref|NP_001241153.1|  uncharacterized protein LOC100818855               175   5e-50    
ref|NP_001044063.2|  Os01g0715500                                       176   6e-50    
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...    175   6e-50    
gb|AAQ87023.1|  VDAC3.1                                                 175   6e-50    
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...    175   6e-50    
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...    175   6e-50    
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...    175   7e-50    
tpg|DAA43264.1|  TPA: outer membrane protein porin                      175   8e-50    
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...    175   9e-50    
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             175   9e-50    
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    175   9e-50    
ref|XP_002325061.1|  VDAC3.1 family protein                             174   1e-49    
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...    174   1e-49    
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      174   2e-49    
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    174   2e-49    
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    174   3e-49    
gb|KJB43907.1|  hypothetical protein B456_007G223000                    173   3e-49    
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    173   4e-49    
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...    173   4e-49    
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         173   4e-49    
gb|KJB23473.1|  hypothetical protein B456_004G100400                    173   4e-49    
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    172   6e-49    
gb|KDP41624.1|  hypothetical protein JCGZ_16031                         172   6e-49    
ref|NP_001147762.1|  outer mitochondrial membrane protein porin         172   6e-49    
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein      172   7e-49    
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...    172   8e-49    
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...    172   1e-48    
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg                172   1e-48    
ref|XP_007014286.1|  Voltage dependent anion channel 4                  174   1e-48    
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg             171   2e-48    
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...    171   2e-48    
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...    171   3e-48    
gb|KJB34748.1|  hypothetical protein B456_006G081500                    169   3e-48    
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          170   5e-48    
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin         170   5e-48    
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             170   6e-48    
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         170   6e-48    
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...    170   6e-48    
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    170   7e-48    
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    170   7e-48    
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...    170   7e-48    
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...    169   1e-47    
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...    169   1e-47    
emb|CAN64922.1|  hypothetical protein VITISV_017201                     169   2e-47    
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    169   2e-47    
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg             169   2e-47    
ref|NP_001149101.1|  outer mitochondrial membrane protein porin         169   2e-47    
gb|ACG30926.1|  outer mitochondrial membrane protein porin              169   2e-47    
tpg|DAA43927.1|  TPA: outer membrane protein porin                      168   4e-47    
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    167   6e-47    
emb|CDY02103.1|  BnaA03g40640D                                          167   1e-46    
gb|AAP46186.1|  PgPOR29                                                 167   1e-46    
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...    166   1e-46    
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       166   2e-46    
ref|NP_001190641.1|  voltage dependent anion channel 2                  167   2e-46    
gb|ACJ85119.1|  unknown                                                 166   2e-46    
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    166   3e-46    
gb|EMS62963.1|  Mitochondrial outer membrane protein porin              175   3e-46    
ref|XP_006380609.1|  VDAC2.1 family protein                             166   3e-46    
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...    165   7e-46    
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    165   8e-46    
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800          164   9e-46    
gb|AFK33448.1|  unknown                                                 164   1e-45    
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...    164   1e-45    
gb|AAQ87022.1|  VDAC2.1                                                 164   1e-45    
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...    164   1e-45    
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...    166   3e-45    
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             163   4e-45    
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6            162   6e-45    
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...    162   7e-45    
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...    161   1e-44    
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    162   1e-44    
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...    161   1e-44    
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...    161   1e-44    
gb|KJB23474.1|  hypothetical protein B456_004G100400                    157   2e-44    
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg             160   2e-44    
gb|KJB23472.1|  hypothetical protein B456_004G100400                    158   3e-44    
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...    160   3e-44    
gb|ACU23163.1|  unknown                                                 160   4e-44    
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg                159   1e-43    
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g             158   2e-43    
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    158   2e-43    
gb|EPS70241.1|  hypothetical protein M569_04517                         158   3e-43    
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...    157   3e-43    
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356              157   5e-43    
gb|AFK40966.1|  unknown                                                 153   8e-43    
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g             155   3e-42    
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356              154   5e-42    
gb|AAL04449.1|  voltage-dependent anion channel                         149   7e-42    
dbj|BAJ91367.1|  predicted protein                                      154   1e-41    
tpg|DAA43265.1|  TPA: hypothetical protein ZEAMMB73_938356              153   2e-41    
ref|XP_010691575.1|  PREDICTED: mitochondrial outer membrane prot...    152   3e-41    
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa    152   5e-41    
emb|CDP01200.1|  unnamed protein product                                152   7e-41    
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    149   5e-40    
gb|EPS73591.1|  pom30 protein                                           149   6e-40    
ref|XP_006607011.1|  PREDICTED: mitochondrial outer membrane prot...    149   1e-39    
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...    148   2e-39    
ref|XP_006607010.1|  PREDICTED: mitochondrial outer membrane prot...    149   2e-39    
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...    147   2e-39    
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...    147   2e-39    
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4       149   2e-39    
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2            149   2e-39    
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin         147   2e-39    
dbj|BAD87377.1|  putative 36kDA porin II                                150   3e-39    
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    149   4e-39    
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...    144   6e-38    
gb|ABE77194.1|  putative voltage-dependent ion channel                  144   1e-37    
ref|XP_010551869.1|  PREDICTED: mitochondrial outer membrane prot...    138   1e-37    
emb|CBI33688.3|  unnamed protein product                                139   2e-37    
emb|CDY70638.1|  BnaCnng69120D                                          141   3e-37    
dbj|BAG92834.1|  unnamed protein product                                137   3e-37    
gb|EEE58291.1|  hypothetical protein OsJ_09329                          149   3e-37    
ref|XP_010551868.1|  PREDICTED: mitochondrial outer membrane prot...    138   4e-37    
gb|AFW82970.1|  outer membrane protein porin                            140   5e-37    
ref|XP_006291699.1|  hypothetical protein CARUB_v10017863mg             139   2e-36    
gb|AFW82971.1|  hypothetical protein ZEAMMB73_507543                    138   4e-36    
gb|AAC64164.1|  voltage-dependent anion-selective channel protein       132   2e-35    
ref|XP_004172904.1|  PREDICTED: mitochondrial outer membrane prot...    136   2e-35    
ref|XP_008665842.1|  PREDICTED: mitochondrial outer membrane prot...    132   1e-34    
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa            132   5e-34    
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...    132   7e-34    
ref|XP_004983259.1|  PREDICTED: mitochondrial outer membrane prot...    133   1e-33    
gb|KJB29688.1|  hypothetical protein B456_005G114000                    127   4e-32    
ref|XP_011030342.1|  PREDICTED: mitochondrial outer membrane prot...    129   5e-32    
gb|ABF94514.1|  Eukaryotic porin family protein, expressed              127   6e-32    
ref|XP_006826371.1|  hypothetical protein AMTR_s00004p00132290          122   2e-31    
gb|ABB02635.1|  unknown                                                 124   3e-31    
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g             125   3e-31    
ref|XP_007201143.1|  hypothetical protein PRUPE_ppa016048mg             126   4e-31    
ref|XP_002298773.1|  hypothetical protein POPTR_0001s30130g             125   1e-30    
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa    122   4e-30    
ref|XP_003634314.2|  PREDICTED: mitochondrial outer membrane prot...    119   2e-28    
ref|XP_006367075.1|  PREDICTED: mitochondrial outer membrane prot...    118   2e-28    
emb|CDY23028.1|  BnaC07g31590D                                          117   3e-28    
ref|XP_008236314.1|  PREDICTED: mitochondrial outer membrane prot...    118   4e-28    
gb|ADE76112.1|  unknown                                                 113   2e-27    
ref|XP_002511521.1|  voltage-dependent anion-selective channel, p...    115   3e-27    
gb|KDP31208.1|  hypothetical protein JCGZ_11584                         114   8e-27    
ref|XP_006439652.1|  hypothetical protein CICLE_v10021785mg             112   3e-26    
ref|XP_003634315.2|  PREDICTED: mitochondrial outer membrane prot...    110   1e-25    
emb|CDY25906.1|  BnaC09g32780D                                          112   2e-25    
ref|XP_009614188.1|  PREDICTED: mitochondrial outer membrane prot...    110   2e-25    
ref|XP_006476654.1|  PREDICTED: mitochondrial outer membrane prot...    110   2e-25    
gb|AFK40114.1|  unknown                                                 110   3e-25    
ref|XP_010029017.1|  PREDICTED: mitochondrial outer membrane prot...    109   4e-25    
ref|XP_009801980.1|  PREDICTED: mitochondrial outer membrane prot...    108   6e-25    
ref|XP_004236191.1|  PREDICTED: mitochondrial outer membrane prot...    108   8e-25    
ref|XP_004508774.1|  PREDICTED: mitochondrial outer membrane prot...    108   9e-25    
ref|XP_004164031.1|  PREDICTED: mitochondrial outer membrane prot...    108   9e-25    
ref|XP_003550309.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    109   9e-25    
ref|XP_010426523.1|  PREDICTED: mitochondrial outer membrane prot...    107   3e-24    
gb|KHN36963.1|  Mitochondrial outer membrane protein porin 5            106   7e-24    
gb|KJB79456.1|  hypothetical protein B456_013G050600                    105   2e-23    



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   337 bits (863),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DYV+DHKFT+TTYS+TGVAITSSG+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS +YTTITVDEPAPGLKTI+SFV PDQ+SGKVELQYLHEYAGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQRSGKVELQYLHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASPLV+FSGVAGNNT+ALGTD+SFDTA+G FTK NAGLSFSTSDLIASL LND GD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTASGNFTKCNAGLSFSTSDLIASLALNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYHTV+
Sbjct  181  TLSASYYHTVK  191



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DYV+DHKFT+TTYS+TGVAITSSG+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS +YTTITVDEPAPGLKTI+SFV PDQKSGKVELQYLHEYAGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQKSGKVELQYLHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASPLV+FSGVAGNNT+ALGTD+SF+TA+G FTK NAGLSFSTSDLIASL LND GD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFNTASGNFTKCNAGLSFSTSDLIASLALNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYHTV+
Sbjct  181  TLSASYYHTVK  191



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   333 bits (855),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DYV+DHKFTITT+S TGVAITSSG+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTITTFSTTGVAITSSGLKKGELFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS LYTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASPLV+FSGVAGNN +ALGTDVSFDTATG FTK NAGLSFS+SDLIASL LND GD
Sbjct  121  IGLTASPLVNFSGVAGNNIVALGTDVSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYHTV+
Sbjct  181  TVSASYYHTVK  191



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DYV+DHKFT+TTYS TGVAIT+SG+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASPLV+FSGVAGNNT+ALGTD+SFDTATG FTK NAGLSFS+SDLIASL LND GD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYHTV+
Sbjct  181  TVSASYYHTVK  191



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   331 bits (849),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DYV+DHKFT+TTYS TGVAIT+SG+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVD NS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGI+TS
Sbjct  61   KNKNITTDVKVDANSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASPLV+FSGVAGNNT+ALGTD+SFDTATG FTK NAGLSFS+SDLIASL LND GD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYHTV+
Sbjct  181  TVSASYYHTVK  191



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DYV+DHKFT+TTY++ GVAITSSGVKKGE L+ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN TTD+KVDTNS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGL ASPLV+FSGVAGNN +ALGTD+SFDT++G FTK NAGL+F+TSDLIASL LND GD
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLLY DY  DHKFT+TTY+A GVAITSSG+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFTVTTYTANGVAITSSGIKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNSK++TTITVDEPAPGLKTIISFV PDQ+SGKVELQYLHEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSKVFTTITVDEPAPGLKTIISFVVPDQRSGKVELQYLHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGVAGN+ LALG D+SFDTATG FTKYNAG SF+ SDLIA+LTLND GD
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGADLSFDTATGNFTKYNAGFSFTNSDLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH+V
Sbjct  181  TLTASYYHSV  190



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   323 bits (827),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MV GPGLYSDIGKKA+DLLY DYV+DHKFT+TTY++ GVAITSSGVKKGE L+ADVNTQL
Sbjct  1    MVMGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN TTD+KVDTNS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGL ASPLV+FSGVAGNN +ALGTD+SFDT++G FTK NAGL+F+TSDLIASL LND  D
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKAD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLTASYYHTV  190



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   322 bits (826),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLLY DY  DHKF++TTYS  GVAIT+SG+KKGEL + DVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFSVTTYSPNGVAITASGLKKGELFLGDVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD KVDTNSK++TTITVDEPAPGLKTI SFV PDQ+SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNITTDFKVDTNSKVFTTITVDEPAPGLKTIFSFVVPDQRSGKVELQYLHEYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGVAGN+ LALGTDVSFDTATG FTKYNAGLSF+ SDLIA+LTLND GD
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGTDVSFDTATGNFTKYNAGLSFTNSDLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH+V
Sbjct  181  TLTASYYHSV  190



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK A+DLLY DY +DHKFT+TTY+++GVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVDEPAPGLKTI SF+ PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNNTL+LGTD+SFDTATG FTK NAGL FS +DLIA+LTLND GD
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLNASYYHTV  190



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   319 bits (818),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK A+DLLY DY +DHKFT+TTY+++GVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVDEPAPGLKTI SF+ PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNNTL+LGTD+SFDTATG FTK NAGL FS +DLIA+LTLND GD
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLNASYYHTV  190



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DY ADHKFTITTY++ GVAITS+G+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQADHKFTITTYTSAGVAITSTGIKKGELFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTITVDEPAPGLK I SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P V+FSG  GNNTLA+GTD+SFDTATG FTK+NAGL+F+ SDLIASLTLND GD
Sbjct  121  IGLTANPSVNFSGAVGNNTLAIGTDLSFDTATGNFTKFNAGLNFTRSDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH+V
Sbjct  181  ALTASYYHSV  190



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY  DHKFTITTY++TG+A+TS+G+KKGE  +ADV+TQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYKDYQGDHKFTITTYTSTGIALTSTGIKKGEFFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN LALGTD+SFDTA+G FTK NAGLSF+ SDLIASLTLND GD
Sbjct  121  IGLTANPIVNFSGVVGNNLLALGTDLSFDTASGNFTKCNAGLSFTNSDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   312 bits (799),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYS+IGKKA+DLLY DY +DHKFT+TTY++ GVAITSSGVKKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IG TA+P+V+FSGV GNN++ALGTD+SFDTATG FTK NAGLS++ +DLIASLTLND GD
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHIV  190



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   311 bits (796),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DY  DHKFT+TT+++ GVAITS+G+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQNDHKFTLTTFTSAGVAITSTGLKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS ++TTITV+EPAPGLKTI+SFV PDQKSGK ELQYLH++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNVFTTITVNEPAPGLKTIVSFVVPDQKSGKAELQYLHDHAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASP+V+FSGV G +  ++GTD+SFDT+TGKF KYNAGLSFS +DLIASLTLND GD
Sbjct  121  IGLTASPIVNFSGVVGTSAASIGTDLSFDTSTGKFVKYNAGLSFSNADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  KLTASYYHTV  190



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   311 bits (796),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYS+IGKKA+DLLY DY +DHKFT+TTY++ GVAITSSGVKKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IG TA+P+V+FSGV GNN++ALGTD+SFDTATG FTK NAGLS++  DLIASLTLND GD
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHIDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHIV  190



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   310 bits (794),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY +DHKFTITTYS TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSTGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TT+TVDEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAGI+TS
Sbjct  61   KNKNITTDIKVDTNSNLFTTVTVDEPAPGLKTILSFRLPDQRSGKVELQYLHDYAGITTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N +ALGTDVSFD+ TG+FTK NAGLSFS +DLIASLTLND GD
Sbjct  121  VGLTANPVVNFSGVFGTNVVALGTDVSFDSKTGQFTKLNAGLSFSNADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   308 bits (790),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L TTITVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G+N LALGTD+SFDT TG FTK NAGLSF+ +DLIASLTLND GD
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNFTKVNAGLSFANADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY +DHKFT+TTY++TGVAITS+G+KKGEL +AD+++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAITSTGIKKGELFLADISSQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G+N +ALGTD+SFDTATG FTK NAGLS++ SDLIASLT+ND GD
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>ref|XP_004147460.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 ref|XP_004168625.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L TTITVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G+N LALGTD+SFDT TG FTK N GLSF+ +DLIASLTLND GD
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNFTKVNTGLSFANADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY +DHKFT+TTY++TGVA+TS+G+KKGEL +ADV+ QL
Sbjct  1    MGKGPGLYADIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTIT+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G+N ++LGTD+SFDTATG FTKYNAGLS++ +DLIASLT+ND GD
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYHTVR
Sbjct  181  TLTASYYHTVR  191



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   306 bits (784),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY ADHKFT+TTY++ GVAITS+G KKGELL+AD++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITT++KVDT+SKL+ T+TVDEPAPGLKTI SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTNVKVDTSSKLFATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+PLV+FSGV GNN++ +GTD+SFDTA+G FTK NAGL+F+ SDLIASLTLND GD
Sbjct  121  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHIV  190



