BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049O16

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611385.1|  PREDICTED: protease Do-like 10, mitochondrial      209   4e-61   Nicotiana tomentosiformis
ref|XP_009803816.1|  PREDICTED: protease Do-like 10, mitochondrial      209   6e-61   Nicotiana sylvestris
gb|EYU39504.1|  hypothetical protein MIMGU_mgv1a003194mg                209   7e-61   Erythranthe guttata [common monkey flower]
ref|XP_011077091.1|  PREDICTED: protease Do-like 10, mitochondrial      209   8e-61   Sesamum indicum [beniseed]
ref|XP_006353238.1|  PREDICTED: protease Do-like 10, mitochondria...    207   4e-60   Solanum tuberosum [potatoes]
ref|XP_002265825.2|  PREDICTED: protease Do-like 10, mitochondrial      206   5e-60   Vitis vinifera
ref|XP_004250091.1|  PREDICTED: protease Do-like 10, mitochondrial      204   5e-59   Solanum lycopersicum
ref|XP_010927886.1|  PREDICTED: protease Do-like 10, mitochondrial      199   3e-57   Elaeis guineensis
ref|XP_010277816.1|  PREDICTED: protease Do-like 10, mitochondrial      197   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008776774.1|  PREDICTED: protease Do-like 10, mitochondria...    197   1e-56   Phoenix dactylifera
gb|EPS59937.1|  hypothetical protein M569_14869                         187   1e-56   Genlisea aurea
emb|CDP04134.1|  unnamed protein product                                195   1e-55   Coffea canephora [robusta coffee]
ref|XP_006468667.1|  PREDICTED: protease Do-like 10, mitochondria...    194   3e-55   Citrus sinensis [apfelsine]
ref|XP_010528621.1|  PREDICTED: protease Do-like 10, mitochondrial      193   5e-55   Tarenaya hassleriana [spider flower]
ref|XP_006448510.1|  hypothetical protein CICLE_v10014700mg             192   1e-54   Citrus clementina [clementine]
ref|XP_004962074.1|  PREDICTED: protease Do-like 10, mitochondria...    192   1e-54   Setaria italica
gb|ACF84354.1|  unknown                                                 189   2e-54   Zea mays [maize]
ref|XP_002441105.1|  hypothetical protein SORBIDRAFT_09g020480          191   4e-54   Sorghum bicolor [broomcorn]
ref|XP_004155122.1|  PREDICTED: protease Do-like 10, mitochondria...    191   4e-54   
ref|XP_004152886.1|  PREDICTED: protease Do-like 10, mitochondria...    191   4e-54   Cucumis sativus [cucumbers]
ref|XP_002463281.1|  hypothetical protein SORBIDRAFT_02g041140          191   4e-54   Sorghum bicolor [broomcorn]
gb|EMS52153.1|  Protease Do-like 10, mitochondrial                      191   5e-54   Triticum urartu
ref|NP_001142088.1|  hypothetical protein                               189   1e-53   Zea mays [maize]
ref|XP_006858733.1|  hypothetical protein AMTR_s00066p00121670          189   2e-53   
ref|XP_008647597.1|  PREDICTED: hypothetical protein isoform X1         189   2e-53   Zea mays [maize]
gb|KDP32493.1|  hypothetical protein JCGZ_13418                         189   2e-53   Jatropha curcas
ref|XP_006655329.1|  PREDICTED: protease Do-like 10, mitochondria...    187   2e-53   
ref|XP_011011698.1|  PREDICTED: protease Do-like 10, mitochondrial      187   1e-52   Populus euphratica
ref|XP_009420477.1|  PREDICTED: protease Do-like 10, mitochondrial      187   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010110145.1|  Protease Do-like 10                                186   2e-52   Morus notabilis
ref|XP_008224670.1|  PREDICTED: protease Do-like 10, mitochondrial      187   2e-52   Prunus mume [ume]
ref|XP_007211387.1|  hypothetical protein PRUPE_ppa003181mg             186   3e-52   Prunus persica
gb|EAY98063.1|  hypothetical protein OsI_19981                          186   4e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_007028414.1|  DegP protease 10 isoform 1                         185   5e-52   
ref|XP_003568444.1|  PREDICTED: protease Do-like 10, mitochondrial      185   7e-52   Brachypodium distachyon [annual false brome]
gb|EEE63742.1|  hypothetical protein OsJ_18561                          184   7e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010027457.1|  PREDICTED: protease Do-like 10, mitochondrial      184   1e-51   Eucalyptus grandis [rose gum]
ref|XP_002514764.1|  serine endopeptidase degp2, putative               183   1e-51   
ref|NP_001055560.1|  Os05g0417100                                       184   1e-51   
gb|KJB49014.1|  hypothetical protein B456_008G097600                    179   2e-51   Gossypium raimondii
gb|KEH24728.1|  DegP protease                                           180   3e-50   Medicago truncatula
ref|XP_004293434.2|  PREDICTED: protease Do-like 10, mitochondrial      180   4e-50   Fragaria vesca subsp. vesca
ref|XP_008377055.1|  PREDICTED: protease Do-like 10, mitochondrial      180   4e-50   
ref|XP_004489189.1|  PREDICTED: protease Do-like 10, mitochondria...    179   4e-50   Cicer arietinum [garbanzo]
gb|KJB49010.1|  hypothetical protein B456_008G097600                    179   4e-50   Gossypium raimondii
gb|KJB49013.1|  hypothetical protein B456_008G097600                    179   4e-50   Gossypium raimondii
ref|XP_002868484.1|  DEGP10                                             179   8e-50   
ref|XP_002311275.1|  hypothetical protein POPTR_0008s07940g             179   9e-50   
gb|KEH24729.1|  DegP protease                                           176   2e-49   Medicago truncatula
ref|XP_007150859.1|  hypothetical protein PHAVU_004G000300g             177   3e-49   Phaseolus vulgaris [French bean]
ref|XP_010673840.1|  PREDICTED: protease Do-like 10, mitochondrial      177   5e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN40897.1|  Protease Do-like 10, mitochondrial                      174   6e-49   Glycine soja [wild soybean]
ref|XP_006405960.1|  hypothetical protein EUTSA_v10027701mg             177   7e-49   Eutrema salsugineum [saltwater cress]
ref|XP_003534464.1|  PREDICTED: protease Do-like 10, mitochondria...    175   1e-48   Glycine max [soybeans]
gb|KHG11681.1|  hypothetical protein F383_13103                         174   4e-48   Gossypium arboreum [tree cotton]
ref|NP_568543.1|  protease Do-like 10                                   174   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283411.1|  hypothetical protein CARUB_v10004459mg             174   6e-48   Capsella rubella
ref|XP_010435521.1|  PREDICTED: protease Do-like 10, mitochondrial      172   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009139697.1|  PREDICTED: protease Do-like 10, mitochondrial      171   8e-47   Brassica rapa
ref|XP_006858734.1|  hypothetical protein AMTR_s00066p00122890          170   8e-47   Amborella trichopoda
ref|XP_010450457.1|  PREDICTED: protease Do-like 10, mitochondrial      169   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010440803.1|  PREDICTED: protease Do-like 10, mitochondria...    169   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010440805.1|  PREDICTED: protease Do-like 10, mitochondria...    168   9e-46   
emb|CDX74606.1|  BnaA04g07830D                                          167   2e-45   
emb|CDY53528.1|  BnaCnng25320D                                          167   3e-45   Brassica napus [oilseed rape]
ref|XP_002963416.1|  hypothetical protein SELMODRAFT_62730              157   3e-42   
ref|XP_002971553.1|  hypothetical protein SELMODRAFT_62447              155   9e-42   
ref|XP_010027524.1|  PREDICTED: protease Do-like 10, mitochondrial      151   7e-40   Eucalyptus grandis [rose gum]
ref|XP_002951860.1|  trypsin family                                     131   1e-32   Volvox carteri f. nagariensis
ref|XP_007028418.1|  DegP protease 10 isoform 5                         130   3e-32   
gb|KCW54068.1|  hypothetical protein EUGRSUZ_I00049                     123   4e-32   Eucalyptus grandis [rose gum]
gb|KCW54108.1|  hypothetical protein EUGRSUZ_I00089                     124   8e-32   Eucalyptus grandis [rose gum]
ref|XP_010027525.1|  PREDICTED: protease Do-like 10, mitochondria...    129   9e-32   Eucalyptus grandis [rose gum]
ref|XP_010027526.1|  PREDICTED: protease Do-like 10, mitochondria...    125   1e-30   Eucalyptus grandis [rose gum]
gb|KCW54069.1|  hypothetical protein EUGRSUZ_I00050                     125   1e-30   Eucalyptus grandis [rose gum]
ref|XP_006845229.1|  hypothetical protein AMTR_s00005p00256670          116   3e-30   
ref|XP_010030295.1|  PREDICTED: uncharacterized protein LOC104420090    126   4e-30   
gb|KJB49012.1|  hypothetical protein B456_008G097600                    123   4e-30   Gossypium raimondii
ref|XP_002888435.1|  predicted protein                                  123   7e-30   
emb|CDY66495.1|  BnaCnng51110D                                          114   4e-29   Brassica napus [oilseed rape]
gb|KCW54110.1|  hypothetical protein EUGRSUZ_I000922                    112   8e-28   Eucalyptus grandis [rose gum]
ref|XP_002886957.1|  hypothetical protein ARALYDRAFT_894151             117   9e-28   Arabidopsis lyrata subsp. lyrata
ref|NP_564856.1|  putativeDegP protease 3                               117   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KIZ03685.1|  hypothetical protein MNEG_4270                          115   1e-27   Monoraphidium neglectum
ref|XP_002886956.1|  hypothetical protein ARALYDRAFT_315601             115   5e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010027559.1|  PREDICTED: protease Do-like 10, mitochondrial      115   6e-27   Eucalyptus grandis [rose gum]
ref|XP_002888434.1|  predicted protein                                  114   1e-26   
ref|XP_002499997.1|  predicted protein                                  114   2e-26   Micromonas commoda
gb|KFK41004.1|  hypothetical protein AALP_AA2G073000                    113   2e-26   Arabis alpina [alpine rockcress]
ref|XP_009140719.1|  PREDICTED: putative protease Do-like 3, mito...    114   2e-26   Brassica rapa
ref|XP_010513422.1|  PREDICTED: putative protease Do-like 3, mito...    113   3e-26   Camelina sativa [gold-of-pleasure]
gb|AAB60923.1|  F5I14.16                                                113   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866059.1|  predicted protein                                  113   4e-26   
ref|XP_006391532.1|  hypothetical protein EUTSA_v10019834mg             111   3e-25   
ref|XP_006378624.1|  hypothetical protein POPTR_0010s18430g             108   3e-25   
ref|XP_006391530.1|  hypothetical protein EUTSA_v10019569mg             108   5e-25   
ref|XP_010511113.1|  PREDICTED: putative protease Do-like 3, mito...    109   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002866058.1|  hypothetical protein ARALYDRAFT_357728             107   4e-24   
ref|XP_004344572.1|  DegPtype protease                                  106   2e-23   Acanthamoeba castellanii str. Neff
ref|XP_006301507.1|  hypothetical protein CARUB_v10021933mg             105   5e-23   Capsella rubella
sp|Q9SHZ0.1|DEGP4_ARATH  RecName: Full=Protease Do-like 4, mitoch...    103   1e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35320.1|  BnaA04g15270D                                          103   2e-22   Brassica napus [oilseed rape]
ref|NP_568583.1|  DegP protease 13                                      101   3e-22   
ref|XP_008441958.1|  PREDICTED: protease Do-like 10, mitochondrial      102   3e-22   
sp|Q9FM41.1|DGP13_ARATH  RecName: Full=Putative protease Do-like 13     101   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436835.1|  PREDICTED: LOW QUALITY PROTEIN: putative pro...    101   7e-22   
ref|XP_010418975.1|  PREDICTED: putative protease Do-like 3, mito...    101   1e-21   Camelina sativa [gold-of-pleasure]
sp|Q9LK70.1|DGP12_ARATH  RecName: Full=Putative protease Do-like ...    100   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608950.1|  hypothetical protein MTR_4g106730                  100   2e-21   Medicago truncatula
ref|XP_006282154.1|  hypothetical protein CARUB_v10028411mg           99.4    4e-21   
emb|CDY39277.1|  BnaC06g27140D                                        98.6    4e-21   Brassica napus [oilseed rape]
ref|XP_010037587.1|  PREDICTED: protease Do-like 9                    99.8    5e-21   Eucalyptus grandis [rose gum]
gb|KCW49312.1|  hypothetical protein EUGRSUZ_K02868                   97.8    1e-20   Eucalyptus grandis [rose gum]
ref|XP_011071819.1|  PREDICTED: protease Do-like 9 isoform X2         97.8    1e-20   Sesamum indicum [beniseed]
gb|KDP31134.1|  hypothetical protein JCGZ_11510                       98.2    1e-20   Jatropha curcas
ref|NP_566552.1|  DEGP protease 12                                    97.4    2e-20   
ref|XP_006339987.1|  PREDICTED: protease Do-like 9-like               97.8    2e-20   Solanum tuberosum [potatoes]
ref|XP_006391531.1|  hypothetical protein EUTSA_v10019570mg           97.1    2e-20   
emb|CDP16995.1|  unnamed protein product                              97.4    3e-20   Coffea canephora [robusta coffee]
ref|XP_009105158.1|  PREDICTED: putative protease Do-like 3, mito...  96.7    3e-20   Brassica rapa
emb|CDY07457.1|  BnaA07g25360D                                        96.7    3e-20   Brassica napus [oilseed rape]
ref|XP_002946355.1|  trypsin family                                   96.7    5e-20   Volvox carteri f. nagariensis
ref|XP_007028415.1|  DegP protease 10 isoform 2                       96.3    6e-20   
ref|XP_011044336.1|  PREDICTED: protease Do-like 9                    96.3    6e-20   Populus euphratica
gb|KFG58629.1|  trypsin domain-containing protein                     93.6    7e-20   Toxoplasma gondii RUB
ref|XP_009794183.1|  PREDICTED: protease Do-like 9                    95.9    9e-20   Nicotiana sylvestris
gb|KJB49011.1|  hypothetical protein B456_008G097600                  94.7    2e-19   Gossypium raimondii
ref|XP_011015595.1|  PREDICTED: protease Do-like 9                    95.1    2e-19   Populus euphratica
ref|XP_011071818.1|  PREDICTED: protease Do-like 9 isoform X1         95.9    2e-19   
ref|XP_006376843.1|  hypothetical protein POPTR_0012s07930g           95.1    2e-19   
ref|XP_002321577.2|  hypothetical protein POPTR_0015s08440g           94.7    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009609751.1|  PREDICTED: protease Do-like 9                    94.4    3e-19   Nicotiana tomentosiformis
ref|XP_006446449.1|  hypothetical protein CICLE_v10014711mg           94.0    4e-19   Citrus clementina [clementine]
ref|XP_010456846.1|  PREDICTED: putative protease Do-like 11, mit...  94.0    4e-19   
gb|EYU42545.1|  hypothetical protein MIMGU_mgv1a0052332mg             92.0    5e-19   Erythranthe guttata [common monkey flower]
gb|KDO66274.1|  hypothetical protein CISIN_1g036586mg                 93.6    5e-19   Citrus sinensis [apfelsine]
ref|XP_010678720.1|  PREDICTED: protease Do-like 9                    93.6    5e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK31613.1|  hypothetical protein AALP_AA6G135800                  90.9    8e-19   Arabis alpina [alpine rockcress]
ref|XP_011087156.1|  PREDICTED: protease Do-like 9                    93.2    8e-19   Sesamum indicum [beniseed]
ref|XP_006470390.1|  PREDICTED: protease Do-like 9-like               92.8    1e-18   Citrus sinensis [apfelsine]
dbj|GAM25013.1|  hypothetical protein SAMD00019534_081880             92.4    1e-18   Acytostelium subglobosum LB1
ref|XP_010446115.1|  PREDICTED: putative protease Do-like 3, mito...  92.4    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004252189.1|  PREDICTED: protease Do-like 9                    92.8    1e-18   Solanum lycopersicum
ref|XP_003055699.1|  predicted protein                                92.0    1e-18   Micromonas pusilla CCMP1545
gb|EYU29924.1|  hypothetical protein MIMGU_mgv1a005009mg              91.7    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_008887060.1|  trypsin domain-containing protein                92.8    2e-18   
ref|XP_002885148.1|  hypothetical protein ARALYDRAFT_479117           91.7    2e-18   
ref|XP_002370490.1|  trypsin, putative                                92.4    2e-18   
gb|KFH09397.1|  trypsin domain-containing protein                     92.4    2e-18   Toxoplasma gondii VAND
gb|EPT25374.1|  trypsin domain-containing protein                     92.0    3e-18   Toxoplasma gondii ME49
gb|ESS28089.1|  trypsin domain-containing protein                     92.0    3e-18   Toxoplasma gondii VEG
ref|XP_009379979.1|  PREDICTED: protease Do-like 9                    91.7    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928580.1|  PREDICTED: protease Do-like 9                    91.7    3e-18   Elaeis guineensis
sp|Q9LK71.2|DGP11_ARATH  RecName: Full=Putative protease Do-like ...  90.9    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002968921.1|  hypothetical protein SELMODRAFT_90340            90.5    6e-18   
gb|EPR63244.1|  trypsin domain-containing protein                     90.5    1e-17   Toxoplasma gondii GT1
ref|XP_011402326.1|  Protease Do-like 9                               89.7    1e-17   Auxenochlorella protothecoides
gb|KJB40784.1|  hypothetical protein B456_007G077100                  89.7    1e-17   Gossypium raimondii
ref|XP_010678716.1|  PREDICTED: protease Do-like 9 isoform X1         89.4    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_566551.1|  DegP protease 11                                    89.4    1e-17   
ref|XP_002989968.1|  hypothetical protein SELMODRAFT_130891           89.0    2e-17   
gb|KHG08084.1|  Protease Do-like 9                                    82.4    4e-17   Gossypium arboreum [tree cotton]
ref|XP_010254385.1|  PREDICTED: protease Do-like 9                    88.2    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_006654043.1|  PREDICTED: protease Do-like 2, chloroplastic...  87.8    5e-17   Oryza brachyantha
ref|XP_010272002.1|  PREDICTED: protease Do-like 9                    87.8    6e-17   Nelumbo nucifera [Indian lotus]
ref|XP_002885149.1|  DEGP12                                           87.0    9e-17   
gb|AAT93972.1|  putative DegP2 protease                               87.4    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057235.1|  Os06g0234100                                     87.0    1e-16   
ref|XP_010678715.1|  PREDICTED: protease Do-like 9                    86.3    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007514393.1|  predicted protein                                86.7    1e-16   Bathycoccus prasinos
ref|XP_010678718.1|  PREDICTED: protease Do-like 9 isoform X2         86.3    1e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|EFA82977.1|  hypothetical protein PPL_03755                        86.7    2e-16   Heterostelium album PN500
dbj|BAB01153.1|  unnamed protein product                              86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960292.1|  PREDICTED: protease Do-like 2, chloroplastic...  86.7    2e-16   Setaria italica
ref|XP_010233342.1|  PREDICTED: protease Do-like 2, chloroplastic     86.3    3e-16   
emb|CDY46469.1|  BnaA08g06390D                                        85.5    3e-16   Brassica napus [oilseed rape]
ref|XP_009107927.1|  PREDICTED: putative protease Do-like 12, mit...  85.5    3e-16   Brassica rapa
gb|AFW57620.1|  hypothetical protein ZEAMMB73_444319                  84.7    5e-16   
emb|CDX91770.1|  BnaC08g06890D                                        82.8    5e-16   
gb|EMS45662.1|  Protease Do-like 9                                    84.7    5e-16   Triticum urartu
ref|XP_003886416.1|  hypothetical protein NCLIV_068150                85.5    5e-16   Neospora caninum Liverpool
ref|XP_002439270.1|  hypothetical protein SORBIDRAFT_09g003540        85.1    6e-16   Sorghum bicolor [broomcorn]
gb|AET50594.1|  hypothetical protein                                  84.7    7e-16   Eimeria tenella
emb|CDJ68975.1|  trypsin, putative                                    84.7    7e-16   Eimeria necatrix
emb|CDJ40717.1|  trypsin, putative                                    84.7    7e-16   Eimeria tenella
gb|KIZ00510.1|  hypothetical protein MNEG_7454                        84.3    9e-16   Monoraphidium neglectum
ref|XP_010424503.1|  PREDICTED: putative protease Do-like 11, mit...  84.3    1e-15   
dbj|BAJ90442.1|  predicted protein                                    84.0    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655949.1|  PREDICTED: protease Do-like 9-like               83.6    1e-15   Oryza brachyantha
ref|NP_001146551.1|  hypothetical protein                             84.0    2e-15   Zea mays [maize]
ref|XP_008438126.1|  PREDICTED: protease Do-like 9                    83.2    2e-15   Cucumis melo [Oriental melon]
ref|XP_004152460.1|  PREDICTED: protease Do-like 9-like               83.2    2e-15   Cucumis sativus [cucumbers]
ref|XP_002502087.1|  predicted protein                                82.8    2e-15   Micromonas commoda
ref|XP_004508846.1|  PREDICTED: protease Do-like 9-like               83.2    3e-15   Cicer arietinum [garbanzo]
ref|XP_010111735.1|  Protease Do-like 9                               83.2    3e-15   Morus notabilis
ref|XP_003564034.1|  PREDICTED: protease Do-like 9                    83.2    3e-15   Brachypodium distachyon [annual false brome]
ref|XP_003525265.1|  PREDICTED: protease Do-like 9-like               83.2    3e-15   Glycine max [soybeans]
ref|XP_006855396.1|  hypothetical protein AMTR_s00057p00143260        82.8    3e-15   
ref|XP_003288812.1|  hypothetical protein DICPUDRAFT_153086           83.2    3e-15   Dictyostelium purpureum
gb|KHN48612.1|  Protease Do-like 9                                    81.6    3e-15   Glycine soja [wild soybean]
gb|EMS54752.1|  Protease Do-like 2, chloroplastic                     82.8    3e-15   Triticum urartu
ref|XP_008239730.1|  PREDICTED: protease Do-like 9                    82.8    4e-15   Prunus mume [ume]
ref|XP_006281902.1|  hypothetical protein CARUB_v10028106mg           82.0    4e-15   
gb|EMT00922.1|  Protease Do-like 2, chloroplastic                     82.8    4e-15   
ref|XP_003550747.1|  PREDICTED: protease Do-like 9-like               82.4    4e-15   Glycine max [soybeans]
ref|XP_001753311.1|  predicted protein                                82.8    5e-15   
dbj|BAJ90870.1|  predicted protein                                    82.4    5e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007155398.1|  hypothetical protein PHAVU_003G198000g           82.0    6e-15   Phaseolus vulgaris [French bean]
ref|XP_005850048.1|  hypothetical protein CHLNCDRAFT_34342            82.0    6e-15   Chlorella variabilis
gb|ABK21948.1|  unknown                                               78.6    7e-15   Picea sitchensis
ref|XP_010070002.1|  PREDICTED: protease Do-like 2, chloroplastic     82.0    7e-15   Eucalyptus grandis [rose gum]
ref|XP_010041338.1|  PREDICTED: protease Do-like 2, chloroplastic     82.0    7e-15   Eucalyptus grandis [rose gum]
gb|KHN18478.1|  Protease Do-like 9                                    81.3    7e-15   Glycine soja [wild soybean]
ref|XP_008341479.1|  PREDICTED: protease Do-like 9                    81.6    7e-15   Malus domestica [apple tree]
ref|XP_009348028.1|  PREDICTED: protease Do-like 9                    81.6    8e-15   
gb|KHF97497.1|  Protease Do-like 9                                    79.0    8e-15   Gossypium arboreum [tree cotton]
ref|XP_004357429.1|  hypothetical protein DFA_02707                   81.6    1e-14   Cavenderia fasciculata
ref|XP_007200306.1|  hypothetical protein PRUPE_ppa002853mg           81.3    1e-14   Prunus persica
ref|XP_009349862.1|  PREDICTED: protease Do-like 9                    81.3    1e-14   Pyrus x bretschneideri [bai li]
ref|NP_001136976.1|  uncharacterized protein LOC100217136             77.0    1e-14   
ref|XP_007144565.1|  hypothetical protein PHAVU_007G1665001g          79.7    1e-14   Phaseolus vulgaris [French bean]
ref|XP_006352801.1|  PREDICTED: protease Do-like 2, chloroplastic...  81.3    1e-14   Solanum tuberosum [potatoes]
ref|XP_007144564.1|  hypothetical protein PHAVU_007G1665001g          79.7    1e-14   Phaseolus vulgaris [French bean]
ref|XP_011079745.1|  PREDICTED: protease Do-like 2, chloroplastic     80.9    2e-14   
ref|XP_004965071.1|  PREDICTED: protease Do-like 9-like               80.9    2e-14   Setaria italica
ref|XP_008386612.1|  PREDICTED: protease Do-like 2, chloroplastic     80.9    2e-14   
ref|XP_008659079.1|  PREDICTED: protease Do-like 9                    77.8    2e-14   Zea mays [maize]
ref|XP_010029214.1|  PREDICTED: protease Do-like 9                    80.1    3e-14   Eucalyptus grandis [rose gum]
ref|XP_007036141.1|  Protease Do-like 9 isoform 1                     80.1    3e-14   Theobroma cacao [chocolate]