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLL+ DY  DHKFTITTY++ GV ITS+GVKKGE+ +ADV+T+L
Sbjct  1    MVKGPGLYSDIGKKARDLLFKDYQNDHKFTITTYTSAGVEITSTGVKKGEIYLADVSTKL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVDEPAPGLKTI SF+ PDQKSGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLHTTITVDEPAPGLKTIFSFIFPDQKSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASP+V+FSG+ GNN +A+GTD+SFDTA+G FTKYNAGL+ + +DLIASLTLND GD
Sbjct  121  IGLTASPIVNFSGIIGNNLVAVGTDLSFDTASGNFTKYNAGLNVTHADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLNASYYHVV  190



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   305 bits (782),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVA+TS+G+KKGEL +ADV+ QL
Sbjct  1    MGKGPGLYVDIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTIT+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G+N ++LGTD+SFDTATG FTKYNAGLS++ +DLIASLT+ND GD
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYHTVR
Sbjct  181  TLTASYYHTVR  191



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYS+IGKKA+DLLY DY  DHKFT+TTY++ GVAITS+G+KKGELL+ADV+TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+SKL+TT+TVDEPAPGLKTI SFV PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+PLV+FSGV GNN +++GTD+SFDTA+G FTK NAGL+F+ SDLIAS+T+ND  D
Sbjct  121  IGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASVTVNDKCD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  NLTASYYHIV  190



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVAI+S+G++KGEL + DV+TQL
Sbjct  1    MVKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGELYLGDVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTIT+DEPAPGLK I SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F+ SDLIASL LND  D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKAD  180

Query  641  FLGASYYHTV  670
             + ASYYHTV
Sbjct  181  TITASYYHTV  190



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DY +DHKFT+TTY++TGVA+TS+G+KKGEL +AD+NTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQSDHKFTLTTYTSTGVAVTSTGIKKGELFLADINTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS ++TTITVDEPAPGLKTI+SF  PDQ+SGK ELQYLH+YAGIS S
Sbjct  61   KNKNITTDIKVDTNSNVFTTITVDEPAPGLKTILSFKVPDQRSGKAELQYLHDYAGISAS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G +  ++GTD+SFDTA+G FTK+NAG S S +DLIASLTLND GD
Sbjct  121  IGLTANPIVNFSGVVGTSAASVGTDLSFDTASGNFTKFNAGASLSNADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLTASYYHIV  190



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY DIGKKA+DLLY DY +DHKFT+TTY++ GVAITS+G+KKGEL +AD+++QL
Sbjct  1    MGKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSTGIKKGELFLADISSQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTIT+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G+N +ALGTD+SFDTATG FTK NAGLS++ SDLIASLT+ND GD
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
             VKGPGLYSDIGK+A+DLLY DY  D KFT+TT ++ GV ITSSG KKGEL +ADVNTQL
Sbjct  3    FVKGPGLYSDIGKRARDLLYKDYQGDQKFTLTTCTSNGVIITSSGTKKGELFLADVNTQL  62

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS ++TTITVDEPAPG+K I SFVAPDQKSGKVELQYLHEYAGISTS
Sbjct  63   KNKNITTDVKVDTNSNVHTTITVDEPAPGVKAIFSFVAPDQKSGKVELQYLHEYAGISTS  122

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA P+V+FSGVAGN+  A GTD+SFDTATG FTKYNAG+SF+T+DLIASL LND G 
Sbjct  123  LGLTAKPIVNFSGVAGNHKAAFGTDISFDTATGNFTKYNAGVSFTTTDLIASLILNDKGQ  182

Query  641  FLGASYYHTV  670
             + ASY+HT+
Sbjct  183  TVTASYFHTI  192



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKK +DLLY DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYHSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVDE APGLKTI+SF  PDQ+SGK+E+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFDT TG FTK NAGLSF+ +DL+ASL LND GD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  NLSASYYHTV  190



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   302 bits (773),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLLY DY +DHKFT+TT+++ GVAITS+G KKGEL +ADV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTFTSNGVAITSTGTKKGELFLADVSTKL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
             NKNITTD+KVDTNS L+TTITVDEPAPGLK I SF  PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV GN+TLALGTD+SFDTA+G FTK NAGL+F+ +DLIASL +ND  D
Sbjct  121  LGLTANPIVNFSGVIGNSTLALGTDLSFDTASGNFTKCNAGLNFTNTDLIASLNVNDKAD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ILNASYYHIV  190



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKK++DLLY DY ADHKFT+TTY++ GVAITS+G+KKGELL+ADV+T+L
Sbjct  1    MGKGPGLYSDIGKKSRDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN NITT++KVDT S L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNNNITTNVKVDTKSNLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGL A+PLV+FSGV GNN +++GTD+SFDTA+G FTK NAGL+F+ SDLIASLTLND GD
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHIV  190



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   301 bits (772),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLLY DY +DHKFT+TTY+A GVAITS+G KKGEL +ADV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTYTANGVAITSTGTKKGELFLADVSTKL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
             NKNITTD+KVDTNS L+TTITVDEPAPGLK I SF  PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV GN+TLALGTD+SFDTA+G FTK NAGLSF+  DLIAS+ +ND  D
Sbjct  121  LGLTANPIVNFSGVFGNSTLALGTDLSFDTASGNFTKCNAGLSFTNDDLIASVNVNDKLD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ILNASYYHIV  190



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY +DHKFTITTYS TGVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTDLKVDT S L+TTITVDEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FS V G N L+LGTD+SFD+ +G FTK NAGLSF+ +DLIASL LN+ GD
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  SLAASYYHFVN  191



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY +DHKFTITTYS TGVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTDLKVDT S L+TTITVDEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FS V G N L+LGTD+SFD+ +G FTK NAGLSF+ +DLIASL LN+ GD
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  SLAASYYHFVN  191



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 173/207 (84%), Gaps = 3/207 (1%)
 Frame = +2

Query  50   PPSLLSLQLRC*LPEGEMVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITS  229
            P   L L  +  L  G+MV GPGLY+DIGKKA+DLLY DY +DHKFT+TTYS TGVAITS
Sbjct  37   PSRFLCLLFQSLL--GKMV-GPGLYTDIGKKARDLLYKDYQSDHKFTVTTYSPTGVAITS  93

Query  230  SGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKS  409
            SG KKGEL +ADVNTQLKNKN+TTD+KVDT+S L TT+TVD+PAPGLK I SF  PDQ+S
Sbjct  94   SGTKKGELFLADVNTQLKNKNVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRS  153

Query  410  GKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLS  589
            GKVELQYLH+YAGISTSIGLTA+P+V+FSGV G N LALGTD+SFDT TG  TK NAG+S
Sbjct  154  GKVELQYLHDYAGISTSIGLTANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVS  213

Query  590  FSTSDLIASLTLNDXGDFLGASYYHTV  670
            FS +DLIA+LTLND GD L ASYYH V
Sbjct  214  FSNADLIAALTLNDKGDILSASYYHNV  240



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGK+A+DLL+ DY +D KFTITTYS TGVAITSSG+KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTDLKVDT+S L+TT+TVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P+V+FSGV G N LA+GTD+SFDT  G+ TK+NAGL+F+ +DLIASLT+ND GD
Sbjct  121  VGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALNASYYHIV  190



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   300 bits (769),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY ADHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+K D+ S L+TT+T+DEPAPGLKTI SFV PDQKSGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKFDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGKVELQYRHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA PLVSFSGV GN+++++GTD+SFDTA+G F K NAGL+ + SDLIAS+TLND GD
Sbjct  121  IGLTAKPLVSFSGVIGNDSVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLTASYYHIV  190



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   300 bits (769),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKK +DLLY DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVD+ APGLKTI+SF  PDQ+SGK+E+QYLHEYAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDDAAPGLKTILSFRVPDQRSGKLEVQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFD+ TG FTK NAGLSF+ +DL+ASL LND GD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDSKTGDFTKCNAGLSFTNADLVASLNLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH+V
Sbjct  181  NLSASYYHSV  190



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY  D KF+ITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLYRDYQTDQKFSITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L TTITVDE APGLKTI+SF  PDQ+SGK+ELQYLH+YAGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLLTTITVDEAAPGLKTILSFRVPDQRSGKLELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LA GTDVSFD+ TG FTK NAGLSF+ +DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVLGTNLLAFGTDVSFDSKTGNFTKCNAGLSFANADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHT+
Sbjct  181  TLNASYYHTI  190



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
             VKGPGLY DIGK+A+DLLY DY  DHKFT+TTYS+ G+AITS+G KKGEL++ DVNTQL
Sbjct  3    FVKGPGLYPDIGKRARDLLYKDYQGDHKFTLTTYSSNGLAITSTGTKKGELILGDVNTQL  62

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTDLKVDTNS + TTITVDEPAPG+K IISF APDQKSGKVELQY HEYA ISTS
Sbjct  63   KNKNITTDLKVDTNSNVCTTITVDEPAPGVKAIISFAAPDQKSGKVELQYFHEYAAISTS  122

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA P+V+FSGVAG++  A GTDVSFDTATG FTKYNAG+SF+T+DLIAS  LND G 
Sbjct  123  LGLTAKPIVNFSGVAGSHKAAFGTDVSFDTATGNFTKYNAGVSFTTTDLIASFILNDKGQ  182

Query  641  FLGASYYHTV  670
             L ASY+HTV
Sbjct  183  SLTASYFHTV  192



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY ADHKFT+TTY++ GVAITS+G+KKGELL+ADV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN NITT++KVDT S L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGL A+PLV+FSGV GNN +++GTD+SFDT +G FTK NAGL+F+ SDLIASLTLND GD
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHIV  190



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY +DHKFTITT+S TGV +TS+G KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTITTFSPTGVTLTSTGTKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITVDEPAPGLK+I SF  PDQ+SGK+ELQYLHE+AGIS+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPDQRSGKIELQYLHEHAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G + LALGTDVSFDT +G F K NAGLSFS +DLIASLT+ND GD
Sbjct  121  IGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDFAKCNAGLSFSNADLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLAASYYHLV  190



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT S L+TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+N+ GD
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  SLNASYYHTV  190



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+K+DTNS L TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+ND GD
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALNASYYHAV  190



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
             VKGPGLYSDIGKKA+DLLY DY  D KFT+TTY++ GVAITSSG +KG+L +AD+NTQL
Sbjct  3    FVKGPGLYSDIGKKARDLLYRDYQGDQKFTLTTYTSNGVAITSSGTRKGDLFLADINTQL  62

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT S +YTTITVDEPAPG+K I+SFVAPDQKSGKVELQY HE+AGISTS
Sbjct  63   KNKNITTDVKVDTYSNVYTTITVDEPAPGVKAIVSFVAPDQKSGKVELQYFHEHAGISTS  122

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA P+V+FSGVAGN   A GTD+SFDTATG FTK NAG+SF+T+DLIASL LND G+
Sbjct  123  LGLTAKPIVNFSGVAGNQKAAFGTDISFDTATGNFTKCNAGVSFTTTDLIASLMLNDKGE  182

Query  641  FLGASYYHTV  670
             + ASY+HTV
Sbjct  183  TVTASYFHTV  192



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+K+DTNS L TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSG+ G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+ND GD
Sbjct  121  VGLTANPIVNFSGIVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALNASYYHAV  190



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  DHKFT+TT S TGVAITS+G KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDT S LYTTITVD+PAPGLK I SF APDQ+SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRAPDQRSGKVELQYLHEYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+ SGV G N LALGTD+SFDT TG FTK NAGLSFS  DLIASLTLN+ GD
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLNASYYHIV  190



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS + TTITVDEP+PGLK I SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPSPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F+ SDLIASL LND  D
Sbjct  121  IGLTANPIVHFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKAD  180

Query  641  FLGASYYHTV  670
             + ASYYHTV
Sbjct  181  TITASYYHTV  190



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLL+ DY  DHKFTITTY++TGV ITS+GV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF  PDQKSGKVELQY HEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN +A+GTD+SFDTA+G FTKYNAGL+ + +DLIASLTLND GD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  NLTASYYHIV  190



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G FTK+NAGL+F+ +DLIASL LND  D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKAD  180

Query  641  FLGASYYHTV  670
             + ASYYHTV
Sbjct  181  TVTASYYHTV  190



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY+DIGK+ +DLL+ DY  DHKFTITT ++TGV ITS+GV+KGEL +AD++T+L
Sbjct  1    MVKGPGLYTDIGKRTRDLLFKDYQNDHKFTITTQTSTGVEITSTGVRKGELYLADISTKL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNIT+D+KVDTNS L TTITVDEPAPGLK I SF+ PDQKSGKVELQYLHEYAGISTS
Sbjct  61   KNKNITSDIKVDTNSSLRTTITVDEPAPGLKAIFSFIFPDQKSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN +A+GTD+SFDTA+G FTKYNAGL+ + +DLIASLTLND GD
Sbjct  121  IGLTANPIVNFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHIV  190



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   298 bits (763),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS + TTITVDEPAPGLK I SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F   DLIASL LND  D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFIHCDLIASLLLNDKAD  180

Query  641  FLGASYYHTV  670
             + ASYYHTV
Sbjct  181  TITASYYHTV  190



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   298 bits (762),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY+DIGKKA+DLLY DY +DHKFTITT+S TGVAITSSG KKGEL +ADVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYRDYQSDHKFTITTFSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            N+TTD+KVDT+S L TTITVD+PAPGLK I SF  PDQ+SGKVELQYLH+YAGIS+S+GL
Sbjct  63   NVTTDVKVDTDSNLSTTITVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TA+P+V+FSGV G N LALGTD+SFDT TG  TK NAGLSFS +DL+A+LTLND GD L 
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGLSFSNADLVAALTLNDKGDILS  182

Query  650  ASYYHTV  670
            ASYYH+V
Sbjct  183  ASYYHSV  189



>gb|ACU19720.1| unknown [Glycine max]
Length=241

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLL+ DY  DHKFTITTY++TGV ITS+GV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF  PDQKSGKVELQY HEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN +A+GTD+SFDTA+G F KYNAGL+ + +DLIASLTLND GD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNFIKYNAGLNITHADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  NLTASYYHIV  190



>gb|KJB60742.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=207

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY  DHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVD+ S L+TT+T+DEPAPGLKTI SFV PDQKSG VELQY HEYAGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA PLVSFSGV GN+ +++GTD+SFDTA+G F K NAGL+ + SDLIAS+TLND GD
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLTASYYHIV  190



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  DHKFT+TT S TGVAITS+G KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDT S LYTTITVD+PAPGLK I SF  PDQ+SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+ SGV G N LALGTD+SFDT TG FTK NAGLSFS  DLIASLTLN+ GD
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLNASYYHIV  190



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGK+A+DLL+ DY +D KFTITTYS TGVAITSSG++KGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIEKGELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTDLKVDT+S L+TT+TVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P+V+FSGV G N  A+GTD+SFDT  G+ TK+NAGL+F+ +DLIASLT+ND GD
Sbjct  121  VGLTPNPIVNFSGVVGTNARAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALNASYYHIV  190



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY  D KFT+TT+S TGVAITS+G KKG+L VADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQTDQKFTLTTFSPTGVAITSAGTKKGDLFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN+N+TTD+KVDT+S L+TTITVDEPAPGLKTI SF  PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNRNVTTDIKVDTSSNLFTTITVDEPAPGLKTIFSFRVPDQRSGKVELQYLHDYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG FTK NAGLSFS  DLIAS+ LN+ GD
Sbjct  121  IGLTANPIVNFSGVFGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASVALNEKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLNASYYHIV  190



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G FTK+NAGL+F+ +DLIASL LND  D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKAD  180

Query  641  FLGASYYHTV  670
             + ASYYHTV
Sbjct  181  TVTASYYHTV  190



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F+ +DLIASL LND  D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKCNAGLNFTHTDLIASLILNDKAD  180

Query  641  FLGASYYHTV  670
             + ASYYHTV
Sbjct  181  TVTASYYHTV  190



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY  DHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVD+ S L+TT+T+DEPAPGLKTI SFV PDQKSG VELQY HEYAGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA PLVSFSGV GN+ +++GTD+SFDTA+G F K NAGL+ + SDLIAS+TLND GD
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLTASYYHIV  190



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   296 bits (758),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLL+ DY  DHKFTITTY++TGV ITS+GV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L T ITVDEPAPGLKTI SF  PDQKSGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLRTIITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GNN +A+GTD+SFDT +G FTKYNAGL+ + +DLIASLTLND GD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTTSGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  NLTASYYHIV  190



>gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY  DHKFT TTY+A GVAITS+G+KKGEL +ADV++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQGDHKFTFTTYTAAGVAITSTGIKKGELFLADVSSQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTIT+D+ APGLKTI SF  PDQ+SGKV+LQY HEY+GIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITIDDLAPGLKTIFSFKIPDQRSGKVDLQYQHEYSGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GN+T+ALGTD+SFDTA+G FTK NAGLS++ +DLIAS+TLND GD
Sbjct  121  IGLTANPIVNFSGVVGNSTIALGTDLSFDTASGNFTKLNAGLSYTNADLIASVTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLNASYYHTV  190



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   296 bits (757),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY +DHKF+ITTYS TGV ITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L+TTITVDE APGLKTI+SF  PDQ+SGK+E+QYLH+YAGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N +ALGTDVSFDT TG FTK NAGLSF+ +DL+ASL LN+ GD
Sbjct  121  VGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  NLTASYYHTV  190



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   298 bits (763),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +2

Query  92   EGEMVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVN  271
            E  MVKGPGLY DIGKKA+DLLY DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+
Sbjct  66   ETIMVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVS  125

Query  272  TQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGI  451
            TQLKNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGI
Sbjct  126  TQLKNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGI  185

Query  452  STSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLND  631
            ST IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G FTK+NAGL+F+ +DLIASL LND
Sbjct  186  STGIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILND  245

Query  632  XGDFLGASYYHTV  670
              D + ASYYHTV
Sbjct  246  KADTVTASYYHTV  258



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   296 bits (757),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKK +DLLY D+ +DHKF+ITT S TGVA+TSSG KKG+L  ADVN QL
Sbjct  1    MAKGPGLYTEIGKKVRDLLYKDFQSDHKFSITTCSPTGVAVTSSGTKKGDLFWADVNAQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD KVDTNS L+T +T+DEP PGLKTI SF  PDQ+SGK+ELQYLH+YAGISTS
Sbjct  61   KNKNITTDFKVDTNSNLFTAVTIDEPVPGLKTIFSFRVPDQRSGKLELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+++FSGV G N LALGTDVSFDT TG  TK NAGLSF+ SDLIASLTLND GD
Sbjct  121  VGLTANPIINFSGVVGTNALALGTDVSFDTKTGTLTKCNAGLSFTNSDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  ALSASYYHTV  190



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   295 bits (756),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY +DHKF+ITTYS TGV ITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L+TTITVDE APGLKTI+SF  PDQ+SGK+E+QYLH+YAGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N +ALGTDVSFDT TG FTK NAGLSF+ +DL+ASL LN+ GD
Sbjct  121  VGLTANPIVNFSGVVGTNIVALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  NLTASYYHTV  190



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY+DIGKKA+DLLY DY +D KFT+TTYS TGVAITSSG KKGEL +ADVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDQKFTVTTYSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            N+TTD+KVDT+S L TT+TVD+PAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS+GL
Sbjct  63   NVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTSVGL  122

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TA+P+V+FSGV G N LALGTD+SFDT TG  TK NAG+SFS +DLIA+LTLND GD L 
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVSFSNADLIAALTLNDKGDILS  182

Query  650  ASYYHTV  670
            ASYYH V
Sbjct  183  ASYYHNV  189



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLL+ DY +D KFT+TTYS TGVAITSSG +KGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L A+YYH V
Sbjct  181  ALNAAYYHVV  190



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY +D KF+ITTYS TGVAITS+G+KKG+L +ADV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQSDQKFSITTYSPTGVAITSTGIKKGDLFLADVATQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KV T+S L TTITVDEPAPGLK+I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G+N LALGTDVSFDT TG FTK NAGLSF+  DLIASLTLND GD
Sbjct  121  IGLTANPVVNFSGVVGSNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             L  SYYH V 
Sbjct  181  TLNGSYYHIVN  191



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGKKA+DLLY DY  DHKFT+TT +A+GVAITSSG+KKG+LL+ DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYQTDHKFTVTTLTASGVAITSSGIKKGDLLLGDVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L  TITVDEPAPGLK I+SF+ PDQKS +VELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLATITVDEPAPGLKAILSFIVPDQKSARVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+++FSGV GN  L+LGTDVSFDTA+G  TK NAGL+F  +DLIASL +ND GD
Sbjct  121  LGLTANPVINFSGVVGNAALSLGTDVSFDTASGNLTKLNAGLNFIHTDLIASLLVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYY TV
Sbjct  181  TLTASYYQTV  190



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLL+ DY +D KFT+TTYS TGVAITSSG +KGEL +ADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L A+YYH V
Sbjct  181  ALNAAYYHVV  190



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   293 bits (751),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAIT+SG +K EL VADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L A+YYH V
Sbjct  181  ALNAAYYHVV  190



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAIT+SG +K EL VADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L A+YYH V
Sbjct  181  ALNAAYYHVV  190



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   293 bits (750),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KFTITTYS TGVAITS+G KKG++ +ADV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQNDQKFTITTYSPTGVAITSTGTKKGDVFLADVATQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KV T+S L TTITVDEPAPGLK+I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALGTDVSFDT TG FTK NAGLSF+  DLIASLTLND GD
Sbjct  121  IGLTANPIVNFSGVVGTNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  TVNASYYHIVN  191



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = +2

Query  86   LPEGEMVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVAD  265
            LP   M KGPGLYSDIGKKA+DLLY DY +DHKFT+TTY++ GVAI+S+G+KKGE+ +AD
Sbjct  62   LPGKAMGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLAD  121

Query  266  VNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYA  445
            V+TQLKN NITTD+KVDT+S ++TT+T+DEPAPGLKTI SF  PDQ+SGKVELQY HEYA
Sbjct  122  VSTQLKNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYA  181

Query  446  GISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTL  625
            GIST IGLTASP+V+F+GV GN+ L+LGTD+SFDTA+G  TK NAGLS++ SDLIA+LTL
Sbjct  182  GISTGIGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTL  241

Query  626  NDXGDFLGASYYHTV  670
            ND GD L ASYYH V
Sbjct  242  NDKGDALTASYYHLV  256



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY  DHKFT+TTY++TGVAITS+G+KKGE+ + D+ +QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQGDHKFTVTTYTSTGVAITSTGIKKGEIYLGDITSQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S + TTITVDEPAPGLKTI SF  PDQ+SGKVELQY HE+AGISTS
Sbjct  61   KNKNITTDIKVDTSSNVSTTITVDEPAPGLKTIFSFKIPDQRSGKVELQYQHEHAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G++ +ALGTD+SFDTA+G FTK NAGLS+S +DLIASLTLND GD
Sbjct  121  IGLTANPIVNFSGVIGSSAVALGTDLSFDTASGNFTKLNAGLSYSNTDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHIV  190



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAIT+SG +K EL +ADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L A+YYH V
Sbjct  181  ALNAAYYHVV  190



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
 ref|XP_004162535.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
Length=276

 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY +DHKFT+TTY++ GVAI+S+G+KKGE+ +ADV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN NITTD+KVDT+S ++TT+T+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASP+V+F+GV GN+ L+LGTD+SFDTA+G  TK NAGLS++ SDLIA+LTLND GD
Sbjct  121  IGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALTASYYHLV  190



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY +DHKFT+TTY+A GVAI+S+GVKKG++ +ADV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTAGGVAISSTGVKKGDIFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN NITTD+KVDT+S ++TT+T+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASP+V+F+GV GN  L+LGTD+SFDTA+G  TK NAGLS++ SDLIA+LTLND GD
Sbjct  121  IGLTASPIVNFAGVIGNEKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALTASYYHLV  190



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   291 bits (745),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 6/190 (3%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY ADHKFT+TTY++ GVAITS+G KKGELL+AD++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITT      N KL+ T+TVDEPAPGLKTI SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITT------NVKLFATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  114

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+PLV+FSGV GNN++ +GTD+SFDTA+G FTK NAGL+F+ SDLIASLTLND GD
Sbjct  115  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  174

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  175  TLNASYYHIV  184



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   291 bits (744),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAIT+SG +K EL +ADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG D+SFD+  G+ TK NAGLSF+  DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L A+YYH V
Sbjct  181  ALNAAYYHVV  190



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   291 bits (744),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLL+ DY +D KFTITT+S TGVAITSSG KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTI V++PAPGLK I SF  PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALG D++FDT  G+ TK NAGLSF+  DLIA+LTLND GD
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIGELTKSNAGLSFTKDDLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALNASYYHVV  190



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   291 bits (744),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PDQ S K+E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N L+LGTD+SFDT  G  TK NAGLSF+ +DLIASL LND GD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALSASYYHIV  190



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   290 bits (743),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PDQ S K+E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N L+LGTD+SFDT  G  TK NAGLSF+ +DLIASL LND GD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALSASYYHIV  190



>gb|KDO82798.1| hypothetical protein CISIN_1g0238541mg, partial [Citrus sinensis]
Length=174

 Score =   286 bits (733),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYS+IGKKA+DLLY DY +DHKFT+TTY++ GVAITSSGVKKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLT  622
            IG TA+P+V+FSGV GNN++ALGTD+SFDTATG FTK NAGLS++ +DLIASLT
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLT  174



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY +D KFT+TTYS TGV +TSSG +KG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTRKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L+TTITVDEPAPGLKTI+SF  PDQ+SGK+ELQYLH+YAGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEPAPGLKTILSFKVPDQRSGKLELQYLHDYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV GNN  ALG+D+SFDT  G  TK+N G S+S +DLIA+L LND GD
Sbjct  121  VGLTANPIVNFSGVLGNNAFALGSDLSFDTKEGNVTKWNFGASYSNADLIAALALNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLSASYYHLV  190



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
             VKGPGLY DIGK+A+DLLY DY  D KFT+TTY++ GVAITSSG +KG+L +ADV+TQ+
Sbjct  3    FVKGPGLYPDIGKRARDLLYKDYQGDQKFTLTTYTSNGVAITSSGTQKGDLFLADVSTQM  62

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS +YTT TVDEPAPG+K I SFVAPDQKSGKVELQY HEY+GISTS
Sbjct  63   KNKNITTDVKVDTNSNVYTTFTVDEPAPGVKAIFSFVAPDQKSGKVELQYFHEYSGISTS  122

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA P+V+FSGVAGN+T A GTDVSFDT TG F K NA LSF+T+DL+ASL L+D G+
Sbjct  123  LGLTAKPIVNFSGVAGNHTFAFGTDVSFDTETGNFIKSNAALSFTTADLVASLGLSDKGE  182

Query  641  FLGASYYHTV  670
             + ASY+HTV
Sbjct  183  TVTASYFHTV  192



>ref|XP_006842115.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYS+IGKKA+DLLY DY +D KF +TTY++TGVAITSSG KKG+L +ADV TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYHSDQKFILTTYTSTGVAITSSGTKKGDLFLADVTTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L TTITVDE APGLKTI S + PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLSTTITVDEAAPGLKTIFSCIFPDQRSGKVELQYLHDYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV GN T ALGTDV+FDTAT K TK NAG SF+TSDLIA+ T+ND G+
Sbjct  121  IGLTATPIVNFSGVLGNETFALGTDVAFDTATSKLTKCNAGFSFTTSDLIAAATVNDKGN  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLTASYYHTV  190



>ref|XP_007046222.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
 gb|EOY02054.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
Length=224

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYS+IGKKA+DLLY DY  DHKFT+TTY++ GVAITS+G+KKGELL+ADV+TQL
Sbjct  28   MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  87

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+SKL+TT+TVDEPAPGLKTI SFV PDQ+SGKVELQY HEYAGISTS
Sbjct  88   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHEYAGISTS  147

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+PLV+FSGV GNN +++GTD+SFDTA+G FTK NAGL+F+ SDLIAS+T+     
Sbjct  148  IGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASVTVPLTNT  207

Query  641  FLGASYYHT  667
             +GA   H+
Sbjct  208  AVGAELTHS  216



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAIT+SG +K EL +ADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG D+SFD+  G+ TK NAGLSF+  DLIASL LND GD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLALNDKGD  180

Query  641  FLGASYYHTV  670
             L A+YYH V
Sbjct  181  ALNAAYYHVV  190



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PDQ S ++E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAELEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N L+LGTD+SFDT  G  TK NAGLSF+ +DLIASL LND GD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALSASYYHIV  190



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLL+ DY  DHKFT+TT + +GV ITSSGV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTVTTQTLSGVEITSSGVRKGEIFLADVSTKV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF+ PDQ S KVELQY HEY GI+TS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITVDEPAPGLKTIFSFIFPDQNSAKVELQYQHEYVGINTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTASP+V+FS V GNN +++G+DVSFDTA+G F KYNAGL+ + +DLIASLT+ND GD
Sbjct  121  IGLTASPIVNFSSVIGNNLVSVGSDVSFDTASGNFIKYNAGLNVTHADLIASLTINDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLNASYYHVV  190



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   288 bits (738),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY +DHKFTITTYS TGV +TS+G+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQSDHKFTITTYSPTGVTLTSTGIKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K+KN+TTD+KVDT+S L TT+TVDEPAPGLKTI+SF  PDQ+SGK+ELQYLH+YAGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLLTTVTVDEPAPGLKTILSFRVPDQRSGKLELQYLHDYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FS V G+N LA+G+DVSFD+  G  TK N G SF+ SDLIA+LTLND GD
Sbjct  121  VGLTANPIVNFSAVLGSNKLAVGSDVSFDSKEGAITKCNFGASFTNSDLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  TLSASYYHTV  190



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   288 bits (736),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY +DHK TIT+ S TGVAITSSG KKG++ VADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+K+DT+S L+ T+TVDEPAPGLK+I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSG  G N +ALGTD+SFDT +G FTK NAG+SF  +DLIASLT+ND GD
Sbjct  121  IGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNFTKCNAGVSFCNADLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             + ASY+H+V
Sbjct  181  AVNASYFHSV  190



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   288 bits (736),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY +D KFT+TTYS TGV +TSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K+KNITTD+KVDTNS L+TT+TVDEP PGLKTI+SF  PDQ+SGK+ELQYLH+YAGIS++
Sbjct  61   KHKNITTDIKVDTNSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHDYAGISSN  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV GNN +ALG+DVSFDT  G F K N G SF+ +DLIA+LTLND GD
Sbjct  121  VGLTANPIVNFSGVVGNNKVALGSDVSFDTKEGAFVKCNFGASFTNADLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLSASYYHIV  190



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   288 bits (736),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY +D KFT+TTYS TGV +TS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSTGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K+KN+TTD+KVDT+S L+TT+TVDEP PGLKTI+SF  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHEYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV GNN LALG+DVSFDT  G F K N G SF+ +DLIA+LTLND GD
Sbjct  121  VGLTANPIVNFSGVVGNNKLALGSDVSFDTKEGAFIKCNFGASFTNADLIAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  TLSASYYHIV  190



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLL+ DY +D KFTITT+S TGVAITSSG KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTI V++PAPGLK I SF  PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALG D++FDT  G  TK NAGL F+  DLIA+LTLND GD
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIGGLTKSNAGLGFTKDDLIAALTLNDRGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  ALNASYYHVV  190



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K++N+TTD+KVDT+S L+TTITVDEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+ GD
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  180

Query  641  FLGASYYHTV  670
             + ASYYH V
Sbjct  181  SVNASYYHIV  190



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLLY DY  DHKF ITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFAITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PD  S K+E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDHSSAKLEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N L+LGTDVSFDT  G  TK NAGLSF+ +DLIASL LND GD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDVSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLSASYYHIV  190



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
             VK PGLYSDIGKKA+DLLY DY  DHKFT+T+Y++ GV+ITSS VKKG+ ++AD++ QL
Sbjct  3    FVKSPGLYSDIGKKARDLLYRDYGGDHKFTLTSYTSNGVSITSSAVKKGDSVLADISAQL  62

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNSK+ TTIT+DEPAPG+K I S  APDQKSGKVELQY HEYAGISTS
Sbjct  63   KNKNITTDVKVDTNSKVLTTITIDEPAPGVKAIFSITAPDQKSGKVELQYFHEYAGISTS  122

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            + LTA P+V+FSGVAGN  +  GTDVSFDTATG FTKYNAG+SF+T+DLIASL LND G+
Sbjct  123  LFLTAKPIVNFSGVAGNKNVFFGTDVSFDTATGNFTKYNAGISFTTADLIASLNLNDKGE  182

Query  641  FLGASYYHTV  670
             + ASY+HTV
Sbjct  183  KITASYFHTV  192



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKAKDLLY DY +DHKFTITT S TGV ITS+  KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKAKDLLYKDYQSDHKFTITTSSVTGVTITSAATKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L T ITVDEP PGLKTI SF  PDQ+SG++ELQYLH+YAGISTS
Sbjct  61   KNKNVTTDVKVDTNSNLVTKITVDEPFPGLKTIFSFTVPDQRSGQIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+F+ V G+N L+LGTDVSFD+    FTK NAG+SFS +DLIASL LN+ GD
Sbjct  121  VGLTANPVVNFAAVLGSNVLSLGTDVSFDSKASNFTKCNAGISFSNADLIASLALNNKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  SLTASYYHIVN  191