ref|XP_010323029.1|  PREDICTED: protease Do-like 2, chloroplastic     79.7    4e-14   Solanum lycopersicum
gb|EYU46653.1|  hypothetical protein MIMGU_mgv1a0034321mg             77.4    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_010227815.1|  PREDICTED: protease Do-like 9                    79.3    4e-14   Brachypodium distachyon [annual false brome]
gb|AFK37778.1|  unknown                                               75.5    4e-14   Lotus japonicus
ref|XP_006476739.1|  PREDICTED: protease Do-like 9-like isoform X1    79.3    5e-14   Citrus sinensis [apfelsine]
gb|KDD74963.1|  hypothetical protein H632_c960p1                      79.3    5e-14   Helicosporidium sp. ATCC 50920
ref|XP_640805.1|  hypothetical protein DDB_G0281081                   79.3    6e-14   Dictyostelium discoideum AX4
ref|XP_002511438.1|  serine endopeptidase degp2, putative             79.0    6e-14   Ricinus communis
ref|XP_010684759.1|  PREDICTED: protease Do-like 2, chloroplastic...  79.0    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007050776.1|  DEGP protease 2 isoform 1                        79.0    7e-14   
ref|XP_002982828.1|  hypothetical protein SELMODRAFT_116969           78.6    7e-14   
ref|XP_006476740.1|  PREDICTED: protease Do-like 9-like isoform X2    78.2    7e-14   Citrus sinensis [apfelsine]
ref|XP_006588605.1|  PREDICTED: protease Do-like 2, chloroplastic...  78.6    7e-14   Glycine max [soybeans]
ref|XP_010684757.1|  PREDICTED: protease Do-like 2, chloroplastic...  79.0    8e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003536894.1|  PREDICTED: protease Do-like 2, chloroplastic...  78.6    9e-14   Glycine max [soybeans]
ref|XP_005649879.1|  trypsin-like serine protease                     78.2    9e-14   Coccomyxa subellipsoidea C-169
ref|XP_004252664.1|  PREDICTED: protease Do-like 9                    78.6    1e-13   Solanum lycopersicum
ref|XP_011458665.1|  PREDICTED: protease Do-like 2, chloroplastic...  78.6    1e-13   Fragaria vesca subsp. vesca
ref|XP_005704063.1|  serine-type endopeptidase isoform 2              78.6    1e-13   Galdieria sulphuraria
ref|XP_003520225.1|  PREDICTED: protease Do-like 2, chloroplastic...  78.6    1e-13   Glycine max [soybeans]
ref|XP_004290719.1|  PREDICTED: protease Do-like 2, chloroplastic...  78.6    1e-13   Fragaria vesca subsp. vesca
ref|XP_002981859.1|  hypothetical protein SELMODRAFT_154815           77.8    1e-13   
ref|XP_005704064.1|  serine-type endopeptidase isoform 1              78.2    1e-13   Galdieria sulphuraria
ref|XP_009587779.1|  PREDICTED: protease Do-like 2, chloroplastic...  77.8    1e-13   
ref|XP_011399889.1|  Protease Do-like 9                               77.4    2e-13   Auxenochlorella protothecoides
ref|XP_009587778.1|  PREDICTED: protease Do-like 2, chloroplastic...  77.8    2e-13   Nicotiana tomentosiformis
ref|XP_009587776.1|  PREDICTED: protease Do-like 2, chloroplastic...  77.8    2e-13   Nicotiana tomentosiformis
dbj|BAD15737.1|  putative DegP2 protease                              77.4    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87490.1|  hypothetical protein OsI_08898                        77.4    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009768576.1|  PREDICTED: protease Do-like 2, chloroplastic...  77.8    2e-13   Nicotiana sylvestris
ref|XP_011028602.1|  PREDICTED: protease Do-like 9                    77.4    2e-13   Populus euphratica
ref|XP_006444216.1|  hypothetical protein CICLE_v10019366mg           77.4    2e-13   Citrus clementina [clementine]
ref|XP_009768577.1|  PREDICTED: protease Do-like 2, chloroplastic...  77.4    2e-13   Nicotiana sylvestris
ref|XP_004953885.1|  PREDICTED: protease Do-like 9-like               77.4    2e-13   Setaria italica
ref|XP_009768575.1|  PREDICTED: protease Do-like 2, chloroplastic...  77.4    2e-13   Nicotiana sylvestris
ref|XP_001701981.1|  DegP-type protease                               77.4    3e-13   Chlamydomonas reinhardtii
ref|XP_002452567.1|  hypothetical protein SORBIDRAFT_04g028270        77.4    3e-13   Sorghum bicolor [broomcorn]
ref|XP_006479864.1|  PREDICTED: protease Do-like 2, chloroplastic...  77.0    3e-13   Citrus sinensis [apfelsine]
ref|XP_002270247.1|  PREDICTED: protease Do-like 2, chloroplastic     77.0    3e-13   Vitis vinifera
ref|XP_010545055.1|  PREDICTED: protease Do-like 2, chloroplastic     77.0    3e-13   Tarenaya hassleriana [spider flower]
gb|EEE57793.1|  hypothetical protein OsJ_08344                        76.3    4e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ETO06735.1|  hypothetical protein RFI_30658                        76.3    4e-13   Reticulomyxa filosa
ref|XP_006363999.1|  PREDICTED: protease Do-like 9-like               76.6    4e-13   Solanum tuberosum [potatoes]
ref|XP_006836679.1|  hypothetical protein AMTR_s00088p00077590        76.6    4e-13   Amborella trichopoda
ref|XP_004148888.1|  PREDICTED: protease Do-like 2, chloroplastic...  76.6    4e-13   Cucumis sativus [cucumbers]
ref|XP_004298924.1|  PREDICTED: protease Do-like 9                    76.6    5e-13   Fragaria vesca subsp. vesca
ref|XP_009631856.1|  PREDICTED: protease Do-like 2, chloroplastic...  76.6    5e-13   Nicotiana tomentosiformis
ref|XP_009631857.1|  PREDICTED: protease Do-like 2, chloroplastic...  76.6    5e-13   
dbj|BAK07966.1|  predicted protein                                    76.3    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009773293.1|  PREDICTED: protease Do-like 2, chloroplastic     76.3    6e-13   Nicotiana sylvestris
ref|XP_006389663.1|  hypothetical protein POPTR_0020s00220g           75.9    7e-13   
ref|XP_008368916.1|  PREDICTED: protease Do-like 2, chloroplastic     76.3    7e-13   
gb|AFW64507.1|  hypothetical protein ZEAMMB73_586209                  75.9    7e-13   
ref|XP_009384166.1|  PREDICTED: protease Do-like 2, chloroplastic     75.9    8e-13   
ref|XP_009770716.1|  PREDICTED: protease Do-like 9                    71.2    8e-13   
gb|EMS48865.1|  Protease Do-like 9                                    75.1    8e-13   
gb|AFW76813.1|  hypothetical protein ZEAMMB73_778886                  75.9    9e-13   
ref|XP_008451432.1|  PREDICTED: protease Do-like 2, chloroplastic     75.9    9e-13   
ref|XP_011033618.1|  PREDICTED: protease Do-like 2, chloroplastic     75.9    9e-13   
gb|EMT18472.1|  Protease Do-like protein 9                            75.1    1e-12   
ref|XP_008647464.1|  PREDICTED: uncharacterized protein LOC100217...  75.5    1e-12   
ref|XP_007050777.1|  DEGP protease 2 isoform 2                        75.5    1e-12   
gb|ETO17994.1|  hypothetical protein RFI_19299                        72.4    1e-12   
emb|CBJ48373.1|  conserved unknown protein                            75.1    1e-12   
ref|XP_006289059.1|  hypothetical protein CARUB_v10002456mg           73.9    1e-12   
emb|CDY72455.1|  BnaA10g28640D                                        71.6    2e-12   
ref|XP_006649039.1|  PREDICTED: protease Do-like 9-like               74.3    2e-12   
ref|XP_008643959.1|  PREDICTED: uncharacterized protein LOC100381...  74.7    2e-12   
ref|XP_002280249.1|  PREDICTED: protease Do-like 9                    74.7    2e-12   
emb|CAN74170.1|  hypothetical protein VITISV_013882                   74.7    2e-12   
ref|XP_010941774.1|  PREDICTED: protease Do-like 2, chloroplastic     74.7    2e-12   
ref|XP_009609244.1|  PREDICTED: protease Do-like 9                    74.7    2e-12   
ref|XP_002511437.1|  serine endopeptidase degp2, putative             74.3    2e-12   
ref|NP_568577.1|  DegP protease 9                                     74.7    2e-12   
ref|XP_004495997.1|  PREDICTED: protease Do-like 2, chloroplastic...  74.7    2e-12   
ref|XP_008800525.1|  PREDICTED: protease Do-like 2, chloroplastic     74.7    2e-12   
gb|KDP28079.1|  hypothetical protein JCGZ_13850                       74.7    2e-12   
ref|XP_010913539.1|  PREDICTED: protease Do-like 9 isoform X1         73.9    3e-12   
gb|KEH43264.1|  DegP protease                                         73.9    3e-12   
emb|CBI15070.3|  unnamed protein product                              73.2    4e-12   
gb|KDO69730.1|  hypothetical protein CISIN_1g007213mg                 73.9    4e-12   
ref|XP_006439771.1|  hypothetical protein CICLE_v10019344mg           73.9    4e-12   
ref|XP_001774430.1|  predicted protein                                73.2    4e-12   
ref|XP_010247118.1|  PREDICTED: protease Do-like 2, chloroplastic     73.6    5e-12   
gb|KJB47048.1|  hypothetical protein B456_008G008100                  73.6    5e-12   
ref|XP_011082504.1|  PREDICTED: protease Do-like 2, chloroplastic     73.6    5e-12   
ref|XP_010913540.1|  PREDICTED: protease Do-like 9 isoform X2         72.8    5e-12   
ref|XP_002520690.1|  serine endopeptidase degp2, putative             73.6    5e-12   
ref|XP_007140930.1|  hypothetical protein PHAVU_008G153200g           73.2    5e-12   
ref|XP_006283387.1|  hypothetical protein CARUB_v10004432mg           73.2    6e-12   
ref|XP_010424502.1|  PREDICTED: putative protease Do-like 12, mit...  73.2    6e-12   
gb|KJB47046.1|  hypothetical protein B456_008G008100                  73.2    6e-12   
emb|CDX99642.1|  BnaC04g33990D                                        72.8    7e-12   
ref|XP_010554015.1|  PREDICTED: protease Do-like 9                    72.8    8e-12   
ref|XP_010450719.1|  PREDICTED: protease Do-like 9                    72.8    9e-12   
ref|XP_008793849.1|  PREDICTED: protease Do-like 9                    72.8    9e-12   
ref|XP_001633828.1|  predicted protein                                72.4    1e-11   
ref|XP_006366368.1|  PREDICTED: protease Do-like 2, chloroplastic...  72.8    1e-11   
ref|XP_008780936.1|  PREDICTED: protease Do-like 9                    72.4    1e-11   
ref|XP_005827715.1|  hypothetical protein GUITHDRAFT_164606           72.0    1e-11   
emb|CDP02143.1|  unnamed protein product                              69.3    2e-11   
emb|CDY44585.1|  BnaA04g10050D                                        71.6    2e-11   
ref|XP_009139975.1|  PREDICTED: protease Do-like 9                    71.6    2e-11   
ref|XP_007217173.1|  hypothetical protein PRUPE_ppa003383mg           71.6    2e-11   
emb|CDY53116.1|  BnaCnng24440D                                        71.6    2e-11   
ref|XP_010528270.1|  PREDICTED: protease Do-like 9                    71.6    2e-11   
gb|KFK33145.1|  hypothetical protein AALP_AA6G336800                  71.2    3e-11   
emb|CAN62736.1|  hypothetical protein VITISV_027750                   71.2    3e-11   
ref|XP_010254399.1|  PREDICTED: protease Do-like 9 isoform X1         71.2    3e-11   
ref|XP_002275131.1|  PREDICTED: protease Do-like 9                    71.2    3e-11   
gb|KFG27726.1|  trypsin domain protein                                68.6    3e-11   
ref|XP_004247469.1|  PREDICTED: protease Do-like 2, chloroplastic     71.2    3e-11   
ref|XP_008230646.1|  PREDICTED: protease Do-like 9                    71.2    3e-11   
emb|CBI34956.3|  unnamed protein product                              70.9    3e-11   
gb|KDP45394.1|  hypothetical protein JCGZ_09643                       71.2    3e-11   
gb|KJB08193.1|  hypothetical protein B456_001G070400                  70.9    3e-11   
emb|CBI32271.3|  unnamed protein product                              70.9    4e-11   
ref|XP_010506841.1|  PREDICTED: protease Do-like 2, chloroplastic     70.9    4e-11   
ref|NP_001118544.1|  DegP2 protease                                   70.5    5e-11   
ref|NP_566115.1|  DegP2 protease                                      70.5    5e-11   
ref|XP_002882138.1|  hypothetical protein ARALYDRAFT_483986           70.5    5e-11   
ref|XP_010507830.1|  PREDICTED: protease Do-like 2, chloroplastic     70.5    5e-11   
ref|XP_002863059.1|  hypothetical protein ARALYDRAFT_497185           70.5    5e-11   
gb|KFK37547.1|  hypothetical protein AALP_AA4G271000                  70.5    5e-11   
gb|KFK37548.1|  hypothetical protein AALP_AA4G271000                  70.5    5e-11   
ref|XP_006295823.1|  hypothetical protein CARUB_v10024950mg           70.5    5e-11   
pdb|4FLN|A  Chain A, Crystal Structure Of Plant Protease Deg2         70.5    5e-11   
ref|XP_010236126.1|  PREDICTED: protease Do-like 9 isoform X1         70.5    5e-11   
ref|XP_005537155.1|  DegP protease                                    70.5    5e-11   
ref|XP_002868670.1|  hypothetical protein ARALYDRAFT_493972           70.5    6e-11   
ref|XP_006405537.1|  hypothetical protein EUTSA_v10027697mg           70.5    6e-11   
ref|XP_004306333.2|  PREDICTED: protease Do-like 9                    70.1    6e-11   
ref|XP_002875030.1|  predicted protein                                70.1    7e-11   
ref|XP_011465390.1|  PREDICTED: protease Do-like 9                    65.5    9e-11   
ref|XP_008341480.1|  PREDICTED: protease Do-like 9                    69.7    1e-10   
ref|XP_007031392.1|  Protease Do-like 9 isoform 1                     69.7    1e-10   
ref|XP_010111534.1|  Protease Do-like 9                               69.7    1e-10   
ref|XP_009118165.1|  PREDICTED: protease Do-like 2, chloroplastic     69.7    1e-10   
emb|CDY15934.1|  BnaA04g11770D                                        69.3    1e-10   
gb|KFG45747.1|  trypsin domain-containing protein                     67.0    1e-10   
ref|XP_009140230.1|  PREDICTED: protease Do-like 9                    69.3    1e-10   
emb|CDP03552.1|  unnamed protein product                              68.9    1e-10   
ref|XP_006397989.1|  hypothetical protein EUTSA_v10001363mg           69.3    1e-10   
gb|KHF97808.1|  Protease Do-like 9                                    68.2    1e-10   
ref|XP_010272003.1|  PREDICTED: protease Do-like 9                    69.3    1e-10   
ref|XP_010518515.1|  PREDICTED: protease Do-like 2, chloroplastic...  68.9    2e-10   
ref|XP_010518514.1|  PREDICTED: protease Do-like 2, chloroplastic...  68.9    2e-10   
ref|XP_003516811.1|  PREDICTED: protease Do-like 9-like               68.6    2e-10   
gb|KFH12639.1|  trypsin domain-containing protein                     67.8    3e-10   
ref|XP_003057446.1|  predicted protein                                68.2    3e-10   
ref|XP_002974405.1|  hypothetical protein SELMODRAFT_100929           68.2    3e-10   
ref|XP_005644766.1|  trypsin-like serine protease                     67.8    3e-10   
ref|XP_005845738.1|  hypothetical protein CHLNCDRAFT_58432            68.6    3e-10   
ref|XP_011011013.1|  PREDICTED: LOW QUALITY PROTEIN: protease Do-...  68.2    3e-10   
ref|XP_010236127.1|  PREDICTED: protease Do-like 9 isoform X2         67.0    5e-10   
ref|XP_002517376.1|  serine endopeptidase degp2, putative             67.4    6e-10   
ref|XP_010437094.1|  PREDICTED: putative protease Do-like 11, mit...  67.0    6e-10   
gb|KJB40785.1|  hypothetical protein B456_007G077100                  66.6    1e-09   
gb|KJB40786.1|  hypothetical protein B456_007G077100                  66.6    1e-09   
gb|KDO77071.1|  hypothetical protein CISIN_1g007765mg                 65.9    1e-09   
ref|WP_038960950.1|  hypothetical protein                             65.9    2e-09   
ref|XP_009348035.1|  PREDICTED: protease Do-like 9                    65.5    2e-09   
ref|XP_007216372.1|  hypothetical protein PRUPE_ppa021785mg           65.5    2e-09   
ref|XP_002985706.1|  hypothetical protein SELMODRAFT_122577           65.5    2e-09   
ref|XP_002948745.1|  hypothetical protein VOLCADRAFT_58517            65.5    2e-09   
ref|XP_007028416.1|  DegP protease 10 isoform 3                       65.5    2e-09   
emb|CDR95924.1|  DegP protease, putative                              65.5    3e-09   
gb|AFW73360.1|  hypothetical protein ZEAMMB73_819902                  65.5    3e-09   
emb|CDX93500.1|  BnaA06g05480D                                        63.2    3e-09   
ref|XP_009349861.1|  PREDICTED: protease Do-like 9                    65.1    4e-09   
gb|EWM29653.1|  protease do-like 9                                    64.7    4e-09   
gb|KCW54067.1|  hypothetical protein EUGRSUZ_I00047                   64.7    4e-09   
ref|WP_035698046.1|  hypothetical protein                             64.3    4e-09   
ref|XP_008776775.1|  PREDICTED: protease Do-like 10, mitochondria...  64.3    4e-09   
ref|XP_008230647.1|  PREDICTED: protease Do-like 9                    64.7    4e-09   
ref|WP_029716855.1|  hypothetical protein                             63.5    4e-09   
gb|EWM29652.1|  protease do-like 9                                    64.7    5e-09   
ref|XP_002870693.1|  hypothetical protein ARALYDRAFT_493929           63.2    8e-09   
ref|XP_005650005.1|  trypsin-like serine protease                     63.5    1e-08   
emb|CDY27464.1|  BnaC04g51050D                                        63.5    1e-08   
ref|XP_008235077.1|  PREDICTED: protease Do-like 2, chloroplastic     63.5    1e-08   
ref|XP_004306334.1|  PREDICTED: protease Do-like 9                    63.2    1e-08   
emb|CDY55521.1|  BnaA04g29470D                                        63.2    1e-08   
ref|XP_004829939.1|  serine protease, putative                        62.0    3e-08   
ref|XP_002154609.2|  PREDICTED: protease Do-like 10, mitochondria...  62.0    4e-08   
ref|XP_002958880.1|  serine protease                                  61.2    6e-08   
ref|XP_007031393.1|  Protease Do-like 9 isoform 2                     60.8    7e-08   
ref|XP_009344539.1|  PREDICTED: protease Do-like 9 isoform X1         60.8    8e-08   
ref|XP_009344540.1|  PREDICTED: protease Do-like 9 isoform X2         60.8    8e-08   
gb|KHG10017.1|  Protease Do-like 9                                    57.0    1e-07   
ref|XP_002862794.1|  hypothetical protein ARALYDRAFT_920262           60.1    1e-07   
emb|CCF73353.1|  unnamed protein product                              60.1    1e-07   
emb|CAX68967.1|  periplasmic serine endoprotease of the DegP/Htr ...  59.7    2e-07   
ref|XP_001610362.1|  DegP protease                                    59.3    2e-07   
ref|XP_005831529.1|  hypothetical protein GUITHDRAFT_72154            58.5    3e-07   
ref|XP_008348037.1|  PREDICTED: protease Do-like 9                    58.5    4e-07   
gb|EMT08042.1|  Protease Do-like protein 9                            58.5    4e-07   
ref|XP_005779861.1|  hypothetical protein EMIHUDRAFT_430070           58.5    4e-07   
ref|XP_001748733.1|  hypothetical protein                             58.5    5e-07   
ref|XP_006289341.1|  hypothetical protein CARUB_v10002825mg           58.2    5e-07   
ref|XP_001417982.1|  predicted protein                                57.0    1e-06   
ref|WP_027353863.1|  hypothetical protein                             57.0    1e-06   
ref|WP_013043489.1|  hypothetical protein                             56.6    1e-06   
gb|EJK64737.1|  hypothetical protein THAOC_14498                      56.6    2e-06   
ref|XP_002286231.1|  trypsin-like serine protease                     56.2    2e-06   
ref|XP_006439769.1|  hypothetical protein CICLE_v10019344mg           56.2    2e-06   
ref|XP_005774372.1|  hypothetical protein EMIHUDRAFT_74740            56.2    2e-06   
ref|XP_005767710.1|  hypothetical protein EMIHUDRAFT_103267           56.2    3e-06   
gb|KDO69729.1|  hypothetical protein CISIN_1g007213mg                 55.8    3e-06   
ref|XP_006439770.1|  hypothetical protein CICLE_v10019344mg           54.7    6e-06   
ref|XP_006439772.1|  hypothetical protein CICLE_v10019344mg           54.7    7e-06   
ref|WP_012831747.1|  peptidase S1 and S6 chymotrypsin/Hap             54.7    7e-06   
gb|EPG65824.1|  PDZ domain protein                                    54.3    9e-06   
ref|WP_040508656.1|  serine protease                                  54.3    9e-06   
ref|XP_011400998.1|  Protease Do-like 9                               54.7    9e-06   
ref|XP_004989115.1|  hypothetical protein PTSG_09760                  54.3    1e-05   
gb|EJK72666.1|  hypothetical protein THAOC_05779                      53.5    1e-05   
gb|KHN03752.1|  Protease Do-like 2, chloroplastic                     54.3    1e-05   
gb|EJK64993.1|  hypothetical protein THAOC_14214                      53.9    1e-05   
ref|XP_003079294.1|  putative DegP2 protease (ISS)                    53.9    2e-05   
emb|CEF97941.1|  Serine endopeptidase DegP2                           53.5    2e-05   
ref|WP_013942997.1|  protease Do-like 10                              53.5    2e-05   
ref|XP_005855197.1|  trypsin family                                   53.1    2e-05   
ref|XP_009689126.1|  serine protease                                  52.8    3e-05   
ref|XP_005855002.1|  trypsin family                                   52.8    3e-05   
gb|KHG27181.1|  Protease Do-like 9                                    52.4    3e-05   
ref|WP_020770056.1|  PDZ domain protein                               52.4    4e-05   
ref|XP_954412.1|  serine protease (zymogen-like)                      52.0    5e-05   
ref|XP_006391634.1|  hypothetical protein EUTSA_v10023879mg           51.6    6e-05   
ref|XP_005851872.1|  hypothetical protein CHLNCDRAFT_56559            50.8    7e-05   
ref|XP_005714405.1|  unnamed protein product                          51.6    7e-05   
ref|NP_001168096.1|  uncharacterized protein LOC100381831             50.4    8e-05   
emb|CBX27101.1|  Protease Do-like 10, mitochondrial                   51.6    8e-05   
ref|XP_005717038.1|  unnamed protein product                          50.8    9e-05   
gb|AFW64508.1|  hypothetical protein ZEAMMB73_586209                  51.2    1e-04   
ref|WP_021745262.1|  trypsin                                          50.8    1e-04   
ref|WP_017852793.1|  serine protease                                  50.8    1e-04   
ref|XP_010112729.1|  hypothetical protein L484_020456                 50.8    1e-04   
gb|KHN46596.1|  Protease Do-like 2, chloroplastic                     50.8    1e-04   
gb|KHN01751.1|  Protease Do-like 9                                    48.1    2e-04   
gb|ABW31588.1|  trypsin-like serine protease, putative                50.1    2e-04   
gb|ETO12956.1|  trypsin                                               49.7    2e-04   
ref|WP_041661167.1|  hypothetical protein                             50.1    2e-04   
gb|ABW33227.1|  protease, putative                                    50.1    2e-04   
ref|XP_765845.1|  serine protease                                     49.7    3e-04   
ref|WP_008588716.1|  serine protease                                  49.7    3e-04   
gb|EWM23097.1|  protease do-like 2                                    49.7    3e-04   
ref|WP_020036438.1|  hypothetical protein                             49.3    4e-04   
ref|XP_005764176.1|  hypothetical protein EMIHUDRAFT_247734           49.3    4e-04   
ref|WP_033407281.1|  hypothetical protein                             49.3    4e-04   
ref|XP_004339571.1|  trypsin domain containing protein                49.3    5e-04   
ref|WP_000944569.1|  serine protease                                  49.3    5e-04   
ref|WP_000944573.1|  serine protease                                  49.3    5e-04   
ref|WP_004766531.1|  hypothetical protein                             49.3    5e-04   
ref|WP_004762765.1|  hypothetical protein                             48.9    5e-04   
emb|CDI77426.1|  hypothetical protein EAH_00024440                    49.3    5e-04   
ref|WP_020035256.1|  MULTISPECIES: hypothetical protein               48.9    5e-04   
ref|WP_020765310.1|  hypothetical protein                             48.9    5e-04   
ref|WP_004760000.1|  hypothetical protein                             48.9    5e-04   
ref|WP_020779408.1|  hypothetical protein                             48.9    5e-04   
ref|WP_004757632.1|  serine protease                                  48.9    5e-04   
gb|EPS65237.1|  hypothetical protein M569_09541                       48.9    5e-04   
ref|WP_004750201.1|  serine protease                                  48.9    6e-04   
ref|WP_000944574.1|  serine protease                                  48.5    7e-04   
ref|WP_002102012.1|  PDZ domain protein                               48.5    7e-04   
ref|WP_020985403.1|  PDZ domain protein                               48.5    8e-04   
ref|WP_004454582.1|  hypothetical protein                             48.5    8e-04   
ref|WP_004449692.1|  hypothetical protein                             48.5    9e-04   
ref|WP_004435666.1|  hypothetical protein                             48.5    9e-04   
ref|WP_004452494.1|  hypothetical protein                             48.1    0.001   
ref|WP_004429497.1|  hypothetical protein                             48.1    0.001   



>ref|XP_009611385.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana tomentosiformis]
Length=593

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP KPGEQ +ILSQVL+DDIN GYERLAELQV KVNGVEV NL
Sbjct  466  DWYNASPRRLCERALRELPKKPGEQFIILSQVLMDDINAGYERLAELQVKKVNGVEVLNL  525

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHLR+LVED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMSSDL +DE A 
Sbjct  526  KHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSSDLTDDENAV  585

Query  364  ALELACSN  387
             L+ ACS+
Sbjct  586  ELQSACSS  593



>ref|XP_009803816.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana sylvestris]
Length=593

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP KPGEQ +ILSQVL+DDIN GYERLAELQV KVNGVEV NL
Sbjct  466  DWYNASPRRLCERALRELPKKPGEQFIILSQVLMDDINAGYERLAELQVKKVNGVEVLNL  525

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHLR+LVED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMS+DL +DE A 
Sbjct  526  KHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSTDLTDDENAA  585

Query  364  ALELACSN  387
             L+ ACS+
Sbjct  586  ELQSACSS  593



>gb|EYU39504.1| hypothetical protein MIMGU_mgv1a003194mg [Erythranthe guttata]
Length=601

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP KPG+Q VILSQVL+DDINTGYERLA+LQV KVNGVEV+NL
Sbjct  474  DWYNASPRRLCERALRELPQKPGQQFVILSQVLMDDINTGYERLADLQVKKVNGVEVDNL  533

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHLR+LVED   E +RFDLDDERVIVLNYD AK ATSRILKRHRIP AMS DLI ++   
Sbjct  534  KHLRQLVEDGGNENVRFDLDDERVIVLNYDSAKTATSRILKRHRIPSAMSDDLIEEQDVS  593

Query  364  ALELACS  384
             +E+ACS
Sbjct  594  VIEVACS  600



>ref|XP_011077091.1| PREDICTED: protease Do-like 10, mitochondrial [Sesamum indicum]
Length=596

 Score =   209 bits (532),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 95/127 (75%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K G+QLVILSQVL+DDINTGYERL++LQV KVNG+EV+NL
Sbjct  469  DWYNTSPRRLCERALRELPQKTGQQLVILSQVLMDDINTGYERLSDLQVKKVNGIEVDNL  528

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHLR+LVE++S++ +RFDLDD+RVIVLNY+ AK+AT+RILKRHRIP AMSSDL+++E   
Sbjct  529  KHLRQLVENSSRDNVRFDLDDDRVIVLNYNSAKMATTRILKRHRIPSAMSSDLVDEEGGS  588

Query  364  ALELACS  384
             +ELAC+
Sbjct  589  NIELACA  595



>ref|XP_006353238.1| PREDICTED: protease Do-like 10, mitochondrial-like [Solanum tuberosum]
Length=597

 Score =   207 bits (527),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 96/127 (76%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            +WYNTSPRRLCERALR+LP KPGEQ +ILSQVL+DDIN GYERLAELQV KVNGVEV NL
Sbjct  470  EWYNTSPRRLCERALRELPKKPGEQFIILSQVLMDDINAGYERLAELQVKKVNGVEVLNL  529

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHLR+LVED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMS DL +++ A 
Sbjct  530  KHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSIDLTDEQNAA  589

Query  364  ALELACS  384
             L+ ACS
Sbjct  590  ELQSACS  596



>ref|XP_002265825.2| PREDICTED: protease Do-like 10, mitochondrial [Vitis vinifera]
 emb|CBI33040.3| unnamed protein product [Vitis vinifera]
Length=564

 Score =   206 bits (524),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNT PRRLCERALR+LPT+PGEQ+VILSQVL+DDIN GYERLA+LQV KVNGVE++NL
Sbjct  437  DWYNTCPRRLCERALRELPTRPGEQIVILSQVLMDDINAGYERLADLQVKKVNGVEIKNL  496

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KH  +LVE+ S E +RFDLDDERVIVLNY LAK+ATSRILKRHRIP AMS DLI  + + 
Sbjct  497  KHFSQLVENCSMESLRFDLDDERVIVLNYQLAKIATSRILKRHRIPSAMSRDLIQKQDSS  556

Query  364  ALELAC  381
              ELAC
Sbjct  557  EAELAC  562



>ref|XP_004250091.1| PREDICTED: protease Do-like 10, mitochondrial [Solanum lycopersicum]
Length=595

 Score =   204 bits (519),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            +WYNTSPRRLCERALR+LP KPGEQ VILSQVL+DDIN GYERLAELQV KVNGVEV NL
Sbjct  470  EWYNTSPRRLCERALRELPKKPGEQFVILSQVLMDDINAGYERLAELQVKKVNGVEVLNL  529

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHLR+LVED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMS DL +++ A 
Sbjct  530  KHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSIDLTDEQNAA  589

Query  364  ALELAC  381
             L  AC
Sbjct  590  ELLSAC  595



>ref|XP_010927886.1| PREDICTED: protease Do-like 10, mitochondrial [Elaeis guineensis]
Length=568

 Score =   199 bits (506),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 97/129 (75%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERL+ELQV KVNGVEVENL
Sbjct  440  DWYNTSPRRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLSELQVKKVNGVEVENL  499

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDEC-A  360
            KHL +LVE  S+E +RFDLDDERVIVLNY  A++ATSRIL RHRIP AMSSDLI+D+   
Sbjct  500  KHLCELVEGCSEESLRFDLDDERVIVLNYQNARLATSRILNRHRIPSAMSSDLIDDQTNV  559

Query  361  PALELACSN  387
              +++ACS+
Sbjct  560  SEIKVACSS  568



>ref|XP_010277816.1| PREDICTED: protease Do-like 10, mitochondrial [Nelumbo nucifera]
Length=573

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K GEQLVILSQVL+DD+NTGYERLAE+QV KVNGVEVENL
Sbjct  445  DWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDVNTGYERLAEMQVKKVNGVEVENL  504

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVED S+E +RFDLDD+RVIVLNY  AKVATSRILKRHRIP AMS+DLI ++
Sbjct  505  KHLCRLVEDCSEESLRFDLDDDRVIVLNYQSAKVATSRILKRHRIPSAMSNDLIEEQ  561



>ref|XP_008776774.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Phoenix 
dactylifera]
Length=568

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERL+ELQV K NGVEVENL
Sbjct  440  DWYNTSPRRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLSELQVKKANGVEVENL  499

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDEC-A  360
            KHL +LVE  S+E +RFDLDDERVIVLNY  A++ATSRILKRHRIP AMSSDLIND+   
Sbjct  500  KHLCELVEGCSEESLRFDLDDERVIVLNYQNARLATSRILKRHRIPSAMSSDLINDQTNV  559

Query  361  PALELACSN  387
              +++ACS+
Sbjct  560  SEIKVACSS  568



>gb|EPS59937.1| hypothetical protein M569_14869, partial [Genlisea aurea]
Length=196

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 106/115 (92%), Gaps = 1/115 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K G+QL+ILSQVL+DDINTGYERLA+LQV KVNG+EV+NL
Sbjct  82   DWYNTSPRRLCERALRELPRKGGQQLIILSQVLMDDINTGYERLADLQVKKVNGIEVDNL  141

Query  184  KHLRKLVED-NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
             HLR+LVED +S+E IRFD+DDERV+VLNY LAKVATSR+LKRHRIP A+S DLI
Sbjct  142  VHLRRLVEDSHSREVIRFDMDDERVMVLNYSLAKVATSRVLKRHRIPSAVSWDLI  196



>emb|CDP04134.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K GE+LVILSQVL+DDINTGYERLAELQV KV+ VEVENL
Sbjct  463  DWYNTSPRRLCERALRELPRKAGEELVILSQVLMDDINTGYERLAELQVKKVDNVEVENL  522

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVE   KE IRFDLDDERVIVLNY +AKVATSRIL+RHRIP AMS DL+N+E
Sbjct  523  KHLCQLVEGCEKEAIRFDLDDERVIVLNYSMAKVATSRILQRHRIPNAMSGDLLNNE  579



>ref|XP_006468667.1| PREDICTED: protease Do-like 10, mitochondrial-like [Citrus sinensis]
 gb|KDO77070.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=590

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K GEQLVILSQVL+DDIN GYER A+LQV KVNGVE+ENL
Sbjct  458  DWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENL  517

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL +LVE+ S E +RFDLDD+RV+VLNYD+AK+ATS+ILKRHRIP AMS DL N E   
Sbjct  518  KHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAMSGDL-NGEQIS  576

Query  364  ALELA  378
             +ELA
Sbjct  577  EIELA  581



>ref|XP_010528621.1| PREDICTED: protease Do-like 10, mitochondrial [Tarenaya hassleriana]
Length=594

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN+SPRRLCERALR LP K GEQLVILSQVL+DDINTGYERLAELQV KVNGVEV+NL
Sbjct  467  DWYNSSPRRLCERALRDLPKKAGEQLVILSQVLMDDINTGYERLAELQVKKVNGVEVDNL  526

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +L+E  S E +R DLDDERVIVLNY  AK+ATSRILKRHRIP +MSSDL++++   
Sbjct  527  RHLCQLIEKCSDENLRLDLDDERVIVLNYPFAKIATSRILKRHRIPSSMSSDLLSEQNTA  586

Query  364  ALELACS  384
               +AC+
Sbjct  587  TESVACA  593



>ref|XP_006448510.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
 gb|ESR61750.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
Length=590

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K GEQLVILSQVL+DDIN GYER A+LQV KVNGVE+ENL
Sbjct  458  DWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENL  517

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL +LVE+ S E +RFDLDD+RV+VLNYD+AK+ATS+ILKRHRIP A+S DL N E   
Sbjct  518  KHLCQLVENCSTENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSALSGDL-NGEQIS  576

Query  364  ALELA  378
             +ELA
Sbjct  577  EIELA  581



>ref|XP_004962074.1| PREDICTED: protease Do-like 10, mitochondrial-like [Setaria italica]
Length=586

 Score =   192 bits (488),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLV+LSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  458  DWYNASPRRLCERALRELPKKAGEQLVVLSQVLMDDINVGYERLAELQVKKVNGVEVENL  517

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  LVE  ++E +RFDLDDERVI+L Y  A++ATSR+LKRHRIP AMSSDL+ ++   
Sbjct  518  KHLCSLVESCTEENLRFDLDDERVIILKYQNARLATSRVLKRHRIPSAMSSDLVEEQATN  577

Query  364  A-LELACSN  387
              +E +C++
Sbjct  578  GEVEASCTS  586



>gb|ACF84354.1| unknown [Zea mays]
Length=446

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  318  DWYNASPRRLCERALRELPKKTGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  377

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  LVE  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ D+   
Sbjct  378  KHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVEDQVTD  437

Query  364  A-LELACSN  387
              +E +C++
Sbjct  438  GEVETSCTS  446



>ref|XP_002441105.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
 gb|EES19535.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
Length=587

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  459  DWYNASPRRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  518

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  LVE  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ DE   
Sbjct  519  KHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVQDEATN  578

Query  364  A-LELACSN  387
              +E +C++
Sbjct  579  GEVETSCTS  587



>ref|XP_004155122.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus]
Length=601

 Score =   191 bits (485),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 93/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP KPGEQ VILSQVL+DDIN GYERLAELQV KVNGVEV+NL
Sbjct  475  DWYNTSPRRLCERALRELPKKPGEQFVILSQVLMDDINAGYERLAELQVKKVNGVEVDNL  534

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL +LV D S++ +RFDLDD+RVIVLN+++AK+ATSRIL RHRIP A+S DL+ D    
Sbjct  535  KHLCQLV-DKSEDSVRFDLDDDRVIVLNFEMAKIATSRILNRHRIPSALSHDLMEDLSFH  593

Query  364  ALELACSN  387
              +LA S+
Sbjct  594  NSQLASSS  601



>ref|XP_004152886.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus]
 gb|KGN61234.1| hypothetical protein Csa_2G072480 [Cucumis sativus]
Length=601

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP KPGEQ VILSQVL+DDIN GYERLAELQV KVNGVEV+NL
Sbjct  475  DWYNTSPRRLCERALRELPKKPGEQFVILSQVLMDDINAGYERLAELQVKKVNGVEVDNL  534

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL +LV D S++ +RFDLDD+RVIVLN+++AK+ATSRILKRHRIP A+S DL+ D    
Sbjct  535  KHLCQLV-DKSEDSVRFDLDDDRVIVLNFEMAKIATSRILKRHRIPSALSHDLMEDLSFH  593

Query  364  ALELACSN  387
              +LA S+
Sbjct  594  NSQLASSS  601



>ref|XP_002463281.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
 gb|EER99802.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
Length=586

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  458  DWYNASPRRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  517

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  LVE  ++E +RFDLDDERVIVL Y  AK+ATSR+LKRHRIP A+SSDL+ DE   
Sbjct  518  KHLCSLVEGCTEENLRFDLDDERVIVLKYQNAKLATSRVLKRHRIPSAISSDLVEDEPTN  577

Query  364  A-LELACSN  387
              +E +C++
Sbjct  578  GEVETSCTS  586



>gb|EMS52153.1| Protease Do-like 10, mitochondrial [Triticum urartu]
Length=585

 Score =   191 bits (484),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K G+QLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  457  DWYNASPRRLCERALRELPKKAGQQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  516

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  +VE+ ++E +R DLDDERVIVL +  A++ATSRILKRHRIP AMSSDL++++ + 
Sbjct  517  KHLCSIVENCTEENLRIDLDDERVIVLKFQNARLATSRILKRHRIPSAMSSDLVDEQASK  576

Query  364  A-LELACSN  387
               E +C+N
Sbjct  577  GETEASCTN  585



>ref|NP_001142088.1| hypothetical protein [Zea mays]
 gb|ACF87611.1| unknown [Zea mays]
 gb|AFW78022.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=556

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  428  DWYNASPRRLCERALRELPKKTGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  487

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  LVE  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ D+   
Sbjct  488  KHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVEDQVTD  547

Query  364  A-LELACSN  387
              +E +C++
Sbjct  548  GEVETSCTS  556



>ref|XP_006858733.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
 gb|ERN20200.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
Length=573

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K GEQLVILSQVL+D+IN GYERLAELQV KVNGVE++NL
Sbjct  446  DWYNTSPRRLCERALRELPEKVGEQLVILSQVLMDEINVGYERLAELQVKKVNGVEIDNL  505

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            KHL +LVED  +E +RFDLDDERV+VLNY+ AK+ATSRILKRHRIP AMS+DL++
Sbjct  506  KHLCELVEDCKEESLRFDLDDERVVVLNYNKAKLATSRILKRHRIPSAMSTDLLD  560



>ref|XP_008647597.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW78023.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=585

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  457  DWYNASPRRLCERALRELPKKTGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  516

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  LVE  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ D+   
Sbjct  517  KHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVEDQVTD  576

Query  364  A-LELACSN  387
              +E +C++
Sbjct  577  GEVETSCTS  585



>gb|KDP32493.1| hypothetical protein JCGZ_13418 [Jatropha curcas]
Length=565

 Score =   189 bits (479),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR LP K GEQLVILSQVL+DDIN GYERLAELQV +VNGVE+ENL
Sbjct  441  DWYNTSPRRLCERALRDLPKKAGEQLVILSQVLMDDINAGYERLAELQVKEVNGVEIENL  500

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  +VE  + E +RFDLDD+RVIVLNY  A+VATSRILKRHRIP  MS DL++++   
Sbjct  501  KHLCHIVERCTAESLRFDLDDDRVIVLNYSSARVATSRILKRHRIPSPMSRDLVDEQSEL  560

Query  364  ALELA  378
              E+A
Sbjct  561  ESEMA  565



>ref|XP_006655329.1| PREDICTED: protease Do-like 10, mitochondrial-like [Oryza brachyantha]
Length=475

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNG+EVENL
Sbjct  342  DWYNNSPRRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKKVNGIEVENL  401

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECA  360
            KHL  LVE  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+SSDL++++  
Sbjct  402  KHLCSLVEGCTEENLRFDLDDERVIVLKYKNAKLATSRILKRHRIPSAISSDLVDEQAT  460



>ref|XP_011011698.1| PREDICTED: protease Do-like 10, mitochondrial [Populus euphratica]
Length=580

 Score =   187 bits (475),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            +WYNTSPRRLCERAL++LP K  +QL+ILSQVL+DDIN GYERLAELQV KVNGVE++N+
Sbjct  453  EWYNTSPRRLCERALKELPKKADQQLIILSQVLMDDINAGYERLAELQVKKVNGVEIDNM  512

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL +LV D S E +RFDLDD+RVI LNY  AKVATSRILKRHRIP AMSSDL  ++  P
Sbjct  513  KHLCQLVGDCSSESLRFDLDDDRVIALNYQSAKVATSRILKRHRIPSAMSSDLSAEQNIP  572

Query  364  ALELACSN  387
              E A S+
Sbjct  573  ESESASSS  580



>ref|XP_009420477.1| PREDICTED: protease Do-like 10, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=564

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERL+E QV KVN VEVENL
Sbjct  436  DWYNTSPRRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLSEFQVKKVNDVEVENL  495

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL  L+E  ++E IR DLDDERVIVLNY  A++ATSRILKRHRIP AMS+DLI+++   
Sbjct  496  KHLCGLIEGCTEESIRLDLDDERVIVLNYKNARLATSRILKRHRIPSAMSNDLIDEQATN  555