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY+DIGKKA+DLLY DY +D KFTITT+S TGVAIT+SG  KGEL + DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDKKFTITTFSPTGVAITTSGTNKGELFLGDVNTQLKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            N+TTD+KVDT+S L TTITVD+PAPGLK I  F  PDQ+SGKVELQYLH+YAGIS+S+GL
Sbjct  63   NVTTDIKVDTDSNLSTTITVDQPAPGLKAIFCFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TA+P+V+FSGV G N LALG D+SFDT TG  TK NAGLSFS +DLIA+LTLND GD L 
Sbjct  123  TANPIVNFSGVIGTNQLALGADLSFDTKTGILTKCNAGLSFSNADLIAALTLNDKGDILS  182

Query  650  ASYYHTV  670
            ASYYH+V
Sbjct  183  ASYYHSV  189



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   286 bits (732),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MV GPGLYS+IGKKA+DLLY DY  DHKFT+ T S TGV ITSSG KKG+LL ADVNTQL
Sbjct  1    MVNGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT+S L+TTITVDEPAPGLKTI SF  PDQ+SGKVE+QYLH+YA +S+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P+V+FSGV G N  +LGTD+SFDT TG F K NAG+S S  DLIASLTLND GD
Sbjct  121  VGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  SLNASYYHIVN  191



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   285 bits (730),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKK +DLLY DY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L  T+TVDE APGLKTI S   PDQ S K+ELQYLH+YAGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G  TK NAGLSF+ +DLI SL LN+ GD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLSASYYHIV  190



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   285 bits (729),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKK +DLLY DY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L  T+TVDE APGLKTI S   PDQ S K+ELQYLH+YAGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G  TK NAGLSF+ +DLI SL LN+ GD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLSASYYHIV  190



>gb|AFK37646.1| unknown [Lotus japonicus]
Length=177

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGK+A+DLL+ DY +D KFTITTYS TGVAITSSG+KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTDLKVDT+S L+TT+TVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLND  631
            +GLT +P+V+FSGV G N LA+GTD+SFDT  G+ TK+NAGL+F+ +DLIASLT+ND
Sbjct  121  VGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVND  177



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   285 bits (729),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKK +DLLY DY  DHKFTITTYSATGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSATGVAITSSGLKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI S   PDQ S K+ELQYLH+YAGI TS
Sbjct  61   KNKNLTTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G  TK NAGL F+ +DLI SL LN+ GD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLRFTNADLITSLNLNNKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLSASYYHIV  190



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYS+IGKKA+DLLY DY  DHKFT+ T S TGV ITSSG KKG+LL ADVNTQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K+KNITTD+KVDT+S L+TTITVDEPAPGLKTI SF  PDQ+SGKVE+QYLH+YA +S+S
Sbjct  61   KSKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT +P+V+FSGV G N  +LGTD+SFDT TG F K NAG+S S  DLIASLTLN+ GD
Sbjct  121  IGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNNKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  SLNASYYHIVN  191



>gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   283 bits (724),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KFTITTYS TGVAITS+G+KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGLKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K  N TTD+KVDT+S L+TTITVDEPAPGLK I+SF  PDQ+SGK+E+QYLH+YA +S+S
Sbjct  61   KKNNFTTDVKVDTDSNLFTTITVDEPAPGLKAILSFKVPDQRSGKLEVQYLHDYAAVSSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT +P+V+FSGV G+N ++LGTD+SFDT +G FTK NAGLS+S +DL+A+LTLND GD
Sbjct  121  IGLTPNPIVNFSGVIGSNAVSLGTDLSFDTKSGNFTKCNAGLSYSNADLVAALTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLKASYYHIV  190



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY+DIGKKA+DLLY DY +D KFTI+TYS TGVAITSSG KKGEL + DVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDTNS L+TTITV+EPAPG+K I+SF  P+Q SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GL A+P+V+FS V G N LA G D+SFDT  G+ TK NA ++F   DLI SLTLN+ GD
Sbjct  121  VGLKANPIVNFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTLNEKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH +
Sbjct  181  LLSASYYHAI  190



>dbj|BAG09387.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=181

 Score =   278 bits (711),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLL+ DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVDT S L+TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLN  628
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+N
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVN  176



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KFT+TT S TG AITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTG-AITSAGTKKGDLFLADVNTQL  59

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K++N+TTD+KVDT+S L+TTITVDEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  60   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  119

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+ GD
Sbjct  120  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  179

Query  641  FLGASYYHTV  670
             + ASYYH V
Sbjct  180  SVNASYYHIV  189



>gb|KJB30016.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=184

 Score =   277 bits (709),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY ADHKFT+TTY++ GVAITS+G+KKGELL+ADV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN NITT++KVDT S L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTL  625
            IGL A+PLV+FSGV GNN +++GTD+SFDT +G FTK NAGL+F+ SDLIASLTL
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTL  175



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M  GPGLY++IGKKA+DLLY DY +DHKFTITTYS TGVAITSSG KKG++ +ADV TQL
Sbjct  1    MANGPGLYTEIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDVFLADVTTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K +N+TTD+KVDT S L TTITVD+P PG+K I+SF  PDQ SGK ELQYLH+YAGISTS
Sbjct  61   KKQNVTTDIKVDTESNLLTTITVDQPCPGVKAILSFKVPDQNSGKAELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALGTDVSFDT +G FTK NAGL+FS +DL+ASL LN+ GD
Sbjct  121  VGLTANPVVNFSGVLGTNLLALGTDVSFDTKSGNFTKCNAGLNFSNADLMASLNLNEKGD  180

Query  641  FLGASYYHTV  670
             +  S+YH++
Sbjct  181  VVSGSFYHSL  190



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLL  DY +D KFT+TTYS TGV +TSSG KKGEL +ADVNTQ 
Sbjct  1    MGKGPGLYSDIGKRARDLLNKDYNSDQKFTLTTYSPTGVTLTSSGTKKGELFLADVNTQF  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDT+S L+TTITVDE  PGLKTI+SF APDQ+SGK+ELQYLH+YAG+S+S
Sbjct  61   KNKNVTTDIKVDTSSNLFTTITVDELTPGLKTILSFKAPDQRSGKLELQYLHDYAGLSSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+F+GV GNN LALG+DVSFDT  G F KYN G SF+ +DLIA++TLN+  D
Sbjct  121  IGLTANPVVNFAGVLGNNKLALGSDVSFDTKEGAFLKYNFGASFTNADLIAAVTLNNKFD  180

Query  641  FLGASYYHTV  670
             + ASYYHTV
Sbjct  181  SVSASYYHTV  190



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGK+A+DLL  DY +D KFT+TT S TGV +TS+G KKG+L +AD+NTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLNRDYQSDQKFTLTTCSPTGVTLTSTGTKKGDLFLADINTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K+KN+TTD KVDT S L+TT+T+DEPAPGLKTIISF  PDQ+SGK+ELQYLH+YAGIS+S
Sbjct  61   KHKNVTTDFKVDTGSNLFTTVTIDEPAPGLKTIISFKVPDQRSGKLELQYLHDYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV GNN  ++G+DVS+DT  G  TK N G SF+ +DLIASLTLND GD
Sbjct  121  VGLTANPIVNFSGVVGNNLFSVGSDVSYDTKEGALTKCNFGASFTNADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYHTV
Sbjct  181  SLSASYYHTV  190



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY +D KFTITTYS TGVAITSSG KKGEL VADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYRDYNSDQKFTITTYSPTGVAITSSGTKKGELFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN+NITTD+KVDT+S L TTITV+EPAPG+KT++SF  PDQ+SGKVE+QYLH+Y GI  S
Sbjct  61   KNRNITTDIKVDTDSNLSTTITVNEPAPGVKTVLSFRIPDQRSGKVEVQYLHDYFGIGAS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+++ SG  G N +ALG D+++DT  G+FTK N GL+F+  DL+ASLTL D GD
Sbjct  121  VGLTANPIINVSGTLGTNVIALGHDLTYDTKIGEFTKLNTGLNFTKDDLVASLTLTDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  VLNASYYHVV  190



>gb|KJB60740.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60741.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60743.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60744.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=175

 Score =   274 bits (701),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY  DHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+KVD+ S L+TT+T+DEPAPGLKTI SFV PDQKSG VELQY HEYAGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTL  625
            IGLTA PLVSFSGV GN+ +++GTD+SFDTA+G F K NAGL+ + SDLIAS+TL
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTL  175



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   277 bits (709),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K++N+TTD+KVDT+S L+TTITVDEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL L   GD
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALY-VGD  179

Query  641  FLGASYYHTV  670
             + ASYYH V
Sbjct  180  SVNASYYHIV  189



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY DY  D KF+ITTYSATGVA+TS G K+G+L   DV+T+L
Sbjct  1    MAKGPGLYTDIGKKARDLLYKDYQTDQKFSITTYSATGVALTSCGTKEGDLFFGDVSTKL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K  NITTD+KVDTNS L TTITVD  APGLKTI+SF  PDQ+SGK+ELQYLH+Y G+ TS
Sbjct  61   KKNNITTDIKVDTNSNLVTTITVDGAAPGLKTILSFKVPDQRSGKLELQYLHDYVGVCTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +G TA+P+V+FSGV G N +ALGTDVSFDT TG FTKYNAGLSF++ DLIA+LT ND G+
Sbjct  121  VGATANPIVNFSGVIGTNMVALGTDVSFDTKTGNFTKYNAGLSFASEDLIAALTFNDKGN  180

Query  641  FLGASYYHTV  670
             L AS+YH V
Sbjct  181  NLNASFYHYV  190



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   276 bits (705),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLL+ DY +D KF+ITTYS TGVAITSSG KKGEL +ADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFSITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDT S L+TTITV+EPAPG+K I+SF  PDQ SGKVELQYLH+YAG+S S
Sbjct  61   KNKNVTTDIKVDTESNLFTTITVNEPAPGVKAILSFKVPDQTSGKVELQYLHDYAGLSGS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
             GL A+P+V+ S V G N LA+G D+SFDT  G+ TK NAGLS++  DLIASLTLN+ GD
Sbjct  121  FGLKANPIVNLSSVVGTNVLAIGADLSFDTKLGELTKSNAGLSYAKDDLIASLTLNNKGD  180

Query  641  FLGASYYHTV  670
             L AS+YH V
Sbjct  181  ALNASFYHLV  190



>emb|CAJ42303.1| VDAC-like porin [Plantago major]
Length=250

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGK+A+DLLY DY  DHKFT+TT S TGV +TS+G KKG+L +AD+ TQL
Sbjct  22   MGKGPGLYTEIGKRARDLLYKDYQTDHKFTLTTTSPTGVTLTSAGTKKGDLFLADITTQL  81

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD KVDT+S L TTIT+DEP PG KTI+SF  PDQ+SGK+ELQYLH+YAGI+TS
Sbjct  82   KNKNITTDFKVDTSSNLLTTITIDEPCPGTKTILSFKVPDQRSGKLELQYLHDYAGITTS  141

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G  TLA G D+SFDT  G  TKYN G SFS  DLIASL LND GD
Sbjct  142  VGLTANPIVNFSGVLGTKTLAAGADLSFDTKEGALTKYNFGASFSNVDLIASLALNDKGD  201

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  202  TLSASYYHIVN  212



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   273 bits (697),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KFTITTYS TGVAITS+GVKKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGVKKGELFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN+TTD+KVDT+S L+TT TVDE APGLKTI+S   PDQ+SGK+E+QYLH+YA +S+S
Sbjct  61   KQKNVTTDIKVDTDSNLFTTTTVDELAPGLKTILSCKLPDQRSGKLEIQYLHDYAAVSSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GL  +P V+FSGV G N ++LGT++SFDT +G FTK NAG S+S +DLIASLTLND GD
Sbjct  121  VGLAPNPTVNFSGVIGTNVVSLGTELSFDTKSGNFTKCNAGFSYSNADLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYY  V
Sbjct  181  SLKASYYQIV  190



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 5/190 (3%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K++N+TTD+KVDT+S       +DEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KSRNVTTDIKVDTSSN-----AIDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  115

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+ GD
Sbjct  116  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  175

Query  641  FLGASYYHTV  670
             + ASYYH V
Sbjct  176  SVNASYYHIV  185



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLL+ DY  DHKFTITT +  GV ITS+GV+KGE  +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L TTITVDE  PGLKTI SF+ P+QKSGKVELQYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P V+ S V GNN +++G+DVSF+T++G   K N GL+ + +DLIASLT+ND GD
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLNASYYHVV  190



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   271 bits (692),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLYSDIGK+A+DLL+ DY  DHKFTITT +  GV ITS+GV+KGE  +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+TTD+KVDTNS L TTITVDE  PGLKTI SF+ P+QKSGKVELQYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLTA+P V+ S V GNN +++G+DVSF+T++G   K N GL+ + +DLIASLT+ND GD
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  SLNASYYHVV  190



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY  D KFT+TTYS TG+A+T+S  KKGEL +AD+NTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLYKDYNTDQKFTLTTYSPTGIALTASSTKKGELFLADINTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQ--KSGKVELQYLHEYAGIS  454
            K+KN+TTD+KVDT+S L+TTITV EPAPGLKTI+SF  P+   KSGK E+QYLH+YAGIS
Sbjct  61   KHKNVTTDIKVDTDSNLFTTITVTEPAPGLKTILSFRIPEPELKSGKAEVQYLHDYAGIS  120

Query  455  TSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDX  634
             SIGLTA+P+ +FSGV GNN +ALG D+S+DT TG FT+ NAGL+F+  DLIASLTLN+ 
Sbjct  121  ASIGLTANPVANFSGVIGNNVVALGGDLSYDTKTGVFTRLNAGLNFTKDDLIASLTLNEK  180

Query  635  GDFLGASYYHTV  670
             + L ASYYH V
Sbjct  181  ANALNASYYHVV  192



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  149  DLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSK  328
            DLL+ DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQLKNKNITTD+KVDT S 
Sbjct  8    DLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQLKNKNITTDIKVDTGSN  67

Query  329  LYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAG  508
            L+TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G
Sbjct  68   LFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVG  127

Query  509  NNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGASYYHTV  670
             N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+N+ GD L ASYYHTV
Sbjct  128  TNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHTV  181



>emb|CAN67632.1| hypothetical protein VITISV_019646 [Vitis vinifera]
Length=175

 Score =   266 bits (681),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY +DHK TIT+ S TGVAITSSG KKG++ VADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITTD+K+DT+S L+ T+TVDEPAPGLK+I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTL  625
            IGLTA+P+V+FSG  G N +ALGTD+SFDT +G FTK NAG+SF  +DLIASLT+
Sbjct  121  IGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNFTKCNAGVSFCNADLIASLTV  175



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D K ++TTYS+TGVAIT++G  KG+L V DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTASP+V+FSGV GNN LALGTDVSF+T +G F ++NAG SF+  DLIA+LTLND GD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY+D+GKKA+DL+Y D+ +D KF+I+TYS TGVAITS+G+KKGELLV DV  Q 
Sbjct  1    MVKGPGLYTDVGKKARDLIYKDHNSDQKFSISTYSPTGVAITSTGIKKGELLVGDVAFQS  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN+TTDLKV T+S +  T TVDE APGLK+I SF  PDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLVTATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA+GTDVSFDT +G FTK N GLSF   DLIASLTLN+ GD
Sbjct  121  MGLTQNPTVNFSGVIGTNALAIGTDVSFDTKSGNFTKINGGLSFIKEDLIASLTLNEKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  LLNASYYHHVN  191



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D K ++TTYS+TGVAIT++G  KG+L V DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTASP+V+FSGV GNN LALGTDVSF+T +G F ++NAG SF+  DLIA+LTLND GD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY D+ +D KF+ITT+S  GVAITS+G KKG+LL+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            + KNITTDLKV T+S    T TVDE APGL++I SF  PDQ SGKVELQYLHEYAGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G+N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+ND GD
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  LLNASYYHIV  190



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY D+ +D KF+ITT+S  GVAITS+G KKG+LL+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            + KNITTDLKV T+S    T TVDE APGL++I SF  PDQ SGKVELQYLHEYAGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G+N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+ND GD
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  LLNASYYHIV  190



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D K ++TTYS+TGVAIT++G  KG+L V DV+TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVSTQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTASP+V+FSGV GNN LALGTDVSF+T +G F  +NAG SF+  DLIA+LTLND GD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGGFKHFNAGFSFTKDDLIAALTLNDKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +2

Query  92   EGEMVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVN  271
            E  MVKGPGLY++IGKKA+DLLY D+ +D KF+ITTYS  GVAITSSG KKG+LL+ DV 
Sbjct  31   EATMVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVA  90