Query  364  A-LELACSN  387
              +E+ACS+
Sbjct  556  GEVEVACSS  564



>ref|XP_010110145.1| Protease Do-like 10 [Morus notabilis]
 gb|EXC25314.1| Protease Do-like 10 [Morus notabilis]
Length=542

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNT+PR LC+RALR+LP KPGEQLVILSQVL+DD+N GYERLAELQV KVNG+E+ENL
Sbjct  425  DWYNTAPRSLCQRALRELPKKPGEQLVILSQVLMDDVNAGYERLAELQVKKVNGLEIENL  484

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVE+N+++ +RFDLDDERVI LNY+ AK+ATS+ILK HRIP AMS DL +++
Sbjct  485  KHLCQLVENNTEDNVRFDLDDERVIALNYNSAKIATSKILKWHRIPSAMSKDLADEK  541



>ref|XP_008224670.1| PREDICTED: protease Do-like 10, mitochondrial [Prunus mume]
Length=595

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCE ALR+ P + GEQL+ILSQVL+DDIN GYERLAELQV KVNG+EVENL
Sbjct  465  DWYNTSPRRLCESALREPPKRAGEQLIILSQVLMDDINAGYERLAELQVKKVNGIEVENL  524

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVE+ SKE +RFDLDD+RVIVLN+ LAKVATS+ILK HRIP AMS+DLI+ +
Sbjct  525  KHLCQLVENCSKESVRFDLDDDRVIVLNHSLAKVATSKILKCHRIPSAMSNDLIDKQ  581



>ref|XP_007211387.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
 gb|EMJ12586.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
Length=595

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCE ALR+ P + GEQLVILSQVL+DDIN GYERLAELQV KVNG+EVENL
Sbjct  465  DWYNTSPRRLCESALREPPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEVENL  524

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KH+ +LVE+ SKE +RFDLDD+RVIVLN+ LAKVATS+ILK HRIP AMS+DLI+ +
Sbjct  525  KHICQLVENCSKESVRFDLDDDRVIVLNHSLAKVATSKILKCHRIPSAMSNDLIDKQ  581



>gb|EAY98063.1| hypothetical protein OsI_19981 [Oryza sativa Indica Group]
Length=614

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV +VNGVEVENL
Sbjct  479  DWYNNSPRRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKRVNGVEVENL  538

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDEC  357
            KHL  LVE  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+S+DL++++ 
Sbjct  539  KHLCSLVESCTEENLRFDLDDERVIVLKYQNAKLATSRILKRHRIPSAISADLVDEQA  596



>ref|XP_007028414.1| DegP protease 10 isoform 1 [Theobroma cacao]
 gb|EOY08916.1| DegP protease 10 isoform 1 [Theobroma cacao]
Length=602

 Score =   185 bits (470),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NL
Sbjct  479  DWYNTSPRRLCERALRELPKQAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIQNL  538

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE+ S E +RFDLDD+RV+ LN++ A++ATSRIL+RHRIP  MSSDL
Sbjct  539  KHLCQLVENCSTESLRFDLDDDRVVALNFESARIATSRILERHRIPSRMSSDL  591



>ref|XP_003568444.1| PREDICTED: protease Do-like 10, mitochondrial [Brachypodium distachyon]
Length=585

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K G+QLVILSQVL+DDIN GYERLAELQV KVNGVE+ENL
Sbjct  457  DWYNTSPRRLCERALRELPKKAGQQLVILSQVLMDDINVGYERLAELQVKKVNGVEIENL  516

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL  LVE  + E +RFDLDDERVIVL +  A++ATSRILKRHRIP AMS+DL++++
Sbjct  517  KHLCGLVEGCTDENLRFDLDDERVIVLKFQNARLATSRILKRHRIPSAMSNDLVDEQ  573



>gb|EEE63742.1| hypothetical protein OsJ_18561 [Oryza sativa Japonica Group]
Length=563

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K  EQLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  428  DWYNNSPRRLCERALRELPKKAAEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  487

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL  LVE  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+S+DL++++
Sbjct  488  KHLCSLVESCTEENLRFDLDDERVIVLKYQNAKLATSRILKRHRIPSAISADLVDEQ  544



>ref|XP_010027457.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54013.1| hypothetical protein EUGRSUZ_I00006 [Eucalyptus grandis]
Length=567

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP   GE+LVILSQVL+DDIN GYERLAELQV KVNG+E+ENL
Sbjct  441  DWYNTSPRRLCERALRELPKNAGEELVILSQVLMDDINAGYERLAELQVRKVNGIEIENL  500

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +LVE  + E +RFDLDDERVIV NY  AK+ATS ILKRHRIP   S+DLI DE   
Sbjct  501  RHLYRLVEHCTSESVRFDLDDERVIVFNYHTAKIATSTILKRHRIPSVASTDLI-DEQNS  559

Query  364  ALELAC  381
              +LAC
Sbjct  560  QEDLAC  565



>ref|XP_002514764.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF47318.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=527

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN+SPRRLCE ALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGV +ENL
Sbjct  412  DWYNSSPRRLCEHALRELPKKAGEQLVILSQVLMDDINAGYERLAELQVKKVNGVVIENL  471

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIND  351
            KHL +LVE  S ER+RFDLDD+RVIVLNY+LAK+ATS+ILK HRIP A S DLI++
Sbjct  472  KHLCQLVEGCSAERLRFDLDDDRVIVLNYNLAKLATSKILKHHRIPSAKSCDLIDE  527



>ref|NP_001055560.1| Os05g0417100 [Oryza sativa Japonica Group]
 gb|AAT77386.1| putative serine protease [Oryza sativa Japonica Group]
 gb|AAU10782.1| putative serine protease [Oryza sativa Japonica Group]
 dbj|BAF17474.1| Os05g0417100 [Oryza sativa Japonica Group]
 dbj|BAG93339.1| unnamed protein product [Oryza sativa Japonica Group]
Length=614

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K  EQLVILSQVL+DDIN GYERLAELQV KVNGVEVENL
Sbjct  479  DWYNNSPRRLCERALRELPKKAAEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENL  538

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDEC  357
            KHL  LVE  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+S+DL++++ 
Sbjct  539  KHLCSLVESCTEENLRFDLDDERVIVLKYQNAKLATSRILKRHRIPSAISADLVDEQA  596



>gb|KJB49014.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=382

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NL
Sbjct  257  DWYNTSPRRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIKNL  316

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVE+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  317  KHLCQLVENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  373



>gb|KEH24728.1| DegP protease [Medicago truncatula]
Length=550

 Score =   180 bits (456),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 87/128 (68%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K  +QLVILSQVL+DDIN GYERLA+LQV KVNG E++NL
Sbjct  425  DWYNASPRRLCERALRELPKKENQQLVILSQVLMDDINAGYERLADLQVLKVNGTEIDNL  484

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +LVE+ +K+ + FDLDD RVIVLNY+ AK+ATSRIL RHRIP +MS+DLI+ +   
Sbjct  485  EHLCQLVENCTKDSLHFDLDDNRVIVLNYETAKIATSRILTRHRIPSSMSADLIDAQ--N  542

Query  364  ALELACSN  387
             L+L  SN
Sbjct  543  NLQLTSSN  550



>ref|XP_004293434.2| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
 ref|XP_011460090.1| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR+LCE ALR+ P + GEQ VILSQVL+DDIN GYERLAELQV KVNG EVENL
Sbjct  455  DWYNTSPRKLCEIALRESPKRAGEQFVILSQVLMDDINAGYERLAELQVKKVNGKEVENL  514

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            KHL +LVE  S+E +RFDLDD+RV+VLNY+LAKVATS+ILK HRIP AMS+DL+
Sbjct  515  KHLCQLVESCSEESVRFDLDDDRVVVLNYNLAKVATSKILKCHRIPSAMSNDLV  568



>ref|XP_008377055.1| PREDICTED: protease Do-like 10, mitochondrial [Malus domestica]
Length=572

 Score =   180 bits (456),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN+SPRRLCE ALR+ P +PG+QLVILSQVL+DDIN GYERLAELQV KVNGVEV+NL
Sbjct  457  DWYNSSPRRLCESALREPPKRPGQQLVILSQVLMDDINAGYERLAELQVKKVNGVEVDNL  516

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL  LVE+ S+E +RFDLDD+RVIVLN  LAKVATS+ILK HRIP  MS DL
Sbjct  517  KHLCLLVENCSEESVRFDLDDDRVIVLNRRLAKVATSKILKCHRIPSVMSDDL  569



>ref|XP_004489189.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cicer arietinum]
Length=550

 Score =   179 bits (455),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K  +QLVILSQVL+DDIN GYERLA+ QV KVNG E++NL
Sbjct  422  DWYNASPRRLCERALRELPKKENQQLVILSQVLMDDINAGYERLADFQVLKVNGTEIDNL  481

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HL +LVE+ S E + FDLDD+RVIVLNY+ AK+ATSRILKRHRIP +MS+DL
Sbjct  482  EHLCQLVENCSTESLHFDLDDDRVIVLNYETAKIATSRILKRHRIPSSMSTDL  534



>gb|KJB49010.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=551

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NL
Sbjct  426  DWYNTSPRRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIKNL  485

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVE+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  486  KHLCQLVENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  542



>gb|KJB49013.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=542

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NL
Sbjct  417  DWYNTSPRRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIKNL  476

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVE+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  477  KHLCQLVENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  533



>ref|XP_002868484.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44743.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   179 bits (454),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC+RAL+ LP K G+QLVI+SQVL+DDINTGYERLAELQVNKVNGVEV+NL
Sbjct  457  DWYNTSPRTLCQRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVNKVNGVEVDNL  516

Query  184  KHLRKLVEDNSKERIRFDLDDE-RVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECA  360
            +HL +L+E+ + E++R DLDDE RVIVLNY  AK+ATS ILKRHRI  A+SSDL+ ++  
Sbjct  517  RHLCQLIENCNTEKLRIDLDDESRVIVLNYQSAKIATSLILKRHRIASAISSDLLVEQ-N  575

Query  361  PALELA-CS  384
            P  ELA CS
Sbjct  576  PETELASCS  584



>ref|XP_002311275.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
 gb|EEE88642.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
Length=587

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 106/135 (79%), Gaps = 7/135 (5%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQ-------VLLDDINTGYERLAELQVNKVN  162
            +WYNTSPRRLCERAL++LP K  +QL+ILSQ       VL+DDIN GYERLAELQV KVN
Sbjct  453  EWYNTSPRRLCERALKELPKKADQQLIILSQACLRFFFVLMDDINAGYERLAELQVKKVN  512

Query  163  GVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            GVE++NLKHL +L+ D S E +RFDLDD+RVI LNY  AKVATSRILKRHRIP AMSSDL
Sbjct  513  GVEIDNLKHLCQLIRDCSSESLRFDLDDDRVIALNYQSAKVATSRILKRHRIPSAMSSDL  572

Query  343  INDECAPALELACSN  387
              ++  P  E A S+
Sbjct  573  SAEQNIPESESASSS  587



>gb|KEH24729.1| DegP protease [Medicago truncatula]
Length=443

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR+LP K  +QLVILSQVL+DDIN GYERLA+LQV KVNG E++NL
Sbjct  318  DWYNASPRRLCERALRELPKKENQQLVILSQVLMDDINAGYERLADLQVLKVNGTEIDNL  377

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +LVE+ +K+ + FDLDD RVIVLNY+ AK+ATSRIL RHRIP +MS+DLI+ +   
Sbjct  378  EHLCQLVENCTKDSLHFDLDDNRVIVLNYETAKIATSRILTRHRIPSSMSADLIDAQN--  435

Query  364  ALELACSN  387
             L+L  SN
Sbjct  436  NLQLTSSN  443



>ref|XP_007150859.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
 gb|ESW22853.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
Length=549

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K  +QLVILSQVL+DDIN GYERLAELQV KVNG E++NL
Sbjct  433  DWYNTSPRRLCERALRELPKKANQQLVILSQVLMDDINAGYERLAELQVLKVNGTEIDNL  492

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            +HLR+LV++ + E +R DLDD+RVIVLNY++AK+ATS ILKRHRIP ++S DL++ E
Sbjct  493  EHLRQLVQNCNAEFLRIDLDDDRVIVLNYEMAKIATSSILKRHRIPSSVSIDLLDTE  549



>ref|XP_010673840.1| PREDICTED: protease Do-like 10, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            +WYNTSPRRLCERALR++P K G+QLVILSQVL+DDIN GYERL+ELQV KVNGVE++NL
Sbjct  464  EWYNTSPRRLCERALREVPKKAGQQLVILSQVLMDDINAGYERLSELQVRKVNGVEIDNL  523

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            KHL +LVED  ++ +R DLDD+RVIVL+Y  AK+ATSRIL RHRIP + SSDL++ E  P
Sbjct  524  KHLCQLVEDCKEKNLRIDLDDDRVIVLDYHKAKLATSRILTRHRIPSSTSSDLVDSEEEP  583

Query  364  AL  369
             +
Sbjct  584  TV  585



>gb|KHN40897.1| Protease Do-like 10, mitochondrial [Glycine soja]
Length=434

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K  +QLVILSQVL+DDIN GYERLAELQV KVN  E++NL
Sbjct  318  DWYNTSPRRLCERALRELPKKANQQLVILSQVLMDDINAGYERLAELQVLKVNETEIDNL  377

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            +HLR+LVE  + E +R DL+D+RVIVLNY  AK+ATSRILKRHRIP +MS DL++ E
Sbjct  378  EHLRQLVESCNTEFLRLDLEDDRVIVLNYGTAKIATSRILKRHRIPSSMSVDLLDTE  434



>ref|XP_006405960.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
 gb|ESQ47413.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
Length=578

 Score =   177 bits (448),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 88/128 (69%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLCERALR LP KPG++LVI+SQVL+DDINTGYERLAELQV KVNGVEV+NL
Sbjct  449  DWYNISPRRLCERALRDLPKKPGQELVIISQVLMDDINTGYERLAELQVEKVNGVEVDNL  508

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +L+E+ + E +R DLD+ RV+ L+Y  A+VATS ILKRHRI  AMSSDL+ ++  P
Sbjct  509  RHLCQLIENCNTENLRIDLDEGRVLALHYHSARVATSLILKRHRIASAMSSDLLMEQ-NP  567

Query  364  ALELA-CS  384
              ELA CS
Sbjct  568  VTELASCS  575



>ref|XP_003534464.1| PREDICTED: protease Do-like 10, mitochondrial-like [Glycine max]
Length=528

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCERALR+LP K  +QLVILSQVL+DDIN GYERLAELQV KVN  E++NL
Sbjct  412  DWYNTSPRRLCERALRELPKKANQQLVILSQVLMDDINAGYERLAELQVLKVNETEIDNL  471

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            +HLR+LVE  + E +R DL+D+RVIVLNY  AK+ATSRILKRHRIP +MS DL++ E
Sbjct  472  EHLRQLVESCNTEFLRLDLEDDRVIVLNYGTAKIATSRILKRHRIPSSMSVDLLDTE  528



>gb|KHG11681.1| hypothetical protein F383_13103 [Gossypium arboreum]
Length=551

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPRRLCE ALR+LP + GEQLVILSQVL+DDIN GYERLAELQV  VNG+E++NL
Sbjct  426  DWYNTSPRRLCELALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKNVNGIEIKNL  485

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVE+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  486  KHLCQLVENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  542



>ref|NP_568543.1| protease Do-like 10 [Arabidopsis thaliana]
 sp|Q9FIV6.1|DGP10_ARATH RecName: Full=Protease Do-like 10, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11638.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL47441.1| AT5g36950/MLF18_70 [Arabidopsis thaliana]
 gb|AAT85770.1| At5g36950 [Arabidopsis thaliana]
 gb|AED94131.1| protease Do-like 10 [Arabidopsis thaliana]
Length=586

 Score =   174 bits (442),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC RAL+ LP K G+QLVI+SQVL+DDINTGYERLAELQVNKVNGVEV NL
Sbjct  457  DWYNTSPRTLCHRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVNKVNGVEVNNL  516

Query  184  KHLRKLVEDNSKERIRFDLDDE-RVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECA  360
            +HL +L+E+ + E++R DLDDE RVIVLNY  AK+ATS ILKRHRI  A+SSDL+ ++  
Sbjct  517  RHLCQLIENCNTEKLRIDLDDESRVIVLNYQSAKIATSLILKRHRIASAISSDLLIEQNL  576

Query  361  PALELACS  384
                 +CS
Sbjct  577  ETELASCS  584



>ref|XP_006283411.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
 gb|EOA16309.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
Length=577

 Score =   174 bits (441),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 3/129 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC RAL+ LP K G+QLVI+SQVL+DDINTGYERLAELQV KVNGVEV+NL
Sbjct  448  DWYNTSPRSLCMRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVKKVNGVEVDNL  507

Query  184  KHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECA  360
            +HL +L+E+ + E +R DL DDERVI+LNY  AK+ATS ILKRHRI  A+SSDL+ ++  
Sbjct  508  RHLCQLIENCNTEELRLDLDDDERVIILNYQSAKIATSLILKRHRIASAISSDLLIEQ-N  566

Query  361  PALELA-CS  384
            P  ELA CS
Sbjct  567  PVTELASCS  575



>ref|XP_010435521.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   172 bits (436),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 88/128 (69%), Positives = 103/128 (80%), Gaps = 2/128 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL
Sbjct  468  DWYNTSPRSLCVRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNL  527

Query  184  KHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECA  360
            +HL +L+E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSDL+ ++  
Sbjct  528  RHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQ-N  586

Query  361  PALELACS  384
            P  ELA S
Sbjct  587  PVTELASS  594



>ref|XP_009139697.1| PREDICTED: protease Do-like 10, mitochondrial [Brassica rapa]
Length=573

 Score =   171 bits (433),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNT PRRLCERALR LP K  +QLVI+SQVL+DDINTG+ERLAELQV KVNGVEV+NL
Sbjct  441  DWYNTCPRRLCERALRDLPEKSNQQLVIISQVLMDDINTGFERLAELQVKKVNGVEVDNL  500

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +L+E+   E ++ DLDD RV+ L Y  A++ATS ILKRHRI  AMSSDL+ ++   
Sbjct  501  RHLCQLIENCDTENLKLDLDDGRVLALKYQDARLATSLILKRHRIASAMSSDLLIEQNNL  560

Query  364  ALELACS  384
            A ELA S
Sbjct  561  ATELAAS  567



>ref|XP_006858734.1| hypothetical protein AMTR_s00066p00122890 [Amborella trichopoda]
 gb|ERN20201.1| hypothetical protein AMTR_s00066p00122890 [Amborella trichopoda]
Length=524

 Score =   170 bits (431),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC+ + R++P K GEQLVILSQVL+D+IN GYERL +LQV KVNGVE+ NL
Sbjct  397  DWYNTSPRHLCDLSFRRMPKKVGEQLVILSQVLMDEINVGYERLEDLQVKKVNGVEINNL  456

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            KHL +LVED  +E +R DLD ERV+ LNY+ AK+ATS ILKRHRIP A S+DL++ E
Sbjct  457  KHLCQLVEDCKEESLRLDLDKERVVALNYNKAKLATSHILKRHRIPSATSTDLLDSE  513



>ref|XP_010450457.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   169 bits (428),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL
Sbjct  468  DWYNTSPRSLCMRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNL  527

Query  184  KHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSD-LINDEC  357
            +HL +L+E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSD LI    
Sbjct  528  RHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQNL  587

Query  358  APALELACS  384
               L  +CS
Sbjct  588  VTELASSCS  596



>ref|XP_010440803.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Camelina 
sativa]
Length=590

 Score =   169 bits (427),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL
Sbjct  460  DWYNTSPRSLCVRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNL  519

Query  184  KHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSD-LINDEC  357
            +HL +L+E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSD LI    
Sbjct  520  RHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQNL  579

Query  358  APALELACS  384
               L  +CS
Sbjct  580  VTELASSCS  588



>ref|XP_010440805.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Camelina 
sativa]
Length=567

 Score =   168 bits (425),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNTSPR LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL
Sbjct  437  DWYNTSPRSLCVRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNL  496

Query  184  KHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSD-LINDEC  357
            +HL +L+E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSD LI    
Sbjct  497  RHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQNL  556

Query  358  APALELACS  384
               L  +CS
Sbjct  557  VTELASSCS  565



>emb|CDX74606.1| BnaA04g07830D [Brassica napus]
Length=573

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNT PRRLCERALR LP K  +QLVI+SQVL+DDINTG+ERLAELQV KVNGVEV+NL
Sbjct  441  DWYNTCPRRLCERALRDLPEKSNQQLVIISQVLMDDINTGFERLAELQVKKVNGVEVDNL  500

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +L+E+   E ++ DLDD RV+ L Y  A++ATS ILKRHRI  AMSSDL+ ++   
Sbjct  501  RHLCQLIENCDTENLKLDLDDGRVLALKYQDARLATSLILKRHRIASAMSSDLLIEQNNL  560

Query  364  ALELACS  384
            A ELA S
Sbjct  561  ATELAAS  567



>emb|CDY53528.1| BnaCnng25320D [Brassica napus]
Length=581

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYNT PRRLCERALR LP K  +QLVI+SQVL+DDINTG+ERLAELQV KVNGVEV+NL
Sbjct  449  DWYNTCPRRLCERALRDLPEKSNQQLVIISQVLMDDINTGFERLAELQVKKVNGVEVDNL  508

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +L+E+   E ++ DLDD RV+ L Y  A++ATS ILKRHRI  AMSSDL+ ++   
Sbjct  509  RHLCQLIENCDAENLKLDLDDGRVLALKYQDARLATSLILKRHRIASAMSSDLLIEQNNL  568

Query  364  ALELACS  384
            A ELA S
Sbjct  569  ATELAAS  575



>ref|XP_002963416.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
 gb|EFJ35287.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
Length=472

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLC+R   K+P KPGEQ VI+SQVL+DDIN GYERLAELQV +VNG ++ NL
Sbjct  360  DWYNASPRRLCDRTFSKMPKKPGEQFVIMSQVLIDDINAGYERLAELQVKQVNGEKIVNL  419

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HLR+LVE   +  IRFDLDD RVIVL Y+ AK A+ RIL+ HRI  A+S+DL
Sbjct  420  QHLRRLVEGCKEPYIRFDLDDGRVIVLKYESAKEASLRILQNHRISSAVSTDL  472



>ref|XP_002971553.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
 gb|EFJ27302.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
Length=463

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN SPRRLC+R   K+P KPGEQ VI+SQVL+DDIN GYERLAELQV +VNG ++ NL
Sbjct  350  DWYNASPRRLCDRTFSKMPKKPGEQFVIMSQVLIDDINAGYERLAELQVKQVNGEKIVNL  409

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            +HLR+LVE   +  IRFDLDD RVIVL Y+ AK A+ RIL+ HRI   +S+DL+
Sbjct  410  QHLRRLVEGCKEPYIRFDLDDGRVIVLKYESAKEASLRILQNHRISSPVSTDLL  463



>ref|XP_010027524.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54066.1| hypothetical protein EUGRSUZ_I00047 [Eucalyptus grandis]
Length=541