Query  272  TQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGI  451
             Q + KN+TTD KV T+S +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGI
Sbjct  91   FQSRQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGI  150

Query  452  STSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLND  631
            STS+GLT +P V+FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+
Sbjct  151  STSMGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNE  210

Query  632  XGDFLGASYYHTV  670
             GD L ASYYH V
Sbjct  211  KGDLLNASYYHIV  223



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY+DIGKKA+DLLY DY +D KFTI+TYS TGVAITSSG KKG L + DVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGFLELGDVNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKNITT +KVDTNS L+TTITV+EPAPG+K I+S   P+Q+SGK+E QYLHEYAG++ S
Sbjct  61   KNKNITTQIKVDTNSNLFTTITVNEPAPGVKAILSEKVPEQRSGKLEFQYLHEYAGVNAS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GL ++P+V+ SG  G+  L++G DVSFDTAT  FTKYNA ++F    LI SLTLN+ GD
Sbjct  121  VGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAAVNFVKDSLIGSLTLNEKGD  180

Query  641  FLGASYYHTV  670
             L ASYYH +
Sbjct  181  LLSASYYHAI  190



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKK +DLL  DY  D KF+ T+Y++TG+A TS+G+KKGE  + D+NTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLNKDYNFDQKFSFTSYTSTGLAFTSTGIKKGEFFLGDLNTQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN N+TTD+KVDT+S L+ T+T+DEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAG+STS
Sbjct  61   KNNNVTTDIKVDTSSNLFATVTIDEPAPGLKTILSFTVPDQRSGKVELQYLHDYAGVSTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT SP+  FSGV GN+T ++G +VSFDTA+G F KY+AGLSFS  D ++SLTL   GD
Sbjct  121  IGLTPSPITHFSGVIGNDTFSVGGEVSFDTASGNFLKYDAGLSFSKPDFVSSLTLTGKGD  180

Query  641  FLGASYYHTV  670
             L ASY HTV
Sbjct  181  TLKASYLHTV  190



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY D+ +D K +ITTYS  GVAITS+G KKGE L+ DV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTD KV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV GNN LALGTDVSFDT +G FTK NAGL+F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   265 bits (677),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY D+ +D K +ITTYS  GVAITS+G KKGE L+ DV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTD KV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV GNN LA+GTDVSFDT +G FTK NAGL+F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVIGNNALAVGTDVSFDTKSGNFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY+DIGKK +DLLY D+ +DHK +ITT+S  GVAITS+G KKG+LL+ DV  QL
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVTFQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTDL+V T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA GTDVSFDT +G FTK NAG++F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT TVDEP PG+K I++   PDQKSGK+ELQYLH+YAGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILTAKLPDQKSGKLELQYLHDYAGIATS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT SP V+FSGV G N LALGTDVSF+T +G F  +NAGLSF+  DLIASLTLND G+
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGE  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT TVDEP PG+K I+S   PDQKSGK+ELQY H+YAGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILSAKLPDQKSGKLELQYFHDYAGIATS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT SP V+FSGV G N LALGTDVSF+T +G F  +NAGLSF+  DLIASLTLND G+
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGE  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  KLNASYYHIV  190



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKAKDLLY D+ +D KF+ITT S  GV ITSSG KKG+ L+ DV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTDLKV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FS V G N LA GTDVSFDT +G FTK NAGLSF+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY D+ +D KF+ITT+S  GVAITS+G KKG+LL+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            + KNITTDLKV T+S +  T TVDE APGLK+I SF  PDQ SGK+ELQYLH+YAGISTS
Sbjct  61   RQKNITTDLKVCTDSTVLITATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+ GD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGD  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  LLNASYYHIVN  191



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPG Y+DIGKKA+DLLY D+ +D K +ITT+S  GVAITS+G KKG+ L+ DV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LALGTDVSFDT +G FTK NAG++F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTV  670
             + ASYYH V
Sbjct  181  SVNASYYHIV  190



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPG Y+DIGKKA+DLLY D+ +D K +ITT+S  GVAITS+G KKG+ L+ DV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LALGTDVSFDT +G FTK NAG++F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKA+DLLY D+ +D K +ITTYS  GVAITS+G KKGE L+ D   QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDGGFQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTD KV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV GNN LALGTDVSFDT +G FTK NAGL+F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY D+ +D KF+ITTYS  GVAITSSG KKG++L+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN+TTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+E+QYLH+YAGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+  D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  LLNASYYHIV  190



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY+DIGKKAKDLLY D+ +D KF+ITT S  GV ITSSG KKG+ L+ DV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTDLKV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FS V G N LA GTDVSFDT +G FTK NAGLSF+  DL+ASLTLND GD
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLVASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY D+ +D KF+ITTYS  GVAITSSG KKG++L+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN+TTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+E+QYLH+YAGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+  D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  LLNASYYHIV  190



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = +2

Query  92   EGEMVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVN  271
            E +MVKGPGLY+DIGKKA+DLLY D+ +D K +ITTYS  GVAITS+G KKG+LL+ DV 
Sbjct  63   EAKMVKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGDLLLGDVA  122

Query  272  TQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGI  451
             Q K KNITTD KV T+S +  T TVDE APGLK+I SF  PDQ SGK+ELQYLH+YAGI
Sbjct  123  FQSKQKNITTDFKVCTDSTVLITATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGI  182

Query  452  STSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLND  631
            STS+GLT +P V+FSGV G+N +ALGTDVSFDT +G FTK NAGLSF+  DLIASLTLN+
Sbjct  183  STSMGLTQNPTVNFSGVIGSNVVALGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTLNE  242

Query  632  XGDFLGASYYHTV  670
             GD +  SYYH V
Sbjct  243  KGDAMNLSYYHIV  255



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   261 bits (666),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 150/190 (79%), Gaps = 21/190 (11%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLYSDIGKKA+DLLY DY ADHKFT+TTY++ GVAITS+G+KKGELL+AD     
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLAD-----  55

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
                            L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  56   ----------------LFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  99

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGL A+PLV+FSGV GNN +++GTD+SFDT +G FTK NAGL+F+ SDLIASLTLND GD
Sbjct  100  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGD  159

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  160  TLNASYYHIV  169



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY D+ +D KF+ITTYS  GVAITS+G KKG++L+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSTGTKKGDVLLGDVAFQS  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            + KN+TTD KV T+S +  T TVDE APGLK+I SF APDQ SGK+E+QYLHEYAGISTS
Sbjct  61   RQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHEYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA+GTD+SFDT +G FTK NAGLSF+  DLIASLT+N+  D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDISFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  641  FLGASYYHTV  670
             L ASYYH V
Sbjct  181  LLNASYYHIV  190



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY+DIGKK +DLLY D+ +DHK +ITT+S  GVAITS+G KKG+LL+ DV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTDL+V T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA GTDVSFDT +G FTK NAG++F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   260 bits (665),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D K +ITTYSA+GVAIT+SG  KG+L +ADV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSASGVAITTSGTNKGDLFLADVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNK  T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGISTS
Sbjct  61   KNKKFTADIKVATDSSLLTTFTYDEATPGLKAILSAKLPDQKSGKVELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G N LALG DVSF+T +G F  +NAG SF+  DLIASLTLND G+
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGADVSFNTESGNFKHFNAGFSFTKDDLIASLTLNDKGE  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY+ D KFT+TTY++ GVAIT+SG KK E +  ++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K +++S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++  IG
Sbjct  62   NITVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SGV G   L++G DVSFDTA+G FTKYNAGLS + +DLIA+LTLN+ GD L
Sbjct  122  LTANPIVNLSGVVGTKALSVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  SASYYHLV  189



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY+DIGKK +DLL+ D+ +DHK +ITT S  GVAITS+G KKG+LL+ DV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLFKDHNSDHKLSITTQSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KNITTDL+V T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT +P V+FSGV G N LA GTDVSFDT +G FTK NAG++F+  DLIASLTLND GD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  641  FLGASYYHTVR  673
             + ASYYH V 
Sbjct  181  SVNASYYHIVN  191



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY+ D KFT+TTY+++GVAIT+SG KK E +  ++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYRDYLTDQKFTVTTYTSSGVAITASGTKKNEFIFGEIQSQLKKK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K ++ S L TT+TVDE A PGL+TI SFV P+Q+SGKVELQYLH+YAG++TSIG
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLRTIFSFVVPEQRSGKVELQYLHDYAGVNTSIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SGV G    A+G DVSFDTA+G FTKYNAGLS + +DLIA+LTLN+ GD L
Sbjct  122  LTANPIVNLSGVFGTKGFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  647  GASYYH  664
             ASYYH
Sbjct  182  SASYYH  187



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT TVDEP PG+K I+S   PDQKSGK+ELQYLH+YAGISTS
Sbjct  61   KNKNFTADIKVSTDSSLVTTFTVDEPTPGVKAILSARLPDQKSGKLELQYLHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT SP V+FSGV G N LALGTDVSF+T +G F  +NAGLSF+  DLIASL L+D G+
Sbjct  121  VGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKEDLIASLILSDKGE  180

Query  641  FLGASYYHTV  670
             L ASYY  V
Sbjct  181  KLNASYYQIV  190



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT T+DEP PG+K I S   PDQKSGK ELQYL++YAGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTLDEPTPGVKAIFSAKLPDQKSGKFELQYLNDYAGIATS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            + LT SP+V+FSGV G N +ALGTDVSF+T +G F  +NAG+SF+  DLIASLTLND G+
Sbjct  121  LSLTGSPIVNFSGVVGTNVVALGTDVSFETESGNFKHFNAGVSFTKDDLIASLTLNDKGE  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY+ D KFT+TTY++TGVAIT+SG KK E +  ++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSTGVAITASGTKKTEFIFGEIQSQLKKK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K ++ S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++TSIG
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNTSIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ S V G    A+G DVSFDTA+G FTKYNAGLS + +DLIA+LTLN+ GD L
Sbjct  122  LTANPIVNISSVFGTKAFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  647  GASYYHTV  670
              SYYH V
Sbjct  182  SGSYYHLV  189



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IG+KA+DLLY DY+ D KFT+TTY++ GVAIT+SG KK E +  ++ +QLKNK
Sbjct  2    GPGLYSEIGRKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NI+ D+K +++S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++  IG
Sbjct  62   NISVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SGV G   L++G DVSFDTA+G FTKYNAGLS   +DLIA+LTLN+ GD L
Sbjct  122  LTANPIVNLSGVVGTRGLSVGADVSFDTASGNFTKYNAGLSVINADLIAALTLNNKGDSL  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  SASYYHLV  189



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  107  KGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  286
            KGPGLY+DIGKKA+DLL+ DY +D KFT++TYS TGVAITSSG KKGEL V DVNTQLKN
Sbjct  4    KGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLKN  63

Query  287  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            KN T D+KVDT S L+TTITV EPAPG+K IIS   PD  SGKVELQYLH+YAGIS +IG
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L A+P+V+ SGV G N LA G D+S+DT   + TK N G+SF   DL+ +LTLN+ GD L
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVL  183

Query  647  GASYYHTV  670
             ASYYH +
Sbjct  184  NASYYHVI  191



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  107  KGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  286
            KGPGLY+DIGKKA+DLL+ DY +D KFT++TYS TGVAITSSG KKGEL V DVNTQLKN
Sbjct  4    KGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLKN  63

Query  287  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            KN T D+KVDT S L+TTITV EPAPG+K IIS   PD  SGKVELQYLH+YAGIS +IG
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L A+P+V+ SGV G N LA G D+S+DT   + TK N G+SF   DL+ +LTLN+ GD L
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVL  183

Query  647  GASYYHTV  670
             ASYYH +
Sbjct  184  NASYYHVI  191



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D K +ITTYS+TGV+IT+SG  KG+L V DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVSITTSGTNKGDLFVGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV ++S + TT T DE  PGLKTI+S   PDQKS KVELQYLH +AGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKTIVSAKVPDQKSAKVELQYLHPHAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G + LALGTDVSFDT +G F  +NAG+SF+  DLIASLTLND G+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNAGVSFTKDDLIASLTLNDKGE  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  DHK T+TT S TGV IT++G+ KG L V DV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDHKLTVTTSSETGVVITTTGINKGNLFVGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T DLKV T+S L TT+T DE APGLKTI+S   PDQKSGK+ELQYLH+YAGI TS
Sbjct  61   KNKNFTADLKVATDSSLLTTLTYDEAAPGLKTILSAKLPDQKSGKLELQYLHDYAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P V+F+GV G N LALGTD SF+T TG     N GLSF+  DLIASL LND G+
Sbjct  121  VGLTANPTVNFAGVVGTNILALGTDASFNTETGNLKHLNFGLSFTKDDLIASLNLNDKGE  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 147/180 (82%), Gaps = 5/180 (3%)
 Frame = +2

Query  131  IGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLK  310
            IGKKA+DLLY DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQLK++N+TTD+K
Sbjct  84   IGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIK  143

Query  311  VDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVS  490
            VDT+S       +DEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+
Sbjct  144  VDTSSN-----AIDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVN  198

Query  491  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGASYYHTV  670
            FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+ GD + ASYYH V
Sbjct  199  FSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIV  258



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  107  KGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  286
            KGPGLY++IGKKA+DLL+ DY +D KFT++TYS TGVAITSSG KKGEL V DVNTQLKN
Sbjct  4    KGPGLYTNIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGAKKGELFVGDVNTQLKN  63

Query  287  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            KN T D+KVDT S L+TTITV EPAPG+K IIS   PD  SGKVELQYLH+YAGIS +IG
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L A+P+V+ SGV G N LA G D+S+DT   + TK N G+SF   DL+ +LTLN+ GD L
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVL  183

Query  647  GASYYHTV  670
             ASYYH +
Sbjct  184  NASYYHVI  191



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY  D KFT+ TY+A GVAIT+SG KK EL+  ++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYHTDQKFTVATYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K +++S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH++ G++ SIG
Sbjct  62   NITVDVKANSDSNLSTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDHGGVNASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SGV G + +A+G DVSFDTA G F K NAGLS + +DLIASLT+ND GD +
Sbjct  122  LTANPIVNLSGVVGTDAVAVGADVSFDTANGDFIKCNAGLSITNADLIASLTVNDKGDCV  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  NASYYHLV  189



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT+T DEPAPGLK I+    PD KSGK E+QY H+YA ISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAAISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +G TASP+V+FSGV G N LALGTDV+F+T +G F  +NAGL+F+  DLIASL LN+ G+
Sbjct  121  VGFTASPIVNFSGVVGTNVLALGTDVAFNTESGNFKHFNAGLNFTKDDLIASLILNEKGE  180

Query  641  FLGASYYHTV  670
             L ASYY  V
Sbjct  181  KLNASYYQIV  190



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGK+A+DLLY DY  D KFT+TTY+A GVAIT+SG KK EL+  ++ +QLKNK
Sbjct  2    GPGLYSEIGKQARDLLYKDYQTDQKFTVTTYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K  ++S L T + VDE A PGLKTI SFV PDQ+SG+VELQY H++AG++ SIG
Sbjct  62   NITVDVKAGSDSNLSTKVAVDELATPGLKTIFSFVLPDQRSGQVELQYQHDHAGVNASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+VS SGV G N +A+G DVSFDTA G F KYNAGLS + +DLIASLT+ND GD +
Sbjct  122  LTANPIVSLSGVVGTNAVAVGADVSFDTAVGDFIKYNAGLSITNADLIASLTVNDKGDSV  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  NASYYHLV  189



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   252 bits (643),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY  DHKFT+TT ++ GVAIT++G +K +L+  ++ +Q+KNK
Sbjct  2    GPGLYSEIGKKARDLLYRDYQTDHKFTVTTCTSNGVAITATGTRKNDLIFGEIQSQIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K +++S + TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  62   NVTFDVKTNSDSNVTTTVTVDELATPGLKTIFSFVIPDQRSGKVELQYLHDYAGVNASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SGV G+  +++G DV+FDTATG F KYNAGLS + +DLIASLTLN+ GD L
Sbjct  122  LTANPVVNLSGVVGSKNVSVGADVAFDTATGNFIKYNAGLSITNTDLIASLTLNNKGDSL  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  SASYYHLV  189



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY +IGKKA+DLLY DY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQYLH+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYLHDYAGVSASIGL  122

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TA+P+V+ S V G   LA+G DVS DTATG  TKYNAGLSF+  DLIASL LN+ GD L 
Sbjct  123  TANPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFTNDDLIASLNLNNKGDSLT  182

Query  650  ASYYHTV  670
            ASYYH V
Sbjct  183  ASYYHIV  189



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY +IGKKA+DLLY DY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQY H+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TASP+V+ S V G   LA+G DVS DTATG  TKYNAGLSFS  DLIASL+LN+ GD L 
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLSLNNKGDSLT  182

Query  650  ASYYHTVR  673
            ASYYH V 
Sbjct  183  ASYYHIVN  190



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY +IGKKA+DLLY DY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQY H+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TASP+V+ S V G   LA+G DVS DTATG  TKYNAGLSFS  DLIASL LN+ GD L 
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLT  182

Query  650  ASYYHTV  670
            ASYYH V
Sbjct  183  ASYYHIV  189



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY +IGKKA+DLLY DY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQY H+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TASP+V+ S V G   LA+G DVS DTATG  TKYNAGLSFS  DLIASL LN+ GD L 
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLT  182

Query  650  ASYYHTV  670
            ASYYH V
Sbjct  183  ASYYHIV  189



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D K +ITTYS+TGVAIT+SG  KG+L + DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV ++S + TT T DE  PGLK I+S   PDQKS KVELQY+H +AGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G + LALGTDVSFDT +G F  +N G+SF+  DLIASLTLND G+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGE  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLTASYYHIVN  191



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   249 bits (637),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D KF++TTYS+TGVAIT++G  KG L + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV T+S L TT+T DEPAPGLK I+    PD KSGK E+QY H+YAGISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +G TA+P+V+FSGV G N L+LGTDV+++T +G F  +NAG +F+  DL ASL LND G+
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGE  180

Query  641  FLGASYYHTV  670
             L ASYY  V
Sbjct  181  KLNASYYQIV  190



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGLY++IGKKA+DLLY DY  D K +IT YS+TGVAIT+SG  KG+L + DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITAYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN T D+KV ++S + TT T DE  PGLK I+S   PDQKS KVELQY+H +AGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLTA+P+V+FSGV G + LALGTDVSFDT +G F  +N G+SF+  DLIASLTLND G+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGE  180

Query  641  FLGASYYHTVR  673
             L ASYYH V 
Sbjct  181  KLNASYYHIVN  191



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 147/190 (77%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MVKGPGLY++IGKKA+DLLY DY  D KF++TTYS+TGVAIT++G  KG L + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KN N T D+KV T+S L TT+T DEPAPGLK I+    PD KSGK E+QY H+YAGISTS
Sbjct  61   KNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +G TA+P+V+FSGV G N L+LGTDV+++T +G F  +NAG +F+  DL ASL LND G+
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGE  180

Query  641  FLGASYYHTV  670
             L ASYY  V
Sbjct  181  KLNASYYQIV  190



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   246 bits (629),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 142/175 (81%), Gaps = 5/175 (3%)
 Frame = +2

Query  146  KDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNS  325
            KDLLY DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQLK++N+TTD+KVDT+S
Sbjct  3    KDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIKVDTSS  62

Query  326  KLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVA  505
                   +DEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV 
Sbjct  63   N-----AIDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVL  117

Query  506  GNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGASYYHTV  670
            G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+ GD + ASYYH V
Sbjct  118  GTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIV  172



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY  DHKFT+TT +A GVAIT+SG +K +++  ++ +Q+KN 
Sbjct  2    GPGLYSEIGKKARDLLYKDYQTDHKFTVTTCTANGVAITASGTRKNDIIFGEIQSQIKNN  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K +++S + TT+T++E A PGLKTI SFV PDQ+SGKVEL YLH+YAG++ SIG
Sbjct  62   NITFDVKTNSDSNVTTTVTINELATPGLKTIFSFVIPDQRSGKVELHYLHDYAGVNASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+FSGV G+ T+++G DV+FDTATG F KYNA LS + +DLIA+L LN+ GD L
Sbjct  122  LTANPVVNFSGVVGSKTVSVGADVAFDTATGNFIKYNASLSITNADLIAALALNNKGDSL  181

Query  647  GASYYHTVR  673
             ASYYH V 
Sbjct  182  SASYYHLVN  190



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS IGKKAKDLLY DY  DHKFT+TTY+A G AIT++  KK +L V ++ +Q+KNK
Sbjct  3    GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K ++ S + TTIT D+  APGLKTI+SF  PDQKSGKVELQYLH+YAGI+ SIG
Sbjct  63   NITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVELQYLHDYAGINASIG  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SG  G + LA+G DVS DTAT  F KYNA LS++  DLIASL LN+ GD L
Sbjct  123  LTANPVVNLSGAFGTSALAVGADVSLDTATKNFAKYNAALSYTNQDLIASLNLNNKGDSL  182

Query  647  GASYYHTVR  673
             ASYYH V 
Sbjct  183  TASYYHIVE  191



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   244 bits (624),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK +DLLY DY  DHKFT+TTY++ GVA+T++  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTSNGVAVTATSTKKADLIIGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K +++S + TT+T+DE A PGLK I+SF  PDQ+SGK ELQYLH+YAG++ SIG
Sbjct  63   NITVDVKANSDSNVITTVTIDEVATPGLKAILSFAVPDQRSGKFELQYLHDYAGVNASIG  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            +TA+P+V+ SG  G   LA+G D+S DTATG FTKYNAGLS +  DLIASL LN+ GD L
Sbjct  123  MTANPIVNLSGSFGTKALAVGADISLDTATGNFTKYNAGLSVTHEDLIASLNLNNKGDSL  182

Query  647  GASYYHTV  670
             A+YYH+V
Sbjct  183  TAAYYHSV  190



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK KDLLY DY  DHKFT+TTY++ GVA+T+S  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYAEIGKKTKDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLIFGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NIT D+K ++ S + TT+TVDE A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  63   NITVDVKANSESNIITTVTVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ S   G   LA+G DVS DTATG  TKYN+GL F+  DLIASL+LN+ GD L
Sbjct  123  LTANPVVNLSAAFGTKALAVGADVSLDTATGNLTKYNSGLRFTHEDLIASLSLNNRGDSL  182

Query  647  GASYYHTV  670
              +YYH V
Sbjct  183  TGAYYHKV  190



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK +DLLY DY  DHKFT+TTY+A GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTANGVAITATSSKKADLIFGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S + TT+TVDE  APGLKTI SF  PDQ+SGK+ELQYLH+YAGI+ SIG
Sbjct  63   GVTVDVKANSASNVITTVTVDELAAPGLKTIFSFAIPDQRSGKLELQYLHDYAGINASIG  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SG  G N LA+G DVS DTAT  FTKYNAGLSF+  DL ASL LN+ GD L
Sbjct  123  LTANPVVNLSGSFGTNALAVGADVSLDTATKNFTKYNAGLSFTNDDLTASLNLNNKGDSL  182

Query  647  GASYYHTVR  673
             ASYYH V 
Sbjct  183  TASYYHFVE  191



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY +IG+KA++LLY DY  DHK T+TT ++ GV IT+SG +K +L+  ++ + +KNK
Sbjct  2    GPGLYFEIGRKARELLYRDYQTDHKVTVTTCTSNGVEITASGTRKNDLIFGEIQSHIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K +++S + TTIT+DE A PGLKTI SFV PDQ+SGKVE+QYLH+Y GI+ SIG
Sbjct  62   NVTFDVKTNSDSNVTTTITIDELASPGLKTIFSFVVPDQRSGKVEIQYLHDYTGINASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SG  G+ TL++G DV+FDT TGKF KYNAGLS + +DLIA+LTLN+ GD L
Sbjct  122  LTANPVVNLSGAVGSKTLSVGADVAFDTTTGKFIKYNAGLSITNADLIAALTLNNRGDSL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  TASYYHLVK  190



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK +DLLY DY  DHKFT+TTY++ GVA+T+S  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S + TTITVDE A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ S   G   +ALG D+S DTATG  TKYNA L F+  DL+ASL LN+ GD L
Sbjct  123  LTANPVVNLSAAFGTKAVALGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSL  182

Query  647  GASYYHTV  670
              +YYH V
Sbjct  183  TGAYYHKV  190



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK +DLLY DY  DHKFT+TTY++ GVA+T+S  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S + TTITVDE A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ S   G   +A+G D+S DTATG  TKYNA L F+  DL+ASL LN+ GD L
Sbjct  123  LTANPVVNLSAAFGTKAVAVGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSL  182

Query  647  GASYYHTV  670
              +YYH V
Sbjct  183  TGAYYHKV  190



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYSDIGKKA+DLLY DY  D K T+TTY+  G+AI++SG KK EL+  ++ +QLKNK
Sbjct  2    GPGLYSDIGKKARDLLYKDYQTDQKVTLTTYTLNGIAISASGTKKNELIFGELQSQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            NI+ D+K  ++SKL TT+TVDE A PGL++I +F+ PDQ+ GKVELQYLH+Y G++ ++G
Sbjct  62   NISFDVKATSDSKLLTTVTVDELATPGLRSIFNFIIPDQQLGKVELQYLHDYVGVTAAVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+V+ SGV G N  ++G DVSFDTATG F K N GLS   +DLIASLT+ND GD +
Sbjct  122  LTANPIVNLSGVVGTNVYSVGADVSFDTATGNFIKCNGGLSVINADLIASLTVNDKGDSI  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  NASYYHLV  189



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYSD+ K+A+DLLY DY  D KFTITT +  GV+IT+SG KK EL+  ++ +Q KN 
Sbjct  2    GPGLYSDVAKRARDLLYKDYQTDQKFTITTSTLNGVSITTSGTKKNELIFGELQSQWKNN  61

Query  290  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  469
            NI+ D+K  ++SK  TT+TVDE  PGL++I S + PDQ+SGKVELQYLH YAG++  IGL
Sbjct  62   NISVDVKATSDSKFATTVTVDELTPGLRSIFSVIIPDQRSGKVELQYLHNYAGVTAGIGL  121

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
            TA+P+V+ SGV G NT A+G DVSFDTATG F K N GL+   +DLIASLT+ND GD + 
Sbjct  122  TANPVVNLSGVVGTNTYAVGADVSFDTATGNFIKCNGGLNVINADLIASLTVNDKGDSVT  181

Query  650  ASYYHTV  670
            ASYYH V
Sbjct  182  ASYYHLV  188



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK +DLLY DY  DHKFT+TTYS+ GVA+T++  KK +L+ +++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S + TT+TV+E A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ S+ 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+ + S   G   LA+G ++SFD+ATG FTKYNAGL F+  DLIASL +N+ GD L
Sbjct  123  LTANPVANLSAAFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNL  182

Query  647  GASYYHTV  670
              +YYH V
Sbjct  183  TGAYYHKV  190



>gb|KCW56275.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=260

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  ITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPD  400
            +TS+G KKGEL +ADVNTQLKNKNITTD+KVDT+S L+TTITVDEPAPGLK+I SF  PD
Sbjct  25   LTSTGTKKGELFLADVNTQLKNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPD  84

Query  401  QKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNA  580
            Q+SGK+ELQYLHE+AGIS+SIGLTA+P+V+FSGV G + LALGTDVSFDT +G F K NA
Sbjct  85   QRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDFAKCNA  144

Query  581  GLSFSTSDLIASLTLNDXGDFLGASYYHTV  670
            GLSFS +DLIASLT+ND GD L ASYYH V
Sbjct  145  GLSFSNADLIASLTVNDKGDTLAASYYHLV  174



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK +DLLY DY  DHKFT+TTYS+ GVA+T++  KK +L+ +++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S + TT+TV+E A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ S+ 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            LTA+P+ + S   G   LA+G ++SFD+ATG FTKYNAGL F+  DLIASL +N+ GD L
Sbjct  123  LTANPVANLSAGFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNL  182

Query  647  GASYYHTV  670
              +YYH V
Sbjct  183  TGAYYHKV  190



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS IGKKAKDLLY DY  DHKFT+TTY+A G AIT++  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKV-ELQYLHEYAGISTSI  463
            NIT D+K ++ S + TTIT D+  APGLKTI+SF  PDQKSGKV ELQYLH+YAGI+ SI
Sbjct  63   NITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGINASI  122

Query  464  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDF  643
            GLTA+P+V+ SG  G + LALG DVS DTAT  FTKYNA LS++  DLIASL LN+ GD 
Sbjct  123  GLTANPVVNLSGAFGTSALALGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNKGDS  182

Query  644  LGASYYHTVR  673
            L ASYYH V 
Sbjct  183  LTASYYHIVE  192



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+AGI+ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L  +P+V+ SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  TASYYHLVK  190



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+AGI+ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L  +P+V+ SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  TASYYHLVK  190



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+AG++ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGVNASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L  +P+V+ SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  TASYYHLVK  190



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY   HKFT+TT +  GV IT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYGTHHKFTLTTCTPEGVTITAAGTRKNESVFGELQTQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TT+TVDE   PGLK+I+S V PDQ+SGK+ELQYLHEYAGI+ S+G
Sbjct  62   KLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SGV G+  L++G DV+FDTAT  FTKYNA LS + SDLIASL LN+ GD L
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  IASYYHLVK  190



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+A ++ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFASVNASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L  SP+V+ SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L
Sbjct  122  LNPSPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLAYPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  TASYYHLVK  190



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS IGKKAKDLLY DY  DHKFT+TTY+A G AIT++  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQIKNK  62

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKV-ELQYLHEYAGISTSI  463
            NIT D+K ++ S + TTIT D+  APGLKTI+SF  PDQKSGKV ELQYLH+YAGI+ SI
Sbjct  63   NITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGINASI  122

Query  464  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDF  643
            GLTA+P+V+ SG  G + LA+G DVS DTAT  FTKYNA LS++  DLIASL LN+ GD 
Sbjct  123  GLTANPVVNLSGAFGTSALAVGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNKGDS  182

Query  644  LGASYYHTVR  673
            L ASYYH V 
Sbjct  183  LTASYYHIVE  192



>ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Oryza brachyantha]
Length=275

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KFT+TT ++ GVA+T++G +K E +  +++TQLKNK
Sbjct  2    APGLYADIGKKTRDLLYKDYGTHQKFTLTTCTSEGVAVTAAGTRKNESVFGELHTQLKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S L TT+TVDE   PGLK+I+S V PDQ+SGK+ELQYLHEYAGI+ S+G
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SGV G+  L++G DV+FDTAT  FTKYNA LS + S+LIAS+ LN+ GD L
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSELIASMHLNNHGDTL  181

Query  647  GASYYHTVR  673
              SYYH V+
Sbjct  182  TTSYYHLVK  190



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KF++TT S  GVAIT++G +K E L  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSVTTCSPHGVAITAAGTRKNESLFGELHTQIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TTITVDE   PGLK+I+S V PDQ+SGK+ELQYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGVNASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD +
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTM  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  VASYYHLVK  190



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KFT+TT +  GVAIT++G +K E +  ++ TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K ++ S L TT+TVDE   PGLK+I+S V PDQ+SGK+E QYLHE+AGI+ ++G
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLEFQYLHEFAGINANVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L  +P+V+ SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  TASYYHLVK  190



>ref|XP_006298184.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31082.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=267

 Score =   229 bits (584),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +2

Query  164  DYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTI  343
            D+ +D KF+ITTYS  GVAITSSG KKG+LL+ DV  Q + KN+TTD KV T+S +  T 
Sbjct  13   DHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVAFQSRQKNVTTDFKVCTDSTVLITA  72

Query  344  TVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLA  523
            TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA
Sbjct  73   TVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLA  132

Query  524  LGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGASYYHTV  670
            +GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+ GD L ASYYH V
Sbjct  133  VGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIV  181



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KF++TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGVAITAAGTRKNESIFGELHTQIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TTITVDE   PGLK+I+S V PDQ+SGK ELQYLHEYAG++ SIG
Sbjct  62   KLTVDIKANSESDLLTTITVDELGTPGLKSILSLVVPDQRSGKFELQYLHEYAGVNASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L  +P+V+ SGV G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ GD L
Sbjct  122  LNPNPMVNISGVFGSKALSVGVDVSFDTATSNFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
              SYYH V+
Sbjct  182  VGSYYHLVK  190



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KF++TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SG  G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ GD L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  VASYYHLVK  190



>gb|KDO82799.1| hypothetical protein CISIN_1g0238541mg, partial [Citrus sinensis]
Length=162

 Score =   223 bits (568),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  218  AITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAP  397
            AITSSGVKKGEL +ADV+TQLKNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ P
Sbjct  28   AITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVP  87

Query  398  DQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYN  577
            DQ+SGKVELQY HEYAGIST IG TA+P+V+FSGV GNN++ALGTD+SFDTATG FTK N
Sbjct  88   DQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCN  147

Query  578  AGLSFSTSDLIASLT  622
            AGLS++ +DLIASLT
Sbjct  148  AGLSYTHTDLIASLT  162



>gb|ACG45954.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KF +TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SG  G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ GD L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  VASYYHLVK  190



>sp|P42057.1|VDAC_MAIZE RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Zea mays]
 emb|CAA51828.1| porin [Zea mays]
Length=277

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            MV   GLY+DIGKK +DLLY DY    KF +TT S  GVAIT++G +K E +  +++TQ+
Sbjct  1    MVVAVGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQI  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGIST  457
            KNK +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ 
Sbjct  61   KNKKLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNA  120