 Score =   151 bits (382),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             D Y+  PRRLCERAL +LP   G+++VI+S+VL  DIN GYE LAELQV KVNG E+EN
Sbjct  415  ADRYSMWPRRLCERALEELPRNAGQEIVIISKVLTADINAGYEHLAELQVRKVNGTEIEN  474

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            L HL +LVED + E IRFDLD+E VIV NY +AK AT+ IL RHRIP   S+DLI ++
Sbjct  475  LSHLYRLVEDCTDESIRFDLDNEGVIVFNYPMAKTATTTILMRHRIPSTASADLIVEQ  532



>ref|XP_002951860.1| trypsin family [Volvox carteri f. nagariensis]
 gb|EFJ46965.1| trypsin family [Volvox carteri f. nagariensis]
Length=571

 Score =   131 bits (330),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DW NT+PRRL ++AL  +  KP +Q+VILSQVL+DD+NTGY++   LQV +VNG EV NL
Sbjct  458  DWMNTAPRRLYDKALHGMMQKPHQQIVILSQVLVDDVNTGYQQFQSLQVLRVNGTEVLNL  517

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
             HL++LVE  ++  +RF+L+DER++V++  LA  A +RI++R+R+P ++S D++
Sbjct  518  THLKELVEGAAERFVRFELEDERIMVVDRSLALNANNRIMERYRVPSSVSVDIV  571



>ref|XP_007028418.1| DegP protease 10 isoform 5 [Theobroma cacao]
 gb|EOY08920.1| DegP protease 10 isoform 5 [Theobroma cacao]
Length=533

 Score =   130 bits (326),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   VILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIV  261
            + L  VL+DDIN GYERLAELQV KVNG+E++NLKHL +LVE+ S E +RFDLDD+RV+ 
Sbjct  437  ITLRPVLMDDINAGYERLAELQVKKVNGIEIQNLKHLCQLVENCSTESLRFDLDDDRVVA  496

Query  262  LNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            LN++ A++ATSRIL+RHRIP  MSSDL++++
Sbjct  497  LNFESARIATSRILERHRIPSRMSSDLVSEQ  527



>gb|KCW54068.1| hypothetical protein EUGRSUZ_I00049 [Eucalyptus grandis]
Length=134

 Score =   123 bits (308),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +1

Query  22   PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  201
            PRRLC+ A  +LP   G+++VI+S VL DD+N GYE LAELQV KVN +E++NL HL +L
Sbjct  3    PRRLCQLAREELPRNAGQEIVIISMVLRDDVNAGYEHLAELQVRKVNEIEIQNLSHLYRL  62

Query  202  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            VE  +   IRFDLD ERVIV  Y  AK ATS IL  + IP   S+DLI
Sbjct  63   VEHCTALSIRFDLDKERVIVFKYSEAKTATSTILTHYNIPSIASADLI  110



>gb|KCW54108.1| hypothetical protein EUGRSUZ_I00089 [Eucalyptus grandis]
Length=195

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             DW +  PRRL + A  +LP   G+++VI+S VL DD+N GYE LAELQV KVN +E++N
Sbjct  63   ADWDSMWPRRLWQLAPEELPRNAGQEIVIISMVLRDDVNAGYEHLAELQVRKVNEIEIQN  122

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            L+HL  LVE  +   IRFDLD ERVIV  Y  AK ATS IL  + IP   S+DLI+
Sbjct  123  LRHLYGLVEHCTAPSIRFDLDKERVIVFKYSEAKTATSTILTHYNIPSIASADLID  178



>ref|XP_010027525.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Eucalyptus 
grandis]
Length=554

 Score =   129 bits (323),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 64/115 (56%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             D Y   PRRLC+ A  +LP   G+++VI+S VL DD+N GYE LAELQV KVN +E++N
Sbjct  416  ADRYRMWPRRLCQLAREELPRNAGQEIVIISMVLRDDVNAGYEHLAELQVRKVNEIEIQN  475

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            L HL +LVE  +   IRFDLD ERVIV  Y  AK ATS IL  + IP   S+DLI
Sbjct  476  LSHLYRLVEHCTALSIRFDLDKERVIVFKYSEAKTATSTILTHYNIPSIASADLI  530



>ref|XP_010027526.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Eucalyptus 
grandis]
 gb|KCW54070.1| hypothetical protein EUGRSUZ_I00050 [Eucalyptus grandis]
Length=534

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             D Y+  PRRL + AL +LP   G+++VI+S VL+DDI  GY  LA LQV KVN +E++N
Sbjct  416  ADRYSMLPRRLWQLALEELPRNAGQEIVIISMVLMDDITEGYGNLAALQVRKVNEIEIQN  475

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            L+HL +LVE  +   IRFDLD+ERVIVL Y  AK ATS I  R+ IP   S+DLI
Sbjct  476  LRHLYELVEHCTAPSIRFDLDEERVIVLKYSEAKTATSTIRARYNIPSIASADLI  530



>gb|KCW54069.1| hypothetical protein EUGRSUZ_I00050 [Eucalyptus grandis]
Length=517

 Score =   125 bits (314),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             D Y+  PRRL + AL +LP   G+++VI+S VL+DDI  GY  LA LQV KVN +E++N
Sbjct  399  ADRYSMLPRRLWQLALEELPRNAGQEIVIISMVLMDDITEGYGNLAALQVRKVNEIEIQN  458

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            L+HL +LVE  +   IRFDLD+ERVIVL Y  AK ATS I  R+ IP   S+DLI
Sbjct  459  LRHLYELVEHCTAPSIRFDLDEERVIVLKYSEAKTATSTIRARYNIPSIASADLI  513



>ref|XP_006845229.1| hypothetical protein AMTR_s00005p00256670 [Amborella trichopoda]
 gb|ERN06904.1| hypothetical protein AMTR_s00005p00256670 [Amborella trichopoda]
Length=93

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  88   LSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLN  267
            + QVL+D+IN GYE+LA+LQV KVNGVEV+NLKH+ +LVED  +E +RFDLD+ +V++LN
Sbjct  1    MFQVLMDEINVGYEQLAQLQVIKVNGVEVDNLKHMCELVEDCKEESLRFDLDNGKVVILN  60

Query  268  YDLAKVATSRILKRHRIPYAMSSDL  342
            Y+ AK+ATS ILKR+RIP AMS+DL
Sbjct  61   YNEAKLATSHILKRYRIPLAMSTDL  85



>ref|XP_010030295.1| PREDICTED: uncharacterized protein LOC104420090 [Eucalyptus grandis]
Length=844

 Score =   126 bits (316),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             DW +  PRRL + A  +LP   G+++VI+S VL DD+N GYE LAELQV KVN +E++N
Sbjct  712  ADWDSMWPRRLWQLAPEELPRNAGQEIVIISMVLRDDVNAGYEHLAELQVRKVNEIEIQN  771

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            L+HL  LVE  +   IRFDLD ERVIV  Y  AK ATS IL  + IP   S+DLI+
Sbjct  772  LRHLYGLVEHCTAPSIRFDLDKERVIVFKYSEAKTATSTILTHYNIPSIASADLID  827



>gb|KJB49012.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=483

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   VILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIV  261
            + L  VL+DDIN GYERLAELQV KVNG+E++NLKHL +LVE+ S+E +R DLDD+RV+ 
Sbjct  384  ITLQPVLMDDINAGYERLAELQVKKVNGIEIKNLKHLCQLVENCSRESLRIDLDDDRVVA  443

Query  262  LNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  444  LNYESARIATSRILERHRIPSRMSIDLLSEQ  474



>ref|XP_002888435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64694.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=528

 Score =   123 bits (309),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +C  A + +P K GEQLVI+SQVL DDIN GY    +L+V KVNGV+VENLKHL +LVE 
Sbjct  416  ICNCANKNMPEKAGEQLVIISQVLADDINAGYTDFNDLKVIKVNGVQVENLKHLSELVEK  475

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
               E +R DL++E+V+VLNY+ AK ATS ILK HRIP A S DL +++
Sbjct  476  CCTEDLRLDLENEKVVVLNYENAKEATSLILKLHRIPSANSKDLQSEK  523



>emb|CDY66495.1| BnaCnng51110D [Brassica napus]
Length=124

 Score =   114 bits (286),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +CE + +K+P K  EQ+VI+SQ+L DDIN GY    +LQV KVNG+EV+NLKHL +++E+
Sbjct  1    MCECSSKKMPKKASEQIVIISQILEDDINAGYASFEDLQVKKVNGIEVDNLKHLSQVIEE  60

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             S   +R DL++E+V++LN  LA+ A S ILK  +IP AMS DL
Sbjct  61   CSTGYLRLDLENEKVLILNNKLARKANSTILKELKIPSAMSDDL  104



>gb|KCW54110.1| hypothetical protein EUGRSUZ_I000922, partial [Eucalyptus grandis]
Length=153

 Score =   112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             D Y+  PRRLC+ A R       +++VI+S VL+DDI  GY  LA LQV KVN ++++N
Sbjct  36   ADRYSVWPRRLCQLAQRT-SKNADQEIVIISMVLMDDITEGYGNLAALQVRKVNEIDIQN  94

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            L+HL + +E  +   IRFDLD+ERVIV  Y  AK+ATS IL R+ IP   S+DLI
Sbjct  95   LRHLYEFLEHCTATSIRFDLDEERVIVFKYREAKIATSTILTRYNIPSIASADLI  149



>ref|XP_002886957.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63216.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +C+ AL  +P KPGEQ+VI+SQVL  D++ GY  L +LQV +VNGV+VENLKHL +L+E 
Sbjct  391  MCDCALTHMPKKPGEQIVIISQVLEADVSVGYANLTDLQVKRVNGVQVENLKHLCQLIEG  450

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
               E +R DL+    I LN + AK AT++ILKR+ IP AMS DL
Sbjct  451  CCTEDLRLDLEGAFAITLNQNYAKKATAKILKRYGIPSAMSKDL  494



>ref|NP_564856.1| putativeDegP protease 3 [Arabidopsis thaliana]
 sp|Q9SHZ1.1|DEGP3_ARATH RecName: Full=Putative protease Do-like 3, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF23847.1|AC007234_19 F1E22.1 [Arabidopsis thaliana]
 gb|AEE34405.1| putativeDegP protease 3 [Arabidopsis thaliana]
Length=559

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +1

Query  37   ERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNS  216
            E AL K+P K GEQ+VI+SQ+L DDINTGY    + QV KVNGV+V NLKHL KLVE+  
Sbjct  440  ESALGKMPKKAGEQVVIISQILEDDINTGYSIFEDFQVKKVNGVQVHNLKHLYKLVEECC  499

Query  217  KERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             E +R DL+ ++VI L+Y  AK  TS+ILK  +IP A+S DL
Sbjct  500  TETVRMDLEKDKVITLDYKSAKKVTSKILKSLKIPSAVSEDL  541



>gb|KIZ03685.1| hypothetical protein MNEG_4270 [Monoraphidium neglectum]
Length=347

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DW   SPRRL E+AL  L  +P +Q+VILSQVL+DD+NTG++    LQV +VNG EV NL
Sbjct  123  DWIANSPRRLVEKALNGLMQRPEQQIVILSQVLVDDVNTGFQGFQNLQVLRVNGEEVLNL  182

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HLR L+       +R DL+D+R+IVL+   A  +T RI +R+R+P+  S+DL
Sbjct  183  RHLRALLAGCDAPYVRLDLEDDRIIVLDRAAADASTLRIQQRYRVPFLESADL  235



>ref|XP_002886956.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63215.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   115 bits (289),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  43   ALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKE  222
            AL K+P K GEQ+VI+SQ+L DDINTGY    +LQV KVNGV+V NLKHL  L+E+   E
Sbjct  434  ALEKMPKKAGEQIVIISQILEDDINTGYNIFEDLQVKKVNGVQVHNLKHLYNLIEECCTE  493

Query  223  RIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            ++  DL+ + +I L+Y  AK ATS+ILK+  IP AMS DL
Sbjct  494  KLLMDLEQDNIIALDYKSAKKATSKILKKLEIPSAMSKDL  533



>ref|XP_010027559.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
Length=533

 Score =   115 bits (288),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             D Y+  PRRLC+ A R       +++VI+S VL+DDI  GY  LA LQV KVN ++++N
Sbjct  416  ADRYSVWPRRLCQLAQRT-SKNADQEIVIISMVLMDDITEGYGNLAALQVRKVNEIDIQN  474

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            L+HL + +E  +   IRFDLD+ERVIV  Y  AK+ATS IL R+ IP   S+DLI
Sbjct  475  LRHLYEFLEHCTATSIRFDLDEERVIVFKYREAKIATSTILTRYNIPSIASADLI  529



>ref|XP_002888434.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64693.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +CE  ++K+PTK GEQ+VI+SQ+L DDI +G     +LQV K+NGVEV+NLKHL +L+E+
Sbjct  432  ICECCVKKMPTKAGEQIVIISQILEDDITSGLSIFEDLQVKKLNGVEVDNLKHLCQLIEE  491

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             S E +RFDL+D     L +  AK AT +ILK  +IP AMS DL
Sbjct  492  CSNEYLRFDLEDNNFFFLEHKSAKKATCKILKSLKIPSAMSEDL  535



>ref|XP_002499997.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61255.1| predicted protein, partial [Micromonas sp. RCC299]
Length=476

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 83/118 (70%), Gaps = 4/118 (3%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DW+NT+PRRL +RAL   PT PG+++VILSQVL D++N GY+ + +L+V  VNG EV++L
Sbjct  359  DWFNTAPRRLVDRALNDHPTSPGQEVVILSQVLADEVNAGYQGMHDLEVRAVNGREVKSL  418

Query  184  KHLRKLVEDNSKER----IRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            + L+  VE  +  +    +R D  ++RV+V++ + A+ A  RI+ +HR+P  MS DL+
Sbjct  419  RELKAEVEKGTGAKGGKFLRLDFVNDRVLVISREEAERAHGRIMAKHRVPSRMSPDLV  476



>gb|KFK41004.1| hypothetical protein AALP_AA2G073000 [Arabis alpina]
Length=444

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +C+  L  +P K GEQ+V++SQVL DDIN GY    +LQV KVNGV+VENLKHL +L+E 
Sbjct  333  ICDCVLENMPKKAGEQIVVISQVLEDDINVGYSSFEDLQVKKVNGVQVENLKHLFQLIEG  392

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
               E +R DL+ E VI+L +  AK ATS+ILK + IP A S DL
Sbjct  393  CCTEDLRLDLEKENVIILKHKAAKKATSKILKCYGIPSARSKDL  436



>ref|XP_009140719.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=634

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +CE + +K+P K  EQ+VI+SQ+L DDIN GY    +LQV KVNG+EV+NLKHL +++E+
Sbjct  511  MCECSSKKMPKKASEQIVIISQILEDDINAGYASFEDLQVKKVNGIEVDNLKHLCQVIEE  570

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             S   +R DL++E+V++LN  LA+ A S ILK  +IP AMS DL
Sbjct  571  CSTGFLRLDLENEKVLILNNKLARKANSTILKELKIPSAMSDDL  614



>ref|XP_010513422.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=502

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +1

Query  46   LRKLPTKPGEQLVILSQVLLDDINTGY-ERLAELQVNKVNGVEVENLKHLRKLVEDNSKE  222
            L  +P KPGEQ+V++SQVL  DIN GY   L +L+V +VNGV+VENLKHLRKL+E+ S +
Sbjct  401  LNHMPKKPGEQIVVISQVLEADINVGYGADLTDLKVKRVNGVQVENLKHLRKLIEECSTK  460

Query  223  RIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             +R DL+ +  I LN + AK  TS+ILKR+ IP AMS DL
Sbjct  461  DLRLDLEGDFAITLNQNDAKNVTSKILKRYGIPSAMSKDL  500



>gb|AAB60923.1| F5I14.16 [Arabidopsis thaliana]
Length=487

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +1

Query  52   KLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIR  231
            K+P K GEQ+VI+SQ+L DDINTGY    + QV KVNGV+V NLKHL KLVE+   E +R
Sbjct  373  KMPKKAGEQVVIISQILEDDINTGYSIFEDFQVKKVNGVQVHNLKHLYKLVEECCTETVR  432

Query  232  FDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             DL+ ++VI L+Y  AK  TS+ILK  +IP A+S DL
Sbjct  433  MDLEKDKVITLDYKSAKKVTSKILKSLKIPSAVSEDL  469



>ref|XP_002866059.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42318.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=517

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +1

Query  10   YNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKH  189
            Y +   ++CE +  +   K GEQ+VI+SQVLL+DI TGY    +LQV  VNGVEV NL+H
Sbjct  390  YISKSCKICECSSNRKAKKAGEQIVIISQVLLNDITTGYRDFKDLQVKNVNGVEVLNLRH  449

Query  190  LRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            L +L+E   +E +R DL++ RVI LNY  AK ATS IL+ H IP AMS DL
Sbjct  450  LSELIEKCCEEDLRLDLENGRVISLNYTSAKEATSWILEHHGIPSAMSKDL  500



>ref|XP_006391532.1| hypothetical protein EUTSA_v10019834mg [Eutrema salsugineum]
 gb|ESQ28818.1| hypothetical protein EUTSA_v10019834mg [Eutrema salsugineum]
Length=595

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            + E  L K+P K  EQ+VI+SQ+L DDIN  YE   +LQV KVNGVEV+NLKHL +L+E+
Sbjct  475  ISESFLGKMPKKAVEQIVIISQILEDDINADYEGFEDLQVKKVNGVEVDNLKHLCQLIEE  534

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                 +R DL++E+V+VLN   A+ ATSRILK  +IP AMS DL
Sbjct  535  CCTRFLRLDLENEKVLVLNNKSAEKATSRILKDLKIPSAMSEDL  578



>ref|XP_006378624.1| hypothetical protein POPTR_0010s18430g [Populus trichocarpa]
 gb|ERP56421.1| hypothetical protein POPTR_0010s18430g [Populus trichocarpa]
Length=289

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 69/104 (66%), Gaps = 17/104 (16%)
 Frame = +1

Query  85   ILSQVLLDDINTGYERLAELQ-----------------VNKVNGVEVENLKHLRKLVEDN  213
             L QVL+DDIN GYERLAELQ                 V KVNG+E++NLKHL  LVED 
Sbjct  174  FLVQVLMDDINAGYERLAELQWLFVLKCLLTNNCVDGRVKKVNGLEIDNLKHLCGLVEDC  233

Query  214  SKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            S E +RFDLDD+RVI LNY  A+VA SRILKRHRI   M++  +
Sbjct  234  SSESLRFDLDDDRVIALNYQSAEVAISRILKRHRITVRMATSFL  277



>ref|XP_006391530.1| hypothetical protein EUTSA_v10019569mg, partial [Eutrema salsugineum]
 gb|ESQ28816.1| hypothetical protein EUTSA_v10019569mg, partial [Eutrema salsugineum]
Length=316

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            + E  L K+P K  EQ+VI+SQ+L DDIN  YE   +LQV KVNGVEV+NLKHL +L+E+
Sbjct  196  ISESFLGKMPKKAVEQIVIISQILEDDINADYEGFEDLQVKKVNGVEVDNLKHLCQLIEE  255

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                 +R DL++E+V+VLN   A+ ATSRILK  +IP AMS DL
Sbjct  256  CCTRFLRLDLENEKVLVLNNKSAEKATSRILKDLKIPSAMSEDL  299



>ref|XP_010511113.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=562

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +1

Query  37   ERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNS  216
            E AL K+PTK  EQ+VI+SQ+L DDIN+G +   +LQV KVNGV+V+NLKHL  L+E+ S
Sbjct  441  ECALEKMPTKASEQIVIISQILEDDINSGLDIFEDLQVKKVNGVQVDNLKHLFHLIENCS  500

Query  217  KERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             E +RFDL+ ++   L+Y  AK AT +ILK  +I  AMS DL
Sbjct  501  TEYLRFDLEKDKFFGLHYKSAKKATPKILKSLKILSAMSEDL  542



>ref|XP_002866058.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42317.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   107 bits (267),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 52/101 (51%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +C+  L++ P KP  +++I+SQVL D IN GY     LQV KVNG EVE++ HLR+L++ 
Sbjct  416  ICDCTLKRRPQKPVHEIIIISQVLWDVINVGYSSFKNLQVKKVNGEEVESMNHLRRLIKK  475

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  333
               E +R DL+  +VIVLNY  A+  TS IL+RHRIP AMS
Sbjct  476  CRTEDLRLDLEKGKVIVLNYKSARKETSLILERHRIPSAMS  516



>ref|XP_004344572.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
 gb|ELR20829.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
Length=561

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/132 (42%), Positives = 79/132 (60%), Gaps = 15/132 (11%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWYN+SPR+LC +AL +   +P +++VILS VL+ +IN GY+++  LQ+ + N  +++NL
Sbjct  424  DWYNSSPRKLCMKALTEYMEEPDQEVVILSAVLVHEINYGYQQMTNLQLLRFNDQKIKNL  483

Query  184  KHLRKLVEDNSKERIRFDLDDE---------------RVIVLNYDLAKVATSRILKRHRI  318
            K L KLV  N +  +RFD D+                RVI+L  D AK A   IL RHRI
Sbjct  484  KQLAKLVAANKQPYLRFDFDEHVRATCNTPALRHVTGRVIILEADAAKQAEEAILTRHRI  543

Query  319  PYAMSSDLINDE  354
            P   S DL + +
Sbjct  544  PSPHSPDLFDKK  555



>ref|XP_006301507.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
 gb|EOA34405.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
Length=566

 Score =   105 bits (261),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +1

Query  37   ERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNS  216
            E AL K+P K  EQ+VI+SQ+L DDI +G   + +LQV KVNGV+V+NLKHL  L+E+  
Sbjct  447  ECALEKMPRKADEQIVIISQILEDDITSGLSMVEDLQVKKVNGVQVDNLKHLFHLIEECC  506

Query  217  KERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             E ++F+L+ +    LN+  AK ATS+ILK  +IP AMS DL
Sbjct  507  TEYLKFELEKDMFFALNHKSAKKATSKILKNLKIPSAMSDDL  548



>sp|Q9SHZ0.1|DEGP4_ARATH RecName: Full=Protease Do-like 4, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF23846.1|AC007234_18 F1E22.2 [Arabidopsis thaliana]
Length=518

 Score =   103 bits (257),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 5/103 (5%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +C  A++ +P K GEQLV     L DDIN GY     L+V KVNGV+VENLKHL +LVE 
Sbjct  416  ICNCAIKYMPEKAGEQLV-----LADDINAGYTDFKNLKVIKVNGVQVENLKHLTELVET  470

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSD  339
               E +R DL++E+V+VLNY  AK ATS IL+ HRIP A   D
Sbjct  471  CWTEDLRLDLENEKVVVLNYANAKEATSLILELHRIPSANEYD  513



>emb|CDY35320.1| BnaA04g15270D [Brassica napus]
Length=540

 Score =   103 bits (256),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            EQ+VI+SQ+L DDIN GY    +LQV KVNG+EV+NLKHL +++E+ S   +R DL++E+
Sbjct  431  EQIVIISQILEDDINAGYASFEDLQVKKVNGIEVDNLKHLCQVIEECSTGFLRLDLENEK  490