Query  458  SIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXG  637
            S+GL ++P+V+ SG  G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ G
Sbjct  121  SVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHG  180

Query  638  DFLGASYYHTVR  673
            D L ASYYH V+
Sbjct  181  DTLVASYYHLVK  192



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KF++TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SG  G+  L++G DVSFDTA+  FTKYNA LS ++ DLIASL LN+ GD L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTASSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  VASYYHLVK  190



>ref|XP_004969745.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Setaria italica]
Length=275

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYSDIGKKA+DLL  D+  D KFT+TTY++ G AIT++  KK E + +++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLNKDFHTDQKFTLTTYTSNGAAITAASTKKNEAIFSEIQAQLKQK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K  T+S L TT+TV+E   PGLK I++   P+Q +GK E+QYLH+YAGI+ S G
Sbjct  62   NVTVDVKATTDSLLLTTVTVEEFGVPGLKKIVTIPFPNQAAGKAEVQYLHDYAGINASFG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L + PLV+ SGV G   +A+G DV++DTATG FTKYNAGL+F+ +DLIAS+TLN+ GD L
Sbjct  122  LNSKPLVNLSGVFGTKAIAVGADVAYDTATGDFTKYNAGLNFTNTDLIASVTLNNKGDSL  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  TASYYHLV  189



>dbj|BAL41368.1| porin, partial [Arum maculatum]
Length=198

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  155  LYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLY  334
            LY DY  D KF  +T +A GVAITS+G KK +L+  ++ TQ+KNK +TTDLKV+++S L 
Sbjct  1    LYKDYQTDQKFVFSTCAANGVAITSTGTKKNDLIFGEIQTQIKNKGVTTDLKVNSDSTLL  60

Query  335  TTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNN  514
            TTITVDE AP  KTI+SFV PDQ+SGKVELQYLH+YAGI+ S GLTA+P+V+F+ V G N
Sbjct  61   TTITVDEIAPRFKTILSFVVPDQRSGKVELQYLHDYAGINASFGLTANPIVNFASVVGTN  120

Query  515  TLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGASYYHTVR  673
            TLA G D+SF+TATG FTKYN GL+ +  DL+AS TLND  D L  SYYH ++
Sbjct  121  TLAAGVDLSFNTATGDFTKYNVGLNITNDDLVASFTLNDKFDTLTTSYYHYIK  173



>ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF86667.1| unknown [Zea mays]
 tpg|DAA58725.1| TPA: outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KF++TT S  G+AIT++G +K E    D++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TTITVDE   PGLK+I++ V PDQ+SGK+ELQYLHEY G++ SIG
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SG  G+  L++G DVSFDT T  FTKYNA LS +  DLIASL LN+ GD L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTETSNFTKYNAALSLANPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  VASYYHLVK  190



>gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
             PGLY+DIGKK +DLLY DY    KF++TT S  G+AIT++G +K E    D++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
             +T D+K ++ S L TTITVDE   PGLK+I++ V PDQ+SGK+ELQYLHEY G++ SIG
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L ++P+V+ SG  G+  L++G DVSFDT +  FTKYNA LS +  DLIASL LN+ GD L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTESSNFTKYNAALSLANPDLIASLHLNNHGDTL  181

Query  647  GASYYHTVR  673
             ASYYH V+
Sbjct  182  VASYYHLVK  190



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL+S+IGKKAKDLL  DY  D KFT+TT+S TG+A TS+GVKKGEL   D+NTQ 
Sbjct  1    MGKGPGLFSEIGKKAKDLLTRDYNYDQKFTVTTFSETGLAFTSTGVKKGELFSGDLNTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K +N T D+K+DTNS + TTIT+D+P P  KTI SF  PDQKSGKV+LQY H++ G+S+S
Sbjct  61   KYQNATVDVKIDTNSNILTTITLDQPIPNAKTIFSFKIPDQKSGKVDLQYFHDHVGLSSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT +P+V  SG  G++ +++G +++FDTA+  F+KY+AG+  S  +  A++ L D GD
Sbjct  121  IGLTPTPIVEVSGALGSDGISVGGEMAFDTASSTFSKYSAGIGVSKPEYTAAVILADKGD  180

Query  641  FLGASYYHTV  670
             + ASY H V
Sbjct  181  TVKASYTHIV  190



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPG+YSDIGKK KDLL  DY  D KF ITT + +G+A TS+GVK+GE    DVNT  
Sbjct  1    MGKGPGMYSDIGKKTKDLLNKDYTYDQKFVITTNTQSGLAFTSTGVKRGEGFSGDVNTSF  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+T D+KVDT S ++ T+TVDE APG K++ +F  PD KSGK+EL Y  +Y GIS S
Sbjct  61   KNKNVTADVKVDTKSNIFATVTVDEFAPGAKSVFTFTIPDHKSGKLELLYKQDYCGISGS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT SP+V  +G  GN   ++G +++FDTA+G   KYNAG+ F   D  ASL L + GD
Sbjct  121  IGLTPSPIVEATGALGNEGFSVGGELAFDTASGSLIKYNAGVGFVKPDFNASLMLAEKGD  180

Query  641  FLGASYYHTV  670
             L ASY HTV
Sbjct  181  LLKASYLHTV  190



>ref|NP_001056162.1| Os05g0536200 [Oryza sativa Japonica Group]
 sp|Q6L5I5.1|VDAC2_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=OsVDAC2 [Oryza sativa Japonica Group]
 emb|CAC80850.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 gb|AAT39214.1| voltage-dependent anion-selective channel (VDAC) protein [Oryza 
sativa Japonica Group]
 dbj|BAF18076.1| Os05g0536200 [Oryza sativa Japonica Group]
 dbj|BAG92718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79592.1| hypothetical protein OsI_20774 [Oryza sativa Indica Group]
 gb|EEE64499.1| hypothetical protein OsJ_19349 [Oryza sativa Japonica Group]
Length=280

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 138/185 (75%), Gaps = 1/185 (1%)
 Frame = +2

Query  119  LYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNIT  298
            LYSDIGKKA+DLLY DY  D KFT+TTY+A G AIT +G KK E + +++ +Q+KN N++
Sbjct  12   LYSDIGKKARDLLYRDYHTDQKFTLTTYAANGAAITVAGTKKNESIFSEIQSQVKNNNVS  71

Query  299  TDLKVDTNSKLYTTITV-DEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTA  475
             D+K  ++SKL TT TV D   PGLK I+S   P QKS K E+QYLH +AG++  +GL A
Sbjct  72   VDVKATSDSKLITTFTVHDLGTPGLKGILSIPFPYQKSAKAEVQYLHPHAGLNAIVGLNA  131

Query  476  SPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGAS  655
            +PLVSFSGV G    A+GTDV+FDTATG FTKYNAGLS +T DL A+L LN+ GD L AS
Sbjct  132  NPLVSFSGVFGTGAFAVGTDVAFDTATGDFTKYNAGLSHTTPDLTAALLLNNKGDSLAAS  191

Query  656  YYHTV  670
            YYH V
Sbjct  192  YYHKV  196



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPG Y+DIGKK KDLL  DY  D KF ITT + +G+A TS+G+K+GE    D+NTQ 
Sbjct  1    MGKGPGFYTDIGKKTKDLLNKDYTYDQKFVITTSTKSGLAFTSTGLKRGEAFTGDLNTQF  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            KNKN+T D+KVDT S ++TTIT+DE APG K++ SF  PD KSGK+E+QY  +Y GI+ S
Sbjct  61   KNKNVTADVKVDTKSNIFTTITIDEFAPGAKSVFSFTIPDHKSGKLEIQYKQDYCGITGS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGL+ SP+V  +G  GN+  ++G +V+FD+A G   KYNAG+     D  AS+ L + GD
Sbjct  121  IGLSPSPIVEATGALGNDGFSVGGEVAFDSANGSLIKYNAGVGLVKPDFNASIILAEKGD  180

Query  641  FLGASYYHTV  670
             L ASY HTV
Sbjct  181  LLKASYLHTV  190



>ref|XP_006655528.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Oryza brachyantha]
Length=281

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 136/188 (72%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY  + KFT+TTY+A G AIT +  +K E + +++ +QLKN 
Sbjct  10   GPGLYSEIGKKARDLLYKDYHTNQKFTLTTYAANGAAITVASTRKDEAMSSEIQSQLKNN  69

Query  290  NITTDLKVDTNSKLYTTITV-DEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K  ++S L TT TV D   PG K I+S   P QKS K E+QYLH +AG++  +G
Sbjct  70   NVTVDVKATSDSTLMTTFTVHDLCMPGTKGILSIPFPYQKSAKAEVQYLHPHAGLNACVG  129

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L+A+PLVSFSG  G    A+G DV+FDTATG FTKYNA LS +T DL ASL LN+ GD L
Sbjct  130  LSANPLVSFSGAFGTRAFAVGADVTFDTATGDFTKYNAALSHTTEDLTASLLLNNKGDSL  189

Query  647  GASYYHTV  670
              SYYH+V
Sbjct  190  VTSYYHSV  197



>ref|XP_004961383.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Setaria italica]
Length=276

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKKA+DLLY DY  D KFT+TTY++ G AIT++  +K E + +++ +QLK++
Sbjct  5    GPGLYTEIGKKARDLLYKDYHTDQKFTLTTYASNGAAITAASTRKNEAIFSEIQSQLKHE  64

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K  + S + TT TV E   PGLK I+    P QKS K ELQYLH +AG++ S+G
Sbjct  65   NVTVDVKATSESNVTTTFTVHELGTPGLKAILCIPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L A+P+V+ SGV G  T+A+G D SFDT++G  TKYNAGLS++  D +A+ TLN+ GD L
Sbjct  125  LNANPVVNLSGVFGTKTIAVGADASFDTSSGDLTKYNAGLSYNAGDFVAAATLNNKGDSL  184

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  185  AASYYHLV  192



>ref|XP_002458403.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
 gb|EES03523.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
Length=277

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYSDIGKKA+DLL  D+  D KF +TTYS+ G  IT+S  KK E + +++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLSKDFHTDQKFILTTYSSNGTVITASSTKKNESIFSEIQAQLKQK  61

Query  290  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K +++S L TT+TV+E   PGLK  ++   P +  GK E+QYLH+YAGIS S G
Sbjct  62   NVTVDVKANSDSLLLTTVTVEELGVPGLKKTMTIPFPHRGFGKFEIQYLHDYAGISASAG  121

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            + A PLV+ S V GN  +A G DV++DTAT  FTKYNAGLSF+ +DLIA++TLN+ G+ L
Sbjct  122  MNAKPLVNLSAVFGNKAIAAGADVAYDTATRDFTKYNAGLSFTNADLIAAVTLNNKGESL  181

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  182  TASYYHIV  189



>gb|KJB30164.1| hypothetical protein B456_005G132100 [Gossypium raimondii]
Length=335

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 132/168 (79%), Gaps = 7/168 (4%)
 Frame = +2

Query  188  TITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNS---KLYTTITVDEP  358
             +  YS T VAIT +G+KK +L +ADVNTQLK +N+TTD+KVDT+S   +L+TTITVDEP
Sbjct  82   CLIVYSPTDVAITFAGMKKCDLFLADVNTQLKFRNVTTDIKVDTSSNGLQLFTTITVDEP  141

Query  359  APGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDV  538
            APGLKTI  F  PDQ+SGK++LQYL+EYA IS+SIGLT +P+V+FSGV G N LALGTD+
Sbjct  142  APGLKTIFGFKVPDQRSGKIKLQYLYEYARISSSIGLTTNPIVNFSGVFGTNVLALGTDI  201

Query  539  SFDTATGKFTKYNAGLSFSTSDLIASLTL----NDXGDFLGASYYHTV  670
            SF+   G FTK NAGLSF+ +DLIASL L    N+ GD + ASYYH V
Sbjct  202  SFNMKFGNFTKCNAGLSFTNADLIASLALHVVMNEKGDSVNASYYHIV  249



>ref|XP_003568015.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=278

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 136/191 (71%), Gaps = 3/191 (2%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLY++IGKK++DLLY DY  D KFT+TT +A G  IT++  KK E +V+++ +QLK K
Sbjct  5    GPGLYTEIGKKSRDLLYKDYQTDQKFTLTTVAANGATITAASTKKNEAIVSEIQSQLKGK  64

Query  290  NITTDLKVDTNSKLYTTITVDEP-APGLKTIISFVAPDQKS--GKVELQYLHEYAGISTS  460
            N+T D+KV + S +  T+TV E   PGLK ++    P  KS  GK ELQYLH +AGI+ S
Sbjct  65   NVTVDVKVTSESSVIATVTVPELYTPGLKGMLCVPIPYNKSASGKAELQYLHAHAGINAS  124

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GL A+PLV+ SGV G   LA G DV+FDTA+G FTKYNAG+S +  DL AS+ LN+ GD
Sbjct  125  VGLNANPLVNLSGVLGTKDLAFGADVAFDTASGDFTKYNAGVSLTNEDLTASVVLNNKGD  184

Query  641  FLGASYYHTVR  673
             L ASYY  V+
Sbjct  185  TLAASYYQQVK  195



>ref|XP_006845625.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
 gb|ERN07300.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
Length=275

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPG +SDIGKKA+DLL  DY  D KFT+T  S  G+A+T++G+K+G+    D++TQ 
Sbjct  1    MAKGPGPFSDIGKKARDLLTRDYNYDEKFTLTMLSDNGLALTTTGLKRGQFFTGDLSTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K+ N T D+KVDTN  + +TITV+E  P  KT +SF  PD KSGK+E+QYLH+ A I++S
Sbjct  61   KSGNTTVDVKVDTNCNITSTITVNEIFPSSKTALSFKIPDHKSGKLEVQYLHDRAAINSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT +PL+ FS   GN  ++LG +V+FDTAT   TKYN G+  +  D  A+L + D G+
Sbjct  121  IGLTPTPLLEFSAAVGNGEVSLGGEVAFDTATASLTKYNVGIGLTKEDYSAALMVADKGE  180

Query  641  FLGASYYHTV  670
             L ASY HTV
Sbjct  181  TLKASYLHTV  190



>gb|ADE77918.1| unknown [Picea sitchensis]
Length=276

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 133/191 (70%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL+S+IGKKA+DLL  DY  D KF +TTYS  G+ ITS+G+ KG L   D++T  
Sbjct  1    MGKGPGLFSNIGKKARDLLTKDYSHDQKFAVTTYSEDGLGITSTGMNKGGLFCGDIDTHY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K +N T ++KVDTNS + TTIT+DE  PG KT++SF  PD+KSGK++ QY HE+ G+S+S
Sbjct  61   KYQNSTINVKVDTNSNISTTITIDEVLPGAKTVLSFKLPDEKSGKLDFQYSHEHVGLSSS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GLT  P V FSG  G++   +G +V FDT++G FTKYN G+  +  +  A++   D GD
Sbjct  121  VGLTPKPQVDFSGAIGSDVFTVGGEVGFDTSSGLFTKYNGGIGITKPEFSAAILFADKGD  180

Query  641  FLGASYYHTVR  673
             L ASY H + 
Sbjct  181  TLKASYLHELN  191



>ref|XP_002440144.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
 gb|EES18574.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
Length=276

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY  D KFT+TTY+A G AIT++  +K E +  ++ +QLK+ 
Sbjct  5    GPGLYSEIGKKARDLLYKDYHTDQKFTLTTYAANGAAITAASTRKDEAIFNEIQSQLKHN  64

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K  + S L TTITV E   PGLK I+    P QKS K ELQYLH +AG++ S+G
Sbjct  65   NVTVDVKATSESNLITTITVHELGTPGLKGILCIPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L A+P+V+ SGV G  T+A+G D ++DT++G  TKYNAGLS++TSD +A+ TLN  GD +
Sbjct  125  LNANPVVNLSGVFGTKTIAVGADAAYDTSSGDLTKYNAGLSYTTSDFVAAATLNHKGDNI  184

Query  647  GASYYHTV  670
             ASYYH V
Sbjct  185  AASYYHLV  192



>ref|NP_001104949.1| voltage-dependent anion channel protein2 [Zea mays]
 gb|AAD56653.1|AF178952_1 voltage-dependent anion channel protein 2 [Zea mays]
 gb|ACF85067.1| unknown [Zea mays]
 gb|ACG34248.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|AFW78894.1| outer membrane protein porinVoltage-dependent anion channel protein 
2 [Zea mays]
Length=276

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  289
            GPGLYS+IGKKA+DLLY DY  D KFT+TTY+A G AIT++  +K E +  ++ +QLK+ 
Sbjct  5    GPGLYSEIGKKARDLLYKDYHTDQKFTLTTYAANGAAITAASTRKDEAIFNEIQSQLKHN  64