Query  253  VIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            V++LN  LA+ A S ILK  +IP AMS DL
Sbjct  491  VLILNNKLARKANSTILKELKIPSAMSDDL  520



>ref|NP_568583.1| DegP protease 13 [Arabidopsis thaliana]
 gb|AED94564.1| DegP protease 13 [Arabidopsis thaliana]
Length=410

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +1

Query  70   GEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDE  249
            GEQ+V++S+VL D IN  Y     L+VN VN V+VENLKHL +L+E    + +R +L D 
Sbjct  306  GEQIVVISEVLADVINVEYYMYKHLKVNSVNKVKVENLKHLCELIEKCCTKDLRLELGDG  365

Query  250  RVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            RVI+L+Y  AK +TS IL+RHR+P+AMS DL+ D+
Sbjct  366  RVIILDYQFAKSSTSLILERHRVPWAMSKDLMTDQ  400



>ref|XP_008441958.1| PREDICTED: protease Do-like 10, mitochondrial [Cucumis melo]
Length=586

 Score =   102 bits (255),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNK  156
            DWYNTSPRRLCERALR+LP KPGEQ VILSQVL+DDIN GYERLAELQV K
Sbjct  536  DWYNTSPRRLCERALRELPKKPGEQFVILSQVLMDDINAGYERLAELQVKK  586



>sp|Q9FM41.1|DGP13_ARATH RecName: Full=Putative protease Do-like 13 [Arabidopsis thaliana]
 dbj|BAB08526.1| unnamed protein product [Arabidopsis thaliana]
Length=486

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +1

Query  70   GEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDE  249
            GEQ+V++S+VL D IN  Y     L+VN VN V+VENLKHL +L+E    + +R +L D 
Sbjct  382  GEQIVVISEVLADVINVEYYMYKHLKVNSVNKVKVENLKHLCELIEKCCTKDLRLELGDG  441

Query  250  RVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            RVI+L+Y  AK +TS IL+RHR+P+AMS DL+ D+
Sbjct  442  RVIILDYQFAKSSTSLILERHRVPWAMSKDLMTDQ  476



>ref|XP_010436835.1| PREDICTED: LOW QUALITY PROTEIN: putative protease Do-like 13 
[Camelina sativa]
Length=520

 Score =   101 bits (251),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   PTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFD  237
            P K G+Q+VI+S++L D IN  +     LQV  VN V+VENLKHL +L+E  S + +R D
Sbjct  413  PKKAGDQIVIISEILADVINVAFYMFKNLQVKSVNEVKVENLKHLYELIEKCSDKDLRLD  472

Query  238  LDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            L   RVIVL+Y  AK +T  IL+RHR+P+AMS+DL+
Sbjct  473  LGGGRVIVLDYQSAKSSTCLILERHRVPWAMSNDLM  508



>ref|XP_010418975.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=572

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +1

Query  37   ERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNS  216
            E AL K+PTK  EQ+VI+SQ+L DDI +G     +LQV KVNGV+V+NLKHL  L+E+  
Sbjct  451  ECALEKMPTKADEQIVIISQILEDDITSGLGIFEDLQVKKVNGVQVDNLKHLFNLIENCC  510

Query  217  KERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
             E +RFDL+ ++   L+Y  AK AT +ILK  +I  A+S DL
Sbjct  511  TEYLRFDLEKDKFFGLHYKSAKEATPKILKNLKILSAVSEDL  552



>sp|Q9LK70.1|DGP12_ARATH RecName: Full=Putative protease Do-like 12, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01154.1| unnamed protein product [Arabidopsis thaliana]
Length=499

 Score =   100 bits (249),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/89 (55%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            EQ VI+SQV+ DDIN GY    +LQV KVNGV+V+NLKHLR+L+E    + +R DL++++
Sbjct  411  EQHVIISQVMPDDINKGYSNFKDLQVEKVNGVKVKNLKHLRELIEGCFSKDLRLDLENDK  470

Query  253  VIVLNYDLAKVATSRILKRHRIPYAMSSD  339
            V+VLNY+ AK AT  IL+RH I  A +S+
Sbjct  471  VMVLNYESAKKATFEILERHNIKSAWASE  499



>ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula]
 gb|AES91147.1| serine endopeptidase degp2 protein, putative [Medicago truncatula]
Length=590

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P ++ ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  476  DYEYEAPVKILDKLLYAMPQSPDEQLVVISQVLVADINIGYEEIVNTQVVGFNGKPVKNL  535

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE    E ++FDLD E+++VL    AK AT  IL  H IP AMS DL
Sbjct  536  KSLAAMVESCDDEYLKFDLDYEQIVVLRTKTAKAATLDILATHCIPSAMSDDL  588



>ref|XP_006282154.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
 gb|EOA15052.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
Length=508

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = +1

Query  13   NTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHL  192
            N+S R  C+ AL + P K  E+ +I+SQVLLDDIN GY     LQV KVNG EV ++  L
Sbjct  404  NSSTR--CDCALERRPEKYYEETIIISQVLLDDINVGYYSFKNLQVKKVNGEEVRHMNQL  461

Query  193  RKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  333
            R L++    E +R DL+  +VI+LNY  A+  T  IL+RHRIP  MS
Sbjct  462  RTLIKKCRTEDLRLDLEKGKVIILNYKSARKETLLILERHRIPSCMS  508



>emb|CDY39277.1| BnaC06g27140D [Brassica napus]
Length=455

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +1

Query  55   LPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRF  234
            +P K GEQ+V+LSQVL D+   GY  L   +V KVNGV+VENLKHLR+L+E      +R 
Sbjct  357  IPKKAGEQIVLLSQVLEDETTVGYTFLNNSRVKKVNGVQVENLKHLRQLIEKCCTGDLRI  416

Query  235  DLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            DL+++  I++ Y   K AT +ILKR+ IP  MS DL
Sbjct  417  DLENDNTIIIGYKSGKRATPKILKRYGIPSTMSKDL  452



>ref|XP_010037587.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=579

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +P  P EQLV++SQVL  DIN GYE +    V   NG  VENLK L  
Sbjct  470  APVKLLDKLLHSMPQSPDEQLVVVSQVLAGDINVGYEDIVNTPVLAFNGKPVENLKSLAS  529

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE   +E ++FDL+ ++++VL  + A+ AT  ILK H IP AMS DL
Sbjct  530  MVESCEEEFLKFDLEYQQIVVLRTETARAATLDILKTHCIPSAMSDDL  577



>gb|KCW49312.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
 gb|KCW49313.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
Length=474

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +P  P EQLV++SQVL  DIN GYE +    V   NG  VENLK L  
Sbjct  365  APVKLLDKLLHSMPQSPDEQLVVVSQVLAGDINVGYEDIVNTPVLAFNGKPVENLKSLAS  424

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE   +E ++FDL+ ++++VL  + A+ AT  ILK H IP AMS DL
Sbjct  425  MVESCEEEFLKFDLEYQQIVVLRTETARAATLDILKTHCIPSAMSDDL  472



>ref|XP_011071819.1| PREDICTED: protease Do-like 9 isoform X2 [Sesamum indicum]
Length=492

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L ++P  P EQ+V++SQVL+ DIN GYE +   QV+  NG  V+NL
Sbjct  378  DYEYEAPVKLLDKLLHEMPQSPEEQIVVVSQVLVADINIGYEDIVNTQVHAFNGKPVKNL  437

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  438  KSLAHMVENCDDEYLKFDLEYQQIVVLRTKNAKAATLDILSTHCIPSAMSDDL  490



>gb|KDP31134.1| hypothetical protein JCGZ_11510 [Jatropha curcas]
Length=572

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  458  DYEYEAPVKLLDKLLHSMPQSPDEQLVVISQVLVADINIGYEDIVNTQVLAFNGKPVKNL  517

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  + E ++F+L+ E+++VL    AK AT  +L  H IP AMS DL
Sbjct  518  KSLVTMVESCTDEFLKFELEYEQIVVLRTKTAKAATVDVLTTHCIPSAMSDDL  570



>ref|NP_566552.1| DEGP protease 12 [Arabidopsis thaliana]
 gb|AEE75834.1| DEGP protease 12 [Arabidopsis thaliana]
Length=491

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            EQ VI+SQV+ DDIN GY    +LQV KVNGV+V+NLKHLR+L+E    + +R DL++++
Sbjct  403  EQHVIISQVMPDDINKGYSNFKDLQVEKVNGVKVKNLKHLRELIEGCFSKDLRLDLENDK  462

Query  253  VIVLNYDLAKVATSRILKRHRIPYAMSSD  339
            V+VLNY+ AK AT  IL+RH I  A +S+
Sbjct  463  VMVLNYESAKKATFEILERHNIKSAWASE  491



>ref|XP_006339987.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=581

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  467  DYEYEAPVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGERVKNL  526

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  S E ++FDL+ ++V+VL    AK ATS IL  H IP AMS DL
Sbjct  527  KSLASMVEKCSDEFLKFDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  579



>ref|XP_006391531.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
 gb|ESQ28817.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
Length=489

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            S RR      R +P K GEQ+VI+SQVL D+   GY      QV +VNGV VENLKHLR+
Sbjct  375  SARR--SSVFRNMPKKAGEQIVIISQVLEDETTVGYTIFENSQVKQVNGVPVENLKHLRQ  432

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            L+E+   E +R DL+ +  I+ +    K  T +ILKR+ IP AMS DL
Sbjct  433  LLEECCTEYLRLDLEKDNTIIASSKSTKKVTGKILKRYGIPNAMSKDL  480



>emb|CDP16995.1| unnamed protein product [Coffea canephora]
Length=580

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L ++P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  466  DYEYEAPVKLLDKLLHEMPKSPDEQIVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNL  525

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K+L  +VE  + E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  526  KNLASMVESCNDEFLQFDLEYQQIVVLQTKGAKAATLDILTTHCIPSAMSDDL  578



>ref|XP_009105158.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=483

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +1

Query  55   LPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRF  234
            +P K GEQ+V LSQVL D+   GY      +V KVNGV+VENLKHLR+L+E    E +R 
Sbjct  385  VPKKAGEQIVQLSQVLEDETTVGYTFSNNSRVKKVNGVQVENLKHLRQLIEKCCTEDLRI  444

Query  235  DLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            DL+++  I++ Y   K AT +ILKR+ IP  MS DL
Sbjct  445  DLENDNTIIIGYKSGKRATPKILKRYGIPSTMSKDL  480



>emb|CDY07457.1| BnaA07g25360D [Brassica napus]
Length=483

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +1

Query  55   LPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRF  234
            +P K GEQ+V LSQVL D+   GY      +V KVNGV+VENLKHLR+L+E    E +R 
Sbjct  385  VPKKAGEQIVQLSQVLEDETTVGYTFSNNSRVKKVNGVQVENLKHLRQLIEKCCTEDLRI  444

Query  235  DLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            DL+++  I++ Y   K AT +ILKR+ IP  MS DL
Sbjct  445  DLENDNTIIIGYKSGKRATPKILKRYGIPSTMSKDL  480



>ref|XP_002946355.1| trypsin family [Volvox carteri f. nagariensis]
 gb|EFJ52282.1| trypsin family [Volvox carteri f. nagariensis]
Length=546

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DW   +P +LC+R L       G+++V+LS+VL   +N G++ +  +QV KVNGV+V NL
Sbjct  394  DWSTKAPIKLCDRYLSGSMEALGQEVVLLSKVLSASVNQGFQEIQNVQVYKVNGVKVHNL  453

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
             H+ +LVE+   E IRFDL+ +RV+VL+    + AT  IL+ + IP A S  L+ ++
Sbjct  454  AHMARLVEECDSEYIRFDLEWKRVVVLHTGRGRSATPDILRTNCIPAAASDGLLEED  510



>ref|XP_007028415.1| DegP protease 10 isoform 2 [Theobroma cacao]
 gb|EOY08917.1| DegP protease 10 isoform 2 [Theobroma cacao]
Length=537

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQ  147
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQ
Sbjct  479  DWYNTSPRRLCERALRELPKQAGEQLVILSQVLMDDINAGYERLAELQ  526



>ref|XP_011044336.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  450  APVKLLDKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLAN  509

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE+   E ++FDL+ E+++VL    AK AT  IL  H IP A+S DL
Sbjct  510  MVENFDDEFLKFDLEYEQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>gb|KFG58629.1| trypsin domain-containing protein [Toxoplasma gondii RUB]
Length=252

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ V+LS VL  D+  GYE L  +QV + NG  V+ L
Sbjct  140  DFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTL  199

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE++++E  RFDLD + V+VL  D A+ A   IL+R+ I    S D+
Sbjct  200  KHLAELVENSTEEYWRFDLDHDEVVVLEADAARRALPHILQRNMIRSCKSEDV  252



>ref|XP_009794183.1| PREDICTED: protease Do-like 9 [Nicotiana sylvestris]
Length=575

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  461  DYEYEAPVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGKPVKNL  520

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L ++VE+ + E ++ DL+ ++V+VL  + AK ATS IL  H IP AMS DL
Sbjct  521  KSLARMVENCNDEFLKLDLEYQQVVVLQTETAKSATSDILTTHCIPSAMSEDL  573



>gb|KJB49011.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=487

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQV  150
            DWYNTSPRRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV
Sbjct  426  DWYNTSPRRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQV  474



>ref|XP_011015595.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015596.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015597.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  450  APVKLLDKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLAN  509

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  510  MVENFDDEFLKFDLEYDQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>ref|XP_011071818.1| PREDICTED: protease Do-like 9 isoform X1 [Sesamum indicum]
Length=977

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L ++P  P EQ+V++SQVL+ DIN GYE +   QV+  NG  V+NL
Sbjct  863  DYEYEAPVKLLDKLLHEMPQSPEEQIVVVSQVLVADINIGYEDIVNTQVHAFNGKPVKNL  922

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  923  KSLAHMVENCDDEYLKFDLEYQQIVVLRTKNAKAATLDILSTHCIPSAMSDDL  975



>ref|XP_006376843.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 ref|XP_002318029.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|ERP54640.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|EEE96249.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
Length=559

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  450  APVKLLDKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLAN  509

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  510  MVENFDDEFLKFDLEYDQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>ref|XP_002321577.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
 gb|EEF05704.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
Length=556

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  447  APVKLLDKLLHSMPQSPDEQMVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLAN  506

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  507  MVENCDDEFLKFDLEYDQIVVLRMKTAKEATVDILTTHCIPSAISDDL  554



>ref|XP_009609751.1| PREDICTED: protease Do-like 9 [Nicotiana tomentosiformis]
Length=577

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  463  DYEYEAPVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGKPVKNL  522

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE+ + E ++ DL+ ++V+VL    AK ATS IL  H IP AMS DL
Sbjct  523  KSLASMVENCNDEFLKLDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  575



>ref|XP_006446449.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
 gb|ESR59689.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
Length=586

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQ+V++SQVL+ DIN GYE +   QV  +NG  V+NL
Sbjct  472  DYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNL  531

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE +  E ++FDL+ ++++VL    AK ATS IL  H IP AMS DL
Sbjct  532  KSLADMVESSEDEFLKFDLEYQQIVVLKTKTAKEATSDILATHCIPSAMSGDL  584



>ref|XP_010456846.1| PREDICTED: putative protease Do-like 11, mitochondrial [Camelina 
sativa]
Length=581

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 5/113 (4%)
 Frame = +1

Query  34   CERALRKLPTKPGE-QLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            C+ AL     K GE QLVI+SQ+L DDIN  Y+ L +LQV  VN V+++NLKHL +LVE 
Sbjct  446  CKCALYDTYIKAGEHQLVIISQILDDDINKEYQSLEDLQVKNVNRVKIKNLKHLCELVEK  505

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  369
             S + +RF L+D+ V+VLN + A+ AT +I++RH+I   +S D+    C P L
Sbjct  506  CSTKDLRFVLEDDNVMVLNTESARKATLKIMERHKIKSVISKDI----CLPML  554



>gb|EYU42545.1| hypothetical protein MIMGU_mgv1a0052332mg, partial [Erythranthe 
guttata]
Length=386

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L ++     EQ+V++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  272  DYEYEAPVKLLDKLLHEMRQSAEEQIVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNL  331

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  S E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  332  KSLASMVESCSDEYLKFDLEYQQIVVLQTKTAKAATLDILSTHCIPSAMSDDL  384



>gb|KDO66274.1| hypothetical protein CISIN_1g036586mg [Citrus sinensis]
Length=568

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQ+V++SQVL+ DIN GYE +   QV  +NG  V+NL
Sbjct  454  DYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNL  513

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE +  E ++FDL+ ++++VL    AK ATS IL  H IP AMS DL
Sbjct  514  KSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDL  566



>ref|XP_010678720.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=566

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +P    E+LV++SQVL+ DIN GYE +   QV   NG  V NLK L  
Sbjct  457  APVKLLDKLLHSMPQSKDEELVVISQVLVADINIGYEEIVNTQVIAFNGNPVTNLKTLAS  516

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE  + E ++F+LD ++++VL  + AK AT  IL  H IP AMS DL
Sbjct  517  MVESCNDEFMKFNLDYDQIVVLRTETAKAATIDILATHCIPSAMSDDL  564



>gb|KFK31613.1| hypothetical protein AALP_AA6G135800 [Arabis alpina]
Length=282

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  85   ILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVL  264
            I+  VL DDIN GY    +LQV  VNGV+VENL+HL +++E+   E +R DL++++V+VL
Sbjct  180  IVGVVLADDINAGYISFEDLQVKTVNGVQVENLRHLYEMIENCCAEDLRLDLENDQVMVL  239

Query  265  NYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            NY  AK ATS IL+ HRI   +S DL+  E
Sbjct  240  NYKDAKEATSLILEHHRISSPISKDLLQSE  269



>ref|XP_011087156.1| PREDICTED: protease Do-like 9 [Sesamum indicum]
Length=573

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +1

Query  22   PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  201
            P +L ++ L ++P    EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  465  PVKLLDKVLHEMPQSVDEQIVVISQVLVADINIGYEDIVNTQVLAFNGQPVKNLKSLVTM  524

Query  202  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            VE  + + ++FDL+ ++++VL    AK AT  IL RH +P AMS DL
Sbjct  525  VESCTDKYMKFDLEYQQIVVLRTRTAKAATLNILTRHCVPSAMSDDL  571



>ref|XP_006470390.1| PREDICTED: protease Do-like 9-like [Citrus sinensis]
Length=587

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQ+V++SQVL+ DIN GYE +   QV  +NG  V NL
Sbjct  473  DYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVRNL  532

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE +  E ++FDL+ ++++VL    AK ATS IL  H IP AMS DL
Sbjct  533  KSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDL  585



>dbj|GAM25013.1| hypothetical protein SAMD00019534_081880 [Acytostelium subglobosum 
LB1]
Length=505

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = +1

Query  25   RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  204
            R++ E+A +   T P  Q+V++SQVL+D IN GY      +V KVNGV V NLKHL  L+
Sbjct  400  RKVFEKAEKI--TGPDSQVVVISQVLIDKINYGYSAFGLCEVRKVNGVPVRNLKHLVDLI  457

Query  205  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            E+ + + I   ++ + +++L+ D AK AT+RI+ +H IP A S DL+N
Sbjct  458  ENTTDQHIVITIEHDYLVILDKDEAKEATARIMTQHAIPSAKSVDLLN  505



>ref|XP_010446115.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=529

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 68/101 (67%), Gaps = 0/101 (0%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +C+ AL++ P K  ++++I+S++L DDIN GY    +LQV KVNG E+ NL HLR+ +E 
Sbjct  429  ICDCALKRRPEKAAQEIIIISEMLEDDINVGYYSFKKLQVKKVNGEELLNLDHLRRRIEK  488

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  333
               E +R DL+  +VI+L+Y  A      ILKRHRIP +MS
Sbjct  489  CRTEVLRLDLEKGKVIILHYKSACEENLLILKRHRIPSSMS  529



>ref|XP_004252189.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=584

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +  +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  470  DYEYEASVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLSFNGEPVKNL  529

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE    E ++FDL+ ++V+VL    AK ATS IL  H IP AMS DL
Sbjct  530  KSLASMVEKCKDEFLKFDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  582



>ref|XP_003055699.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60951.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=492

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DWY+ +PRRLC+RA+      P EQ+VILS VL D+IN GY+   +L+V++V G +V+N+
Sbjct  380  DWYDKAPRRLCDRAMHSHMKVPDEQVVILSHVLADEINVGYQGKHDLEVSRVCGAKVKNM  439

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            + L   ++ +  E +R D     V+V+N    + A  RIL +HR+P  MS DL
Sbjct  440  RELAAALDAHDGEFVRVDFVGGDVVVVNAKEGRAAGERILAKHRVPARMSPDL  492



>gb|EYU29924.1| hypothetical protein MIMGU_mgv1a005009mg [Erythranthe guttata]
Length=501

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L ++P    EQ+V++SQVL+ +IN GYE +A  QV   NG  V+NL
Sbjct  387  DYGFEAPVKLLDKLLYEMPQSVDEQIVVVSQVLVAEINIGYEEIANTQVLAFNGQPVKNL  446

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  + E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  447  KSLASMVESCNDEYLKFDLEFQQILVLQTKAAKEATLDILATHCIPSAMSDDL  499



>ref|XP_008887060.1| trypsin domain-containing protein [Hammondia hammondi]
 gb|KEP62220.1| trypsin domain-containing protein [Hammondia hammondi]
Length=744

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ V+LS VL  D+  GYE L  +QV   NG  V+ L
Sbjct  632  DFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQHFNGTSVKTL  691

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE++++E  RFDLD + V+VL  D A+ A   IL+R+ I  + S D+
Sbjct  692  KHLAELVENSTEEYWRFDLDHDEVVVLEADAARRALPHILQRNMIRSSKSEDV  744



>ref|XP_002885148.1| hypothetical protein ARALYDRAFT_479117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61407.1| hypothetical protein ARALYDRAFT_479117 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 4/92 (4%)
 Frame = +1

Query  94   QVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYD  273
            Q+L DDIN GY+ L   QV KVNGVEV+NLKHL +L+E+ S E +R D  + +V+VLNY+
Sbjct  382  QILADDINEGYQSLDGAQVEKVNGVEVKNLKHLCELIEECSTEDLRLDFKNHKVLVLNYE  441

Query  274  LAKVATSRILKRHRIPYAMSSDLINDECAPAL  369
             AK AT +IL+RH+I   +S D+    C P L
Sbjct  442  TAKKATLQILERHKIKSFISKDI----CLPML  469



>ref|XP_002370490.1| trypsin, putative [Toxoplasma gondii ME49]
Length=744

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ V+LS VL  D+  GYE L  +QV + NG  V+ L
Sbjct  632  DFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTL  691

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE++++E  RFDLD + V+VL  D A+ A   IL+R+ I    S D+
Sbjct  692  KHLAELVENSTEEYWRFDLDHDEVVVLEADAARRALPHILQRNMIRSCKSEDV  744



>gb|KFH09397.1| trypsin domain-containing protein [Toxoplasma gondii VAND]
Length=748

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ V+LS VL  D+  GYE L  +QV + NG  V+ L
Sbjct  636  DFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTL  695

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE++++E  RFDLD + V+VL  D A+ A   IL+R+ I    S D+
Sbjct  696  KHLAELVENSTEEYWRFDLDHDEVVVLEADAARRALPHILQRNMIRSCKSEDV  748



>gb|EPT25374.1| trypsin domain-containing protein [Toxoplasma gondii ME49]
Length=748

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ V+LS VL  D+  GYE L  +QV + NG  V+ L
Sbjct  636  DFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTL  695

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE++++E  RFDLD + V+VL  D A+ A   IL+R+ I    S D+
Sbjct  696  KHLAELVENSTEEYWRFDLDHDEVVVLEADAARRALPHILQRNMIRSCKSEDV  748



>gb|ESS28089.1| trypsin domain-containing protein [Toxoplasma gondii VEG]
Length=741

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ V+LS VL  D+  GYE L  +QV + NG  V+ L
Sbjct  629  DFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTL  688

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE++++E  RFDLD + V+VL  D A+ A   IL+R+ I    S D+
Sbjct  689  KHLAELVENSTEEYWRFDLDHDEVVVLEADAARRALPHILQRNMIRSCKSEDV  741



>ref|XP_009379979.1| PREDICTED: protease Do-like 9 [Musa acuminata subsp. malaccensis]
Length=578

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQLV++SQVL+ D+N GYE +   QV   NG  V+NL
Sbjct  464  DYEYDAPVKLLDKLLHTMAHSHDEQLVVISQVLVADVNIGYEDIVNTQVMAFNGKPVKNL  523

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            + L  +VE+ S+E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  524  RTLANMVENCSEEFLKFDLEYQQIVVLQTKTAKAATPDILATHCIPSAVSEDL  576



>ref|XP_010928580.1| PREDICTED: protease Do-like 9 [Elaeis guineensis]
Length=579

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  465  DYEYDAPVKLLDKHLHAMAQAHDEQLVVISQVLVADINIGYEDIVNTQVLSFNGKPVKNL  524

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE+  +E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  525  KSLASMVENCDEEFLQFDLEYQQIVVLKTRTAKAATKDILLTHCIPSAMSGDL  577



>sp|Q9LK71.2|DGP11_ARATH RecName: Full=Putative protease Do-like 11, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
Length=560

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +1

Query  82   VILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIV  261
            V +S+ L DDIN GY+ L   QV KVNGVEV+NLKHL +L+E+ S E +R +  + +V+V
Sbjct  444  VKISERLADDINEGYQSLYGAQVEKVNGVEVKNLKHLCELIEECSTEDLRLEFKNHKVLV  503

Query  262  LNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  369
            LNY+ AK AT +IL+RH+I   +S D+    C P L
Sbjct  504  LNYESAKKATLQILERHKIKSVISKDI----CLPML  535



>ref|XP_002968921.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
 gb|EFJ30037.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
Length=558

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ +        EQLV++SQVL  D N GYE +   Q+   NG  V NL
Sbjct  444  DYDYDAPVKLLDKLMHNFAQTEDEQLVVISQVLAADANIGYEDIVNTQIIAFNGTAVRNL  503

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL  +V++ +   +RFDL+ +++IVL+  +AK AT  IL  H IP AMS DL
Sbjct  504  KHLAHMVDNCNDGFMRFDLEYQQMIVLDAQVAKSATPEILSMHCIPSAMSDDL  556



>gb|EPR63244.1| trypsin domain-containing protein [Toxoplasma gondii GT1]
 gb|KFG34324.1| trypsin domain-containing protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=741

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ V+LS VL  D+  GYE L  +QV + NG  V+ L
Sbjct  629  DFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTL  688

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL +LVE+++++  RFDLD + V+VL  D A+ A   IL+R+ I    S D+
Sbjct  689  KHLAELVENSTEKYWRFDLDHDEVVVLEADAARRALPHILQRNMIRSCKSEDV  741



>ref|XP_011402326.1| Protease Do-like 9 [Auxenochlorella protothecoides]
 gb|KFM29273.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=542

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L +R L     +PG+Q+V+L+QVL  +   GYE ++  QV K N V+V +L
Sbjct  416  DYLREAPVKLLDRLLYTHKDRPGQQVVMLNQVLACEATIGYEDISNSQVAKFNDVKVNSL  475

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HL +LV++N +  +RF+L+ + V+VL+  LA+  T  +   H IP+A+S DL
Sbjct  476  QHLVELVQENREPFMRFNLESKEVLVLDASLAQACTEEMQVFHSIPHALSKDL  528



>gb|KJB40784.1| hypothetical protein B456_007G077100 [Gossypium raimondii]
Length=590

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  476  DYEFDAPVKLLDKHLHAMAESTDEQLVVISQVLVADINIGYEDIVNTQVLAFNGKPVKNL  535

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +V++ + E +RFDL+ ++++VL+   AK AT  IL  H I  AMS DL
Sbjct  536  KSLANMVDNCNDEYLRFDLEYQQIVVLHAKAAKAATLDILTTHCISSAMSDDL  588



>ref|XP_010678716.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010678717.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 65/107 (61%), Gaps = 0/107 (0%)
 Frame = +1

Query  22   PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  201
            P  L  +    +     E+L+I+SQVL+ DIN GYE +  +QV  VNG  V+NLK    +
Sbjct  375  PVELLHKLHHSMADSKDEELLIISQVLVADINIGYENITNVQVTAVNGKPVKNLKSFTSM  434

Query  202  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            VE  S+E ++FDL+  + +VL  + AK AT+ IL  H IP AMS DL
Sbjct  435  VESCSEEYLKFDLEFNKKVVLRTETAKAATADILATHCIPSAMSDDL  481



>ref|NP_566551.1| DegP protease 11 [Arabidopsis thaliana]
 gb|AEE75833.1| DegP protease 11 [Arabidopsis thaliana]
Length=555

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +1

Query  94   QVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYD  273
            Q L DDIN GY+ L   QV KVNGVEV+NLKHL +L+E+ S E +R +  + +V+VLNY+
Sbjct  443  QRLADDINEGYQSLYGAQVEKVNGVEVKNLKHLCELIEECSTEDLRLEFKNHKVLVLNYE  502

Query  274  LAKVATSRILKRHRIPYAMSSDLINDECAPAL  369
             AK AT +IL+RH+I   +S D+    C P L
Sbjct  503  SAKKATLQILERHKIKSVISKDI----CLPML  530



>ref|XP_002989968.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
 gb|EFJ08981.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
Length=558

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ +        EQLV++SQVL  D N GYE +   Q+   NG  V NL
Sbjct  444  DYDYDAPVKLLDKLMHNFAQTEDEQLVVISQVLAADANIGYEDIVNTQIIAFNGTAVRNL  503

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL  +V++ +   +RFDL+ +++IVL+  +AK AT  IL  H IP  MS DL
Sbjct  504  KHLAHMVDNCNDGFMRFDLEYQQMIVLDAQVAKSATPEILSMHCIPSGMSDDL  556



>gb|KHG08084.1| Protease Do-like 9 [Gossypium arboreum]
Length=91

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 61/96 (64%), Gaps = 7/96 (7%)
 Frame = +1

Query  55   LPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRF  234
            +P  P EQ V++SQVL+ DIN GYE +       VN   V+NL+ L ++ E++  E ++F
Sbjct  1    MPQSPDEQFVVVSQVLVSDINIGYEDI-------VNTQPVKNLRRLVEMAENSDDEFLKF  53

Query  235  DLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            DL+ E+++VL    AKVAT  IL  H IP AMS DL
Sbjct  54   DLEYEQIVVLRIKTAKVATPDILATHYIPLAMSVDL  89



>ref|XP_010254385.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=577

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 69/113 (61%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     E+LV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  463  DYECDAPVKLLDKHLHAMAQSDDEELVVVSQVLVADINIGYENIVNTQVLAFNGKPVKNL  522

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE+   E ++F+L+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  523  KSLCNMVENCDDEFLKFELEYQQLVVLQTKTAKAATPDILTTHCIPSAMSGDL  575



>ref|XP_006654043.1| PREDICTED: protease Do-like 2, chloroplastic-like [Oryza brachyantha]
Length=585

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL  ++N GYE +   QV K+NG  V+N+ HL  LV+
Sbjct  445  KLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQVIKLNGTAVKNIHHLAHLVD  504

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +   + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  505  NCKDKFLTFEFEDDFLVVLDREEATTASSDILKEHAIPAIRSSDL  549



>ref|XP_010272002.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=551

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 46/113 (41%), Positives = 69/113 (61%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     E+LV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  437  DYECDAPVKLLDKHLHAMAQSEDEELVVVSQVLVADINIGYENIVNTQVLACNGNPVKNL  496

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE+   + ++F+L+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  497  KSLASMVENCDDQFLKFELEYQQLVVLQTKTAKAATLDILTTHCIPSAMSDDL  549



>ref|XP_002885149.1| DEGP12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61408.1| DEGP12 [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            EQ VI+SQV+ DDIN GY    +LQV KVNGV+V+NLKHLR+L+E    + +R DL++++
Sbjct  420  EQQVIISQVMPDDINKGYSNFKDLQVEKVNGVKVKNLKHLRELIEGCCGKDLRLDLENDK  479

Query  253  VIVLNYDLAKVATSR  297
            V+VLNY+ AK A  R
Sbjct  480  VMVLNYESAKKANLR  494



>gb|AAT93972.1| putative DegP2 protease [Oryza sativa Japonica Group]
 gb|EEC78515.1| hypothetical protein OsI_18450 [Oryza sativa Indica Group]
 gb|EEE62322.1| hypothetical protein OsJ_17111 [Oryza sativa Japonica Group]
Length=596

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL  ++N GYE +   QV K+NG  V+N+ HL  LV+
Sbjct  456  KLLAKARYSLSTFEGEQIVIVSQVLAHEVNIGYEHMGNQQVIKLNGTVVKNIHHLAHLVD  515

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +   + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  516  NCKDKFLTFEFEDDFLVVLDREEATTASSDILKEHAIPSVRSSDL  560



>ref|NP_001057235.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAD37774.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAD37915.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAF19149.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAG99912.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80287.1| hypothetical protein OsI_22290 [Oryza sativa Indica Group]
 gb|EEE65395.1| hypothetical protein OsJ_20719 [Oryza sativa Japonica Group]
Length=628

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +   P EQLV++SQVL+ DIN GYE +  +QV   NG  V+NL
Sbjct  514  DYEYDAPVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNIQVLSFNGKPVKNL  573

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL  +VED ++E ++FD+D ++++VL    AK AT  IL  H IP AMS DL
Sbjct  574  KHLATMVEDCNEEYLKFDMDYDQLVVLEAKTAKAATQDILTTHCIPSAMSEDL  626



>ref|XP_010678715.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=487

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            E+L+I+SQVL+ DIN GYE L  +QV  VNG  V+NLK  + +VE  + E ++FDL+   
Sbjct  392  EELIIISQVLVADINIGYEDLTNVQVIAVNGNPVKNLKSFKNMVESCNSEFLKFDLEFNM  451

Query  253  VIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            ++VL  + AK  T+ IL  H IP AMS DL+
Sbjct  452  MVVLRTETAKATTAEILATHCIPSAMSDDLL  482



>ref|XP_007514393.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15830.1| predicted protein [Bathycoccus prasinos]
Length=555

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 0/115 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            DW   +P +L  R   K  T+P ++LVI SQVL  +IN GYE  + L V K NG  ++NL
Sbjct  441  DWEYDAPVQLLSRMYLKDMTEPDQELVICSQVLAHEINIGYEDFSNLAVEKFNGKPIKNL  500

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            K L  LVE  S+E + F+LD + ++VL+ + AK +T  IL  H IP   S +L +
Sbjct  501  KQLVDLVESCSEEYLTFELDMKTLVVLDNEKAKQSTREILDVHAIPSDKSKNLFS  555



>ref|XP_010678718.1| PREDICTED: protease Do-like 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = +1

Query  22   PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  201
            P  L  +    +     E+L+I+SQVL+ DIN GYE +  +QV  VNG  V+NLK    +
Sbjct  375  PVELLHKLHHSMADSKDEELLIISQVLVADINIGYENITNVQVTAVNGKPVKNLKSFTSM  434

Query  202  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            VE  S+E ++FDL+  +V VL  + AK AT+ IL  H IP AMS DL
Sbjct  435  VESCSEEYLKFDLEFNKV-VLRTETAKAATADILATHCIPSAMSDDL  480



>gb|EFA82977.1| hypothetical protein PPL_03755 [Polysphondylium pallidum PN500]
Length=566

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +1

Query  25   RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  204
            RR+ E+  R   T P  Q+V++SQ+L+D IN GY      +V KVNG  + NL HL +L+
Sbjct  457  RRVFEKIERI--TSPSSQVVVISQILIDKINHGYSSFGFSEVKKVNGTPIRNLAHLVQLI  514

Query  205  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            E+ +K  +   L++E +I+L+ + AK AT RI+K+H IP   S +L
Sbjct  515  EETTKPHVVITLENEYLIILDKEEAKEATIRIMKQHAIPSDRSEEL  560



>dbj|BAB01153.1| unnamed protein product [Arabidopsis thaliana]
Length=565

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 9/101 (9%)
 Frame = +1

Query  82   VILSQVLLDDINTGYERL--AEL---QVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDD  246
            V +S+ L DDIN GY+ L  A+L   QV KVNGVEV+NLKHL +L+E+ S E +R +  +
Sbjct  444  VKISERLADDINEGYQSLYGAQLWWEQVEKVNGVEVKNLKHLCELIEECSTEDLRLEFKN  503

Query  247  ERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  369
             +V+VLNY+ AK AT +IL+RH+I   +S D+    C P L
Sbjct  504  HKVLVLNYESAKKATLQILERHKIKSVISKDI----CLPML  540



>ref|XP_004960292.1| PREDICTED: protease Do-like 2, chloroplastic-like [Setaria italica]
Length=599

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL  ++N GYE +   Q+ K+NG  V+N+ HL  LV+
Sbjct  459  KLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQLIKLNGTAVKNIHHLAHLVD  518

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VLN + A  A+S ILK H IP   SSDL
Sbjct  519  TCKDKFLTFEFEDDFLVVLNREEATAASSDILKEHAIPSVRSSDL  563



>ref|XP_010233342.1| PREDICTED: protease Do-like 2, chloroplastic [Brachypodium distachyon]
Length=616

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL +D+N GYE +   QV K+NG  V+N+ HL  LV+
Sbjct  476  KLLAKARYSLSTFEGEQIVIVSQVLANDVNIGYEHMGNQQVIKLNGTMVKNIHHLAHLVD  535

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VL+ + A  A+S I K H IP   SSDL
Sbjct  536  TCQDKFLTFEFEDDFLVVLDREEAMAASSDIQKEHAIPSVRSSDL  580



>emb|CDY46469.1| BnaA08g06390D [Brassica napus]
Length=505

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            EQ VI+S++L DDIN GYE   +LQV KVN V+V+NL+HL +L+E+N  + +  DL+D++
Sbjct  411  EQHVIISEILEDDINQGYESFKDLQVEKVNKVKVKNLRHLFELIEENGTQNLSIDLEDDK  470

Query  253  VIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            V+VLNY+ AK A S ILKRH I  A+S+DL
Sbjct  471  VLVLNYESAKKADSIILKRHNITSAISNDL  500



>ref|XP_009107927.1| PREDICTED: putative protease Do-like 12, mitochondrial [Brassica 
rapa]
Length=505

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            EQ VI+S++L DDIN GYE   +LQV KVN V+V+NL+HL +L+E+N  + +  DL+D++
Sbjct  411  EQHVIISEILEDDINQGYESFKDLQVEKVNKVKVKNLRHLFELIEENGTQNLSIDLEDDK  470

Query  253  VIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            V+VLNY+ AK A S ILKRH I  A+S+DL
Sbjct  471  VLVLNYESAKKADSIILKRHNITSAISNDL  500



>gb|AFW57620.1| hypothetical protein ZEAMMB73_444319 [Zea mays]
Length=458

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GE++VI+SQVL  ++N GYE +   QV K+NG  ++N+ HL  LV+
Sbjct  317  KLLAKARYSLATFEGEEIVIVSQVLAHEVNIGYEHMGNQQVMKLNGTTIKNIHHLAHLVD  376

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  377  TCKDKFLTFEFEDDFLVVLHREEADAASSDILKEHAIPSIRSSDL  421



>emb|CDX91770.1| BnaC08g06890D [Brassica napus]
Length=280

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  73   EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  252
            EQ VI+S++L DDIN GYE   +LQV KVN V+V+NL+HL +L+E+N  + +  DL+D++
Sbjct  186  EQHVIISEILEDDINQGYESFKDLQVEKVNKVKVKNLRHLFELIEENGTQNLSIDLEDDK  245

Query  253  VIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            V+VLNY+ AK A S ILKRH I  A+S+DL
Sbjct  246  VLVLNYESAKKADSIILKRHNITSAISNDL  275



>gb|EMS45662.1| Protease Do-like 9 [Triticum urartu]
Length=510

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +   P EQLV++SQVL+ DIN GYE L   QV   NG  V NL
Sbjct  396  DYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVRAFNGKPVNNL  455

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VED ++E ++FD+D ++V+VL    A+ AT  IL  H IP AMS DL
Sbjct  456  KQLATMVEDCNEEFLKFDMDYDQVVVLETKTARAATQDILTTHCIPSAMSDDL  508



>ref|XP_003886416.1| hypothetical protein NCLIV_068150 [Neospora caninum Liverpool]
 emb|CBZ56391.1| hypothetical protein NCLIV_068150 [Neospora caninum Liverpool]
Length=730

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL ++      + PGEQ VILS VL  D+  GYE L  +QV + NG  V+ L
Sbjct  618  DFESRAPVRLLDKWQHGFQSFPGEQFVILSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTL  677

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HL +LVE +++E  RFDLD + V+VL    A+ A   IL+R+ I    S D+
Sbjct  678  QHLAELVEKSTEEYWRFDLDHDEVVVLEAAAARRALPHILQRNMIRSHKSEDV  730



>ref|XP_002439270.1| hypothetical protein SORBIDRAFT_09g003540 [Sorghum bicolor]
 gb|EES17700.1| hypothetical protein SORBIDRAFT_09g003540 [Sorghum bicolor]
Length=604

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL  ++N GYE +   QV K+NG  ++N+ HL  LV+
Sbjct  464  KLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQVMKLNGTTIKNIHHLAHLVD  523

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  524  TCKDKFLTFEFEDDFLVVLHREEAAAASSDILKEHAIPSIRSSDL  568



>gb|AET50594.1| hypothetical protein [Eimeria tenella]
Length=577

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL +R    +   PG+Q VIL+ VL  +I  G+E L  +QV   NG +V  L
Sbjct  465  DFESRAPVRLLDRWQHGMQQFPGQQCVILTHVLAHEITVGFEHLHNIQVVAFNGEQVRTL  524

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HL+ LVE ++ E  RFDLD E V++L    A+ A   IL R+ IP   S  L
Sbjct  525  RHLKDLVEASTDEFWRFDLDHEEVVILKAASARSALKSILSRNLIPSHKSEGL  577



>emb|CDJ68975.1| trypsin, putative [Eimeria necatrix]
Length=568

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL +R    +   PG+Q VIL+ VL  +I  G+E L  +QV   NG +V  L
Sbjct  456  DFESRAPVRLLDRWQHGMQQFPGQQCVILTHVLAHEITVGFEHLHNIQVVAFNGEQVRTL  515

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HL+ LVE ++ E  RFDLD E V++L    A+ A   IL R+ IP   S  L
Sbjct  516  RHLKDLVEASTDEFWRFDLDHEEVVILKAASARSALKSILSRNLIPSHKSEGL  568



>emb|CDJ40717.1| trypsin, putative [Eimeria tenella]
Length=571

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P RL +R    +   PG+Q VIL+ VL  +I  G+E L  +QV   NG +V  L
Sbjct  459  DFESRAPVRLLDRWQHGMQQFPGQQCVILTHVLAHEITVGFEHLHNIQVVAFNGEQVRTL  518

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +HL+ LVE ++ E  RFDLD E V++L    A+ A   IL R+ IP   S  L
Sbjct  519  RHLKDLVEASTDEFWRFDLDHEEVVILKAASARSALKSILSRNLIPSHKSEGL  571



>gb|KIZ00510.1| hypothetical protein MNEG_7454 [Monoraphidium neglectum]
Length=605

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 70/114 (61%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    GDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVEN  180
             D+ + +P +L ++     PT+PG+Q+V+LSQVL  +   GYE +  ++V  +NG  V N
Sbjct  460  ADYASEAPVKLLDKLYHGQPTEPGQQVVVLSQVLAAESTLGYEDVLNVEVLAINGAPVRN  519

Query  181  LKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            L HL +LV    ++ +RFD +    +VL+ + A   T+ +L+ H IP A+S+DL
Sbjct  520  LAHLAELVAGCREQYLRFDCEYREAVVLDREEAFRDTAAVLEAHGIPAALSADL  573



>ref|XP_010424503.1| PREDICTED: putative protease Do-like 11, mitochondrial [Camelina 
sativa]
Length=585

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = +1

Query  34   CERALRKLPTKPGE-QLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            C+ AL     K GE QLVI+S++L DDIN GY+RL +LQV KVN V+V+NLKHL +LVE 
Sbjct  450  CKCALYDTYRKAGEHQLVIISKILEDDINKGYQRLDDLQVKKVNRVKVKNLKHLCELVEK  509

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  369
             S + +R  L+D++V+VLN + AK AT +I++RH+I   +S D+    C P L
Sbjct  510  CSTKYLRLVLEDDKVMVLNTESAKKATLKIMERHKIKSVISKDI----CLPML  558



>dbj|BAJ90442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V NL
Sbjct  487  DYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVRAFNGKPVNNL  546

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VED +KE ++FD+D ++V+VL    A+ AT  IL  H IP AMS DL
Sbjct  547  KQLATMVEDCNKEFLKFDMDYDQVVVLETKTARAATQDILTTHCIPSAMSDDL  599



>ref|XP_006655949.1| PREDICTED: protease Do-like 9-like, partial [Oryza brachyantha]
Length=504

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +   P EQLV++SQVL+ DIN GYE +  +QV   NG  ++NLKHL  
Sbjct  395  APVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNIQVLAFNGKTIKNLKHLAT  454

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE  S+E ++FD+D E+++VL    AK AT  IL  H IP A+S DL
Sbjct  455  MVEACSEEFLKFDMDYEQLVVLETKTAKAATQDILTTHCIPSAISEDL  502



>ref|NP_001146551.1| hypothetical protein [Zea mays]
 gb|ACL54269.1| unknown [Zea mays]
 gb|AFW57621.1| hypothetical protein ZEAMMB73_444319 [Zea mays]
Length=601