Query  290  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            N+T D+K  + S + TTITV E   PGLK I+    P QKS K ELQYLH +AG++ S+G
Sbjct  65   NVTVDVKATSESNVITTITVHELGTPGLKAILCVPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L A+P+V+ SGV G   +A+G D +FDT++G  TKYNAGLS++T D +A+ TLN+ GD +
Sbjct  125  LNANPVVNLSGVFGTKAIAVGADAAFDTSSGDLTKYNAGLSYTTPDFVAAATLNNKGDNI  184

Query  647  GASYYHTV  670
             ASYYH+V
Sbjct  185  AASYYHSV  192



>emb|CAA57647.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=273

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 3/190 (2%)
 Frame = +2

Query  113  PGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKN  292
            P LY++IGKKA+DLL  DY    KFT TT +A G  ITSS  KK E ++AD+ TQ+K KN
Sbjct  1    PALYNNIGKKARDLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAILADLQTQVKIKN  60

Query  293  ITTDLKVDTNSKLYTTITVDEP-APGLKTIISFVAPDQKS--GKVELQYLHEYAGISTSI  463
             T D+K  ++S + TTITV E   PGLK ++S   P QKS  GK ELQYLH + GI+ S+
Sbjct  61   FTVDVKATSDSSVVTTITVPELYTPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSV  120

Query  464  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDF  643
            GL ++PLV+FSGV G    A G DV+FDTA+G FTKYNAGLS +  DL ASL LN+  + 
Sbjct  121  GLNSNPLVNFSGVIGTKAFAFGVDVAFDTASGDFTKYNAGLSHTNQDLTASLNLNNKVNT  180

Query  644  LGASYYHTVR  673
            L ASYYH V+
Sbjct  181  LAASYYHQVQ  190



>ref|XP_002973372.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
 gb|EFJ25746.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
Length=278

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = +2

Query  107  KGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  286
            KGPG +SD+GKK  DLLY D+ AD +F++++ ++TG+  +S GVKKG++   D  T    
Sbjct  5    KGPGFWSDVGKKTGDLLYKDFSADQRFSLSSTTSTGLTFSSFGVKKGDVFDGDFTTTYVC  64

Query  287  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            KN+T D+KVDT SK+++T+ VD+ APG + I +F  PDQKSGK+ELQY H+YAG++ S+G
Sbjct  65   KNVTVDVKVDTQSKIFSTVKVDDLAPGTRAIFNFSLPDQKSGKMELQYCHQYAGVTASVG  124

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L +SP+V  +   G+N + +G + +FDTA+G FTKYNAG+  +  +  A++ + D GD L
Sbjct  125  LASSPVVECTSAFGSNDVVIGGEAAFDTASGNFTKYNAGVGINKPEFTAAVVVADKGDTL  184

Query  647  GASYYHTV  670
             ASY H +
Sbjct  185  KASYSHVL  192



>ref|XP_002976531.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
 gb|EFJ22200.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
Length=278

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = +2

Query  107  KGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  286
            KGPG +SD+GKK  DLLY D+ AD +F++++ ++TG+  +S GVKKG++   D  T    
Sbjct  5    KGPGFWSDVGKKTSDLLYKDFSADQRFSLSSTTSTGLTFSSFGVKKGDVFDGDFTTTYVC  64

Query  287  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  466
            KN+T D+KVDT SK+++T+ VD+ APG + I +F  PDQKSGK+ELQY H+YAG++ S+G
Sbjct  65   KNVTVDVKVDTQSKIFSTVKVDDLAPGTRAIFNFSLPDQKSGKMELQYCHQYAGVTGSVG  124

Query  467  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFL  646
            L +SP+V  +   G+N + +G + +FDTA+G FTKYNAG+  +  +  A++ + D GD L
Sbjct  125  LASSPVVECTSAFGSNDVVIGGEAAFDTASGNFTKYNAGVGINKPEFTAAVVVADKGDTL  184

Query  647  GASYYHTV  670
             ASY H +
Sbjct  185  KASYSHVL  192



>ref|XP_008338437.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Malus 
domestica]
Length=276

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 128/188 (68%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL++DIGKKAKDLL  DY +D KFTI+TYS  GVA+TS+ VKKG L + D+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTISTYSDAGVALTSTAVKKGGLSIGDILTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+KVDT S + TT T++E  P  KTI SF APD  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNILTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHAAXTTA  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            + L  SP + FS   G  T+A G +  +DT +G FTKY AG+S +  D  AS+ L D GD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIRASYVH  188



>ref|XP_009354614.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
 ref|XP_009379335.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Pyrus 
x bretschneideri]
Length=276

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 128/188 (68%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL++DIGKKAKDLL  DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+KVDT S + TT T++E  P  KTI SF APD  SGK+E+QY H++A I+T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATITTA  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            + L  SP + FS   G  T+A G +  +DT +G FTKY AG+S +  D  AS+ L D GD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIRASYVH  188



>ref|NP_001152335.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|ACG47097.1| outer mitochondrial membrane protein porin [Zea mays]
Length=314

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 138/226 (61%), Gaps = 39/226 (17%)
 Frame = +2

Query  110  GPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGV------------------------  217
            GPGLYSDIGKKA+ LLY DY  D KFT+TTY+A G                         
Sbjct  5    GPGLYSDIGKKARGLLYKDYHTDRKFTLTTYAANGAFKARVTMDMKHRVVRAMIAGSMGD  64

Query  218  --------------AITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDE  355
                          AIT++  +K E +   +  QLK+ N+T D+K  + SK+ TTITV E
Sbjct  65   GDGAPVHVQDKTESAITAASTRKDEAIFNKIQGQLKHNNVTVDVKATSESKVTTTITVHE  124

Query  356  PA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGT  532
             A PGLK  +    P +KS K ELQYLH +AG++ S+GL A+P+V  SGV G  T+++G 
Sbjct  125  LATPGLKAFLCIPFPYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVSVGA  184

Query  533  DVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGASYYHTV  670
            DV+FDT++G  TKYNAGLS+STSD +A+ TLN+ GD + ASYYH+V
Sbjct  185  DVAFDTSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSV  230



>ref|XP_003569678.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=327

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = +2

Query  98   EMVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQ  277
            ++  G GLYS++G+KA+DLLY D+  D KFT+TT +  G AIT++  KK E ++ D+ TQ
Sbjct  52   KVAPGHGLYSEVGQKARDLLYKDFHTDQKFTLTTRANNGAAITATSTKKNEAILGDIKTQ  111

Query  278  LKNKNITTDLKVDTNSK-LYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGIS  454
             K  N+  D+K  T+S+ L TT T D    GLK I++   P+Q +GKVE+QYLH+YAG++
Sbjct  112  FKFNNVKVDVKATTDSEVLITTTTEDLGLVGLKKIVTIPFPNQTAGKVEVQYLHDYAGLN  171

Query  455  TSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDX  634
             S+GL + PL++ SGV GN  LA G DV++D+ATG FTKYNAG+S +  DL A++ LN+ 
Sbjct  172  VSVGLNSKPLINLSGVFGNKALAAGADVAYDSATGNFTKYNAGVSLTNEDLSAAVMLNNK  231

Query  635  GDFLGASYYHTVR  673
            GD L ASYYH+V 
Sbjct  232  GDSLTASYYHSVN  244



>ref|XP_008787191.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Phoenix dactylifera]
Length=275

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 130/188 (69%), Gaps = 1/188 (1%)
 Frame = +2

Query  104  VKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLK  283
            +KGPGL+SDIGKKAKDLL   Y  D K TI+TYSA+GV +TS+ VKKG L   D+ TQ K
Sbjct  1    MKGPGLFSDIGKKAKDLLTKGYSCDQKLTISTYSASGVGLTSAAVKKGGLYSFDIGTQYK  60

Query  284  NKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSI  463
             KN   D+KVDT+S + TT+T+ E  P  KTI SF  PD  SGK+E+QY H++AG++T++
Sbjct  61   YKNTLVDVKVDTDSNVSTTLTMSEILPSTKTIASFKLPDYNSGKLEIQYFHDHAGVATAV  120

Query  464  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDF  643
             L  SP+V  SG  G + +A G +  FDTA+G FTKYNAG+S    D  AS+ L D GD 
Sbjct  121  ALKQSPVVDLSGTIGIHGIAFGAEAGFDTASGTFTKYNAGISLGKPDYNASIILADKGDT  180

Query  644  LGASY-YH  664
            L ASY YH
Sbjct  181  LRASYVYH  188



>dbj|BAJ99317.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = +2

Query  119  LYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNIT  298
            LY+DIGKKA+DLL  DY    KFT TT +A G  ITSS  KK E +++D+ TQ+K KN T
Sbjct  20   LYADIGKKARDLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAILSDLQTQVKIKNFT  79

Query  299  TDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKS--GKVELQYLHEYAGISTSIGL  469
             D+K  ++S + TTIT+ E   PGLK ++S   P QKS  GK ELQYLH + GI+ S+GL
Sbjct  80   VDVKATSDSSVVTTITIPELCKPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGL  139

Query  470  TASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLG  649
              +PLV+ SGV G   LA G DV+FDTA+G FTKYNAG+S +  DL ASL LN+ G+ L 
Sbjct  140  NPNPLVNISGVIGTKALAFGLDVAFDTASGDFTKYNAGMSHTNQDLTASLMLNNKGNTLA  199

Query  650  ASYYHTVR  673
            ASYYH V+
Sbjct  200  ASYYHQVQ  207



>ref|XP_010942794.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Elaeis guineensis]
Length=275

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 129/188 (69%), Gaps = 1/188 (1%)
 Frame = +2

Query  104  VKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLK  283
            +KGPGL+SDIGKKAKDLL  DY  D K TI+TYSA+GV +TS+ VKKG L   D+ TQ K
Sbjct  1    MKGPGLFSDIGKKAKDLLNKDYSCDQKLTISTYSASGVGLTSAAVKKGGLYSFDIGTQYK  60

Query  284  NKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSI  463
             KN   D+KVDTNS + TT+T+ E  P  KTI SF  PD  SGK+E+QY H++A ++T++
Sbjct  61   YKNTLIDVKVDTNSNISTTLTLSEILPSTKTIASFKLPDYNSGKLEIQYFHDHASVATAV  120

Query  464  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDF  643
             L  SP+V  SG  G + +A G +  FDTA+G FTKY AG+S    D  AS+ L D GD 
Sbjct  121  ALKQSPVVDLSGTIGVDGIAFGAEAGFDTASGTFTKYTAGISLGKPDYSASIILADMGDT  180

Query  644  LGASY-YH  664
            L ASY +H
Sbjct  181  LRASYIFH  188



>ref|XP_008354718.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Malus domestica]
 ref|XP_009362557.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
Length=276

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 128/188 (68%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL++DIGKKAKDLL  DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+KVDT S + TT T++E  P  KTI SF APD  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATFTTA  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            + L+ SP + FS   G  T+A G +  +DT +G FTKY AG+S +  D  AS+ L D GD
Sbjct  121  VALSQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIRASYVH  188



>ref|XP_002964960.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
 gb|EFJ33798.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
Length=276

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPG++ DIGK+ KDLL  D+ +D KFT+T+ +++G+  TS G KKGE    +VNTQ 
Sbjct  1    MGKGPGMFGDIGKRTKDLLTRDFTSDQKFTVTSSTSSGITFTSFGNKKGEQFAGNVNTQF  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K  N+T ++KVDT S ++  IT DE A G KT+ +F  PD K GK++ QY+H+  G++TS
Sbjct  61   KTNNMTVNVKVDTESNIHGVITADEIAKGAKTVFTFTIPDNKCGKIKFQYVHDLFGLATS  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            IGLT+SP+   S   GN+ +A+G ++SFDTA+GK ++Y+ G+  +  D  A+L   D GD
Sbjct  121  IGLTSSPVADLSAALGNDVVAVGGELSFDTASGKLSRYSGGIGLTKPDYSAALITADKGD  180

Query  641  FLGASYYHTV  670
             L ASY HTV
Sbjct  181  TLKASYCHTV  190



>ref|XP_009150694.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
 ref|XP_009150695.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
Length=276

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL+SDIGKKAKDLL  DY +DHKF+I+TYSA+GVA+TS+ +KKG +  ADV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLMRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+K+DT+S + TT+T  E  P  K I+SF  PD  SGK+E+QY H++A ++ +
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
              L  +PL+  +   G   ++ G +  +DT++  FTKYNAG+S +  D  AS+ L D GD
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTFTKYNAGISVTKPDACASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIKASYLH  188



>ref|XP_007205702.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
 gb|EMJ06901.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
Length=276

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 126/188 (67%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL+SDIGKKAKDLL  DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+KVDT S + TT T++E  P  KTI SF  PD  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKIPDHNSGKLEVQYFHDHATFTTA  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            + L  SP + FS   G  T+A G +  +DT +G FTKY AG+S +  D  AS+ L D GD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISVNKPDQSASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIRASYVH  188



>sp|Q0JJV1.3|VDAC4_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 4; AltName: 
Full=Voltage-dependent anion-selective channel protein 
4; Short=OsVDAC4 [Oryza sativa Japonica Group]
Length=317

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 135/186 (73%), Gaps = 1/186 (1%)
 Frame = +2

Query  119  LYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNIT  298
            LY +IGKKA+DLLY D+  D KFT+TTY+  GV IT++   K E + +++ T+LK+ N+ 
Sbjct  47   LYFEIGKKARDLLYKDFHTDQKFTLTTYTNNGVVITAASTMKDEAIFSEIQTKLKSNNVM  106

Query  299  TDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTA  475
             D+K  ++S++ TTIT ++    GLK I+S   P Q +GK ELQYLH+YAGIS  +GLT+
Sbjct  107  LDVKATSDSQVLTTITTEDLGVSGLKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTS  166

Query  476  SPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGDFLGAS  655
             PLV+ SGV GN ++A+G DV+ DT+TG FTKY+AGL+ + SDL A LTLN+ GD L AS
Sbjct  167  KPLVNLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTAS  226

Query  656  YYHTVR  673
            YYH V 
Sbjct  227  YYHLVN  232



>emb|CDY08723.1| BnaA06g25010D [Brassica napus]
Length=276

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL+SDIGKKAKDLL  DY +DHKF+I+TYSA+GVA+TS+ +KKG +  ADV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+K+DT+S + TT+T  E  P  K I+SF  PD  SGK+E+QY H++A ++ +
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
              L  +PL+  +   G   ++ G +  +DT++  FTKYNAG+S +  D  AS+ L D GD
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTFTKYNAGISVTKPDACASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIKASYLH  188



>ref|XP_008238010.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Prunus mume]
Length=276

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 126/188 (67%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL+SDIGKKAKDLL  DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+KVDT S + TT T++E  P  KTI SF  P+  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKVPEYNSGKLEVQYFHDHATFTTA  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            I L  SP + FS   G  T+A G +  +DT +G FTKY AG+S +  D  AS+ L D GD
Sbjct  121  IALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISVNKPDQSASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIRASYVH  188



>ref|XP_006841082.1| hypothetical protein AMTR_s00086p00035910 [Amborella trichopoda]
 gb|ERN02757.1| hypothetical protein AMTR_s00086p00035910 [Amborella trichopoda]
Length=276

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 123/189 (65%), Gaps = 0/189 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M++GPGL+SDIGKKA+DLL  DY  D KFT++T+S  GV ITS+ VKKG +   D+  Q 
Sbjct  1    MIRGPGLFSDIGKKARDLLTKDYSYDQKFTLSTFSEVGVGITSTAVKKGGISCGDIAVQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K+K+   DLKVDT S + TT T+ E  P  K I+SF  PD  SGK+E+QY H++AG S+ 
Sbjct  61   KHKSTIVDLKVDTESNILTTFTISEILPSTKAIVSFKLPDHNSGKLEVQYFHDHAGFSSI  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
            +GL  SP V  +G  G    A+G +  F+T +   TKYNAGLS +  +L AS+ L D GD
Sbjct  121  VGLNGSPTVDLTGTIGTQGFAIGVEAGFNTTSNAMTKYNAGLSLTKPELCASVILADKGD  180

Query  641  FLGASYYHT  667
                SY HT
Sbjct  181  NFKVSYMHT  189



>emb|CDY36497.1| BnaC03g48560D [Brassica napus]
Length=276

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 128/188 (68%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MVKGPGLYSDIGKKAKDLLYXDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  280
            M KGPGL+SDIGKKAKDLL  DY +DHKF+I+TYSA+GVA+TS+ +KKG +  ADV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  281  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  460
            K KN   D+K+ T+S + TT+T  E  P  K I+SF  PD  SGK+E+QY H++A ++ +
Sbjct  61   KYKNAVFDVKIHTDSTILTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  461  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDXGD  640
              L  +PL+  +   G   ++ G +  +DT++  FTKYNAG+S +  D  AS+ L D GD
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTFTKYNAGISVTKPDACASIILGDKGD  180

Query  641  FLGASYYH  664
             + ASY H
Sbjct  181  SIKASYLH  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600