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GE++VI+SQVL  ++N GYE +   QV K+NG  ++N+ HL  LV+
Sbjct  460  KLLAKARYSLATFEGEEIVIVSQVLAHEVNIGYEHMGNQQVMKLNGTTIKNIHHLAHLVD  519

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  520  TCKDKFLTFEFEDDFLVVLHREEADAASSDILKEHAIPSIRSSDL  564



>ref|XP_008438126.1| PREDICTED: protease Do-like 9 [Cucumis melo]
Length=586

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  472  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNL  531

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE    E ++FDL+ ++++VL    AK ATS IL  H IP AMS+DL
Sbjct  532  KSLANMVESCDDEFLKFDLEYQQIVVLRTSTAKAATSDILATHCIPSAMSNDL  584



>ref|XP_004152460.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 ref|XP_004157795.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 gb|KGN64293.1| hypothetical protein Csa_1G045910 [Cucumis sativus]
Length=586

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  472  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNL  531

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE    E ++FDL+ ++++VL    AK ATS IL  H IP AMS+DL
Sbjct  532  KSLANMVESCDDEFLKFDLEYQQIVVLRTSTAKAATSDILATHCIPSAMSNDL  584



>ref|XP_002502087.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63345.1| predicted protein [Micromonas sp. RCC299]
Length=463

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L E+       + G+Q+VI +QVL  ++N GYE L    V   NGV++ NL
Sbjct  350  DYDFDAPVKLLEKFCHGRVEEEGQQVVICAQVLAAEVNRGYEDLHNTIVQSFNGVKIFNL  409

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L + VE +  E +RF+LD E  +V++   A  AT  ILK H IP A S+DL
Sbjct  410  KQLAQAVESSKDEFMRFELDHEISVVMDTKAANSATKAILKTHAIPSAKSADL  462



>ref|XP_004508846.1| PREDICTED: protease Do-like 9-like [Cicer arietinum]
Length=582

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P ++ E+ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  468  DYEYEAPVKILEKLLYAMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNL  527

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE    E ++FDLD E+++VL    AK AT  IL  H IP AMS DL
Sbjct  528  KSLAAMVESCDDEYLKFDLDYEQIVVLRTKTAKAATLDILTTHCIPSAMSDDL  580



>ref|XP_010111735.1| Protease Do-like 9 [Morus notabilis]
 gb|EXC31597.1| Protease Do-like 9 [Morus notabilis]
Length=590

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 45/108 (42%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +     EQ V++SQVL+ DIN GYE +   QV   NG  V NLK L  
Sbjct  481  APVKLLDKHLHAMAQSVDEQAVVVSQVLVADINIGYEDIVNTQVLAFNGKPVRNLKTLAS  540

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE  + E ++F+L+ ++++VL    A+ AT  IL  H IP AMS DL
Sbjct  541  MVESCNDEYLKFNLEYDQIVVLQTKTAREATLDILATHCIPSAMSDDL  588



>ref|XP_003564034.1| PREDICTED: protease Do-like 9 [Brachypodium distachyon]
Length=599

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +   P EQLV++SQVL+ DIN GYE L   QV   NG  V NL
Sbjct  485  DYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVLAFNGKPVNNL  544

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VED  +E ++FD+D ++V+VL    AK AT  IL  H IP AMS DL
Sbjct  545  KQLATMVEDCKEEFLKFDMDYDQVVVLETKTAKAATQDILATHCIPSAMSDDL  597



>ref|XP_003525265.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=584

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  470  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPVKNL  529

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  530  KSLATMVESCNDEYLKFDLDYDQIVVLRMKTAKAATLDILATHCIPSAMSDDL  582



>ref|XP_006855396.1| hypothetical protein AMTR_s00057p00143260 [Amborella trichopoda]
 gb|ERN16863.1| hypothetical protein AMTR_s00057p00143260 [Amborella trichopoda]
Length=528

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+V+LSQVL ++ N GYE +   QV K NG +++N++HL  LV+
Sbjct  388  KLLAKARYSLAKFKGEQIVLLSQVLANEANIGYEDMGNQQVLKFNGTKIKNIRHLAHLVD  447

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                E + F+ +D  + VL+ + A +A+ RILK + IP+  SS+L
Sbjct  448  TCKDEYLIFEFEDNFLAVLDREAASIASPRILKDYGIPFERSSNL  492



>ref|XP_003288812.1| hypothetical protein DICPUDRAFT_153086 [Dictyostelium purpureum]
 gb|EGC34675.1| hypothetical protein DICPUDRAFT_153086 [Dictyostelium purpureum]
Length=607

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +1

Query  25   RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  204
            RR+ ER + K+ T    Q+VILSQVL D  N GY  L+  +V KVNGV V NLKHL +L+
Sbjct  484  RRIYER-IEKI-TSEDFQVVILSQVLFDKTNHGYSNLSLCEVKKVNGVPVRNLKHLVQLI  541

Query  205  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            E N  + +   L+ E +I+L+ D A+ A  R++ +H IP+  S DL
Sbjct  542  ESNENKYLVITLEHENLIILDKDEAQEANVRVMSQHAIPHLKSLDL  587



>gb|KHN48612.1| Protease Do-like 9 [Glycine soja]
Length=386

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  272  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPVKNL  331

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  332  KSLATMVESCNDEYLKFDLDYDQIVVLRMKTAKAATLDILATHCIPSAMSDDL  384



>gb|EMS54752.1| Protease Do-like 2, chloroplastic [Triticum urartu]
Length=598

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL +D+N GYE +   QV K+NG  ++N+ HL  LV+
Sbjct  458  KLLAKARYSLSTFEGEQIVIVSQVLANDVNIGYEHMGNQQVIKLNGTMIKNIHHLAHLVD  517

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VL+ + A  A+S I K H IP   S DL
Sbjct  518  TCQDKFLTFEFEDDFLVVLDREEAAAASSDIQKEHAIPSVRSLDL  562



>ref|XP_008239730.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=587

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  LP  P EQLV++SQVL+ DIN GYE +   QV  +NG  V+NL
Sbjct  473  DYEFEAPVKLLDKMLHSLPQSPDEQLVVVSQVLVADINIGYEEIVNTQVLALNGKPVKNL  532

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K+L  +VE+   E ++FDL+ ++++VL  + AK AT  IL  H IP AMS DL
Sbjct  533  KNLASMVEECEDEFLKFDLEYQQMVVLRTNTAKEATLDILATHCIPSAMSDDL  585



>ref|XP_006281902.1| hypothetical protein CARUB_v10028106mg, partial [Capsella rubella]
 gb|EOA14800.1| hypothetical protein CARUB_v10028106mg, partial [Capsella rubella]
Length=466

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 17/107 (16%)
 Frame = +1

Query  31   LCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVED  210
            +C  +L +   K GEQ+V++SQV                  KVNGVEV NL+HL  L+E 
Sbjct  365  ICNCSLDRKAKKAGEQIVMISQV-----------------KKVNGVEVLNLRHLSDLIEK  407

Query  211  NSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIND  351
             S+E +R DL+ ERVI +NY  AK AT  IL+ H IP AMS DL  D
Sbjct  408  CSEEDLRLDLEKERVITVNYKSAKEATPWILEHHGIPSAMSKDLKED  454



>gb|EMT00922.1| Protease Do-like 2, chloroplastic [Aegilops tauschii]
Length=642

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL +D+N GYE +   QV K+NG  ++N+ HL  LV+
Sbjct  502  KLLAKARYSLSTFEGEQIVIVSQVLANDVNIGYEHMGNQQVIKLNGTMIKNIHHLAHLVD  561

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VL+ + A  A+S I K H IP   S DL
Sbjct  562  TCQDKFLTFEFEDDFLVVLDREEAAAASSDIQKEHAIPSVRSLDL  606



>ref|XP_003550747.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=576

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE     QV   NG  V+NL
Sbjct  462  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDFVNTQVLAFNGQPVKNL  521

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  522  KSLATMVESCNDEYLKFDLDYDQIVVLRTKTAKAATLDILSTHCIPSAMSDDL  574



>ref|XP_001753311.1| predicted protein [Physcomitrella patens]
 gb|EDQ81940.1| predicted protein [Physcomitrella patens]
Length=851

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 71/120 (59%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P ++ E++   +     EQLV++SQVL +D+N GYE +A   V   NGV++ NL
Sbjct  718  DFEYDAPVKILEKSRHGMAEFDDEQLVVVSQVLANDVNIGYEEIANTLVKTFNGVKIRNL  777

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL  L++  + + +RF+LD   ++VL   +A+  T +IL+ + +P   S DLI     P
Sbjct  778  RHLADLIDTCTDDFMRFELDYCSLVVLETKVARSVTPKILEDNCVPTDRSQDLITSAALP  837



>dbj|BAJ90870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L T  GEQ+VI+SQVL +D+N GYE +   QV K+NG  ++N+ HL  LV+
Sbjct  464  KLLAKARYSLSTFEGEQIVIVSQVLANDVNIGYEHMGNQQVIKLNGTMIKNIHHLAHLVD  523

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D+ ++VL+ + A  A+S I K H IP   S DL
Sbjct  524  TCQDKFLTFEFEDDFLVVLDREEAVAASSDIQKEHAIPSVRSMDL  568



>ref|XP_007155398.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
 gb|ESW27392.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
Length=588

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  LP  P EQLV++SQVL+ DIN GYE +  +QV   NG  V+NL
Sbjct  474  DYEYEAPVKLLDKLLHSLPQSPDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGKPVKNL  533

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  + E ++FDLD ++++VL    AK  T  IL  H IP AMS DL
Sbjct  534  KSLATMVESCNDEYLKFDLDYDQIVVLRSKTAKATTLDILATHCIPSAMSDDL  586



>ref|XP_005850048.1| hypothetical protein CHLNCDRAFT_34342 [Chlorella variabilis]
 gb|EFN57946.1| hypothetical protein CHLNCDRAFT_34342 [Chlorella variabilis]
Length=606

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L     +P +++V++SQVL  +   GYE +   QV+K NG  V NLKHL +
Sbjct  422  APIKLLDKLLHAWKDEPDQEVVVISQVLACNATLGYEEVFNTQVHKFNGTPVRNLKHLTE  481

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +V    ++ +RFD+D   VIV++  +A  AT  IL+ H IP   S DL
Sbjct  482  MVLTCKEQHMRFDVDYSEVIVIDTAVANEATEEILRLHSIPAMGSKDL  529



>gb|ABK21948.1| unknown [Picea sitchensis]
Length=192

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 72/118 (61%), Gaps = 10/118 (8%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   LP   GEQ+VILSQVL +D+N GYE ++  QV K+N ++++N++HL  +V+
Sbjct  52   KLMAKARYSLPKFEGEQMVILSQVLANDVNIGYEDMSNQQVLKLNEIKIKNIRHLAHIVD  111

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRI----------PYAMSSDLIND  351
              + + + F+L+D  ++V+    A   T +ILK + I          PY  SS+++N+
Sbjct  112  SCNDKYLIFELEDNFLVVMERQAASAETPQILKDYGIACERSPDLSEPYVNSSEIVNE  169



>ref|XP_010070002.1| PREDICTED: protease Do-like 2, chloroplastic [Eucalyptus grandis]
 gb|KCW58553.1| hypothetical protein EUGRSUZ_H01212 [Eucalyptus grandis]
Length=638

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 51/146 (35%), Positives = 77/146 (53%), Gaps = 13/146 (9%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE +   QV K NG +++N++HL  LV+
Sbjct  498  KLLAKARYSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVLKFNGTQIKNIRHLAHLVD  557

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACSN  387
                + + F+ +D  + VL  + A  A+S ILK + IP   SSDL+     P ++L   N
Sbjct  558  SCKDKYLVFEFEDNYLAVLEREAAMAASSCILKDYGIPAERSSDLLE----PYVDLPTDN  613

Query  388  *fffkllfflTEILYFKNSPFQLLNL  465
                +          F NSP   L +
Sbjct  614  EKVEQD---------FGNSPVSSLEI  630



>ref|XP_010041338.1| PREDICTED: protease Do-like 2, chloroplastic [Eucalyptus grandis]
 gb|KCW44430.1| hypothetical protein EUGRSUZ_L02072 [Eucalyptus grandis]
Length=635

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 51/146 (35%), Positives = 77/146 (53%), Gaps = 13/146 (9%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE +   QV K NG +++N++HL  LV+
Sbjct  495  KLLAKARYSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVLKFNGTQIKNIRHLAHLVD  554

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACSN  387
                + + F+ +D  + VL  + A  A+S ILK + IP   SSDL+     P ++L   N
Sbjct  555  SCKDKYLVFEFEDNYLAVLEREAAMAASSCILKDYGIPAERSSDLLE----PYVDLPTDN  610

Query  388  *fffkllfflTEILYFKNSPFQLLNL  465
                +          F NSP   L +
Sbjct  611  EKVEQD---------FGNSPVSSLEI  627



>gb|KHN18478.1| Protease Do-like 9 [Glycine soja]
Length=464

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE     QV   NG  V+NL
Sbjct  350  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDFVNTQVLAFNGQPVKNL  409

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  410  KSLATMVESCNDEYLKFDLDYDQIVVLRTKTAKAATLDILSTHCIPSAMSDDL  462



>ref|XP_008341479.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=564

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 44/111 (40%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +1

Query  22   PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  201
            P +L ++ L  +     EQL+++SQVL+ DIN GYE +   QV   NG+ V+NLK+L  +
Sbjct  427  PIKLLDKHLHAMAQSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGMPVKNLKNLASM  486

Query  202  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            +E+   E ++F L+  +++VL    AK AT  IL  H I  +MS DL   E
Sbjct  487  IENCDDEYLKFGLEYNQMVVLQTKTAKAATLDILTTHCISSSMSDDLKTKE  537



>ref|XP_009348028.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=563

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +1

Query  22   PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  201
            P +L ++ L  +     EQL+++SQVL+ DIN GYE +   QV   NG+ V+NLK+L  +
Sbjct  427  PIKLLDKHLHAMARSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGMPVKNLKNLVSM  486

Query  202  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            VE+   E ++F L+  +++VL    AK AT  IL  H I  +MS DL   E
Sbjct  487  VENCDDEYLKFGLECNQMVVLQTKTAKAATLDILTTHCISSSMSDDLKTKE  537



>gb|KHF97497.1| Protease Do-like 9 [Gossypium arboreum]
Length=249

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV  +NG  ++NL
Sbjct  135  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVSDINIGYEDIVNTQVLALNGKPMKNL  194

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            + L ++VE+   E ++FDL+ E+++VL    AK AT  IL  H IP AMS DL
Sbjct  195  RRLAEMVENCDDEFLKFDLEYEQIVVLRTKTAKAATPDILATHCIPSAMSVDL  247



>ref|XP_004357429.1| hypothetical protein DFA_02707 [Dictyostelium fasciculatum]
 gb|EGG18967.1| hypothetical protein DFA_02707 [Dictyostelium fasciculatum]
Length=631

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +1

Query  61   TKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDL  240
            T P  Q+V+++QVL+D IN GY      +V KVN + ++NLKHL +L+E N+ + +   L
Sbjct  535  TSPDYQIVVIAQVLIDKINYGYSSFGLCEVKKVNNIPIKNLKHLVELIESNTNQYLVITL  594

Query  241  DDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            + + +I+L+ D    A  RI+ +H IP A S DL N
Sbjct  595  EHDYLIILDRDEVMEANKRIMAQHAIPSAKSDDLKN  630



>ref|XP_007200306.1| hypothetical protein PRUPE_ppa002853mg [Prunus persica]
 gb|EMJ01505.1| hypothetical protein PRUPE_ppa002853mg [Prunus persica]
Length=628

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/106 (41%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE ++  QV K+NG ++ N+ HL  LV+
Sbjct  488  KLLAKARYSLARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTQIRNIHHLAYLVD  547

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                + + F+ +D  + VL  + A  A+S ILK + IP   SSDL+
Sbjct  548  SCKDKYLVFEFEDNYITVLEREAATAASSCILKDYGIPSERSSDLL  593



>ref|XP_009349862.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=562

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 0/111 (0%)
 Frame = +1

Query  22   PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  201
            P +L ++ L  +     EQL+++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  426  PIKLLDKHLHAMARSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGTPVKNLKNLVSM  485

Query  202  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  354
            VE+   E ++F L+  +++VL    AK AT  IL  H I  +MS DL   E
Sbjct  486  VENCDDEYLKFGLECNQMVVLQTKTAKAATLDILTTHCISSSMSDDLKTKE  536



>ref|NP_001136976.1| uncharacterized protein LOC100217136 [Zea mays]
 gb|ACF82998.1| unknown [Zea mays]
 gb|AFW76816.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=129

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ L  +     EQLV++SQVL+ DIN GYE +  +QV   NG  V+NLKHL  
Sbjct  20   APVKLLDKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGTPVKNLKHLAT  79

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE+ ++  ++FDLD ++V+VL    AK AT  IL  H IP A S +L
Sbjct  80   MVEECNEAFLKFDLDFDQVVVLETKTAKAATQDILTTHCIPSAASEEL  127



>ref|XP_007144565.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
 gb|ESW16559.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
Length=364

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  RA   L    GEQ+VILSQVL +++N GYE +   QV K NG  ++N+ HL  LV+
Sbjct  224  KLLARARYSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLAHLVD  283

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                  + F+ +D  V VL+ +    A+S IL  + IP   SSDL
Sbjct  284  SCEDRYLSFEFEDSYVAVLDREAVSDASSSILSDYGIPSGRSSDL  328



>ref|XP_006352801.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=611

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 69/115 (60%), Gaps = 0/115 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+V+LSQVL +++N GYE ++  QV K+NG  ++N+ HL  LV+
Sbjct  479  KLLTKARYSLAKFEGEQIVVLSQVLANEVNIGYEDMSNEQVLKMNGTRIKNIHHLAHLVD  538

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALE  372
             +  + + F+ +D  ++VL  + A  A++ ILK + IP   SSDL+       +E
Sbjct  539  SSKGKYLVFEFEDNILVVLEREEAMSASASILKDYGIPAERSSDLLGQYVDSTIE  593



>ref|XP_007144564.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
 gb|ESW16558.1| hypothetical protein PHAVU_007G1665001g, partial [Phaseolus vulgaris]
Length=369

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  RA   L    GEQ+VILSQVL +++N GYE +   QV K NG  ++N+ HL  LV+
Sbjct  229  KLLARARYSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLAHLVD  288

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                  + F+ +D  V VL+ +    A+S IL  + IP   SSDL
Sbjct  289  SCEDRYLSFEFEDSYVAVLDREAVSDASSSILSDYGIPSGRSSDL  333



>ref|XP_011079745.1| PREDICTED: protease Do-like 2, chloroplastic [Sesamum indicum]
Length=626

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/112 (38%), Positives = 68/112 (61%), Gaps = 0/112 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   +P   GEQ+VILSQVL +++N GYE ++  QV K+NG  + N+ HL  LV+
Sbjct  482  KLLTKARYSMPRFKGEQIVILSQVLANEVNIGYEDMSNEQVLKLNGTWIRNIHHLAHLVD  541

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
               ++ + F+ +D  ++VL  + A  A+  ILK + IP   S+DL++    P
Sbjct  542  SCKEKYLVFEFEDNFLVVLERESALAASESILKGYGIPSERSADLLDPYVDP  593



>ref|XP_004965071.1| PREDICTED: protease Do-like 9-like [Setaria italica]
Length=604

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++    +   P EQLV++SQVL+ DIN GYE +  +QV   NG  V+NL
Sbjct  490  DYEYDAPVKLLDKHSHAMAQSPDEQLVVVSQVLVSDINIGYEDIVNIQVLAFNGTPVKNL  549

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL  +VE+ ++  ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  550  KHLATMVEECNEAFLKFDLDYDQLVVLETKTAKAATQDILTTHCIPSAMSEDL  602



>ref|XP_008386612.1| PREDICTED: protease Do-like 2, chloroplastic [Malus domestica]
Length=621

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE ++  QV K+NG ++ N+ HL  LV+
Sbjct  481  KLLXKARYSLARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTQIRNIHHLAYLVD  540

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                + + F+ +D  + VL  + A  A+S ILK + IP   SSDL
Sbjct  541  SCKDKYLVFEFEDNYITVLEREAALAASSCILKDYGIPSERSSDL  585



>ref|XP_008659079.1| PREDICTED: protease Do-like 9 [Zea mays]
 gb|AFW85217.1| hypothetical protein ZEAMMB73_653756 [Zea mays]
Length=249

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQLV++SQVL+ DIN GYE +  +QV   NG  V NL
Sbjct  135  DYEYDAPVKLLDKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGTPVTNL  194

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL  +VE+ ++  ++FDLD ++V+VL    AK AT  I+  H IP A+S DL
Sbjct  195  KHLATMVEECNEAFLKFDLDHDQVVVLETKTAKAATQDIVTTHCIPSAVSEDL  247



>ref|XP_010029214.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=589

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  475  DYEFDAPVKLLDKLLHSMAGSVNEQLVVVSQVLVADINIGYEDIVNTQVLAFNGEPVKNL  534

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L  +VE+   E +RFDL+ ++V+VL    AKVATS IL  H IP AMS+DL
Sbjct  535  KSLANMVENCEDEYLRFDLEYQQVVVLRTKTAKVATSDILTTHCIPSAMSNDL  587



>ref|XP_007036141.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036142.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036143.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036144.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036145.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036146.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20642.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20643.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20644.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20645.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20646.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20647.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
Length=589

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ D N GYE +   QV   NG  V+NL
Sbjct  475  DYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLVADTNIGYEDIVNTQVLAFNGKPVKNL  534

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L ++VE+   E ++FDL+ E+++VL    AK AT  IL  H IP AMS DL
Sbjct  535  KSLAEMVENCEDEFLKFDLEYEQMVVLRTKTAKAATPDILAMHCIPSAMSEDL  587



>ref|XP_010323029.1| PREDICTED: protease Do-like 2, chloroplastic [Solanum lycopersicum]
Length=608

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+V+LSQVL +++N GYE ++  QV K+NG  ++N+ HL  LV+
Sbjct  476  KLLTKARYSLAKFEGEQIVVLSQVLANEVNIGYEDMSNEQVLKLNGTRIKNIHHLAHLVD  535

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
             +  + + F+ +D  ++VL    A  A++ ILK + IP   SSDL+
Sbjct  536  SSKGKYLVFEFEDNILVVLERKEAMSASASILKDYGIPAERSSDLL  581



>gb|EYU46653.1| hypothetical protein MIMGU_mgv1a0034321mg, partial [Erythranthe 
guttata]
Length=289

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   +P   GEQ+V+LSQVL +++N GYE ++  QV K+NG  ++N+ HL  LV+
Sbjct  148  KLLTKARYSMPKFKGEQIVVLSQVLANEVNIGYEDMSNEQVLKLNGTWIKNIHHLAHLVD  207

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                + + F+ +D  ++VL  + A  A+  ILK + IP   S DL+
Sbjct  208  SCKDKYLIFEFEDNFLVVLERESALSASESILKGYGIPSVRSCDLL  253



>ref|XP_010227815.1| PREDICTED: protease Do-like 9, partial [Brachypodium distachyon]
Length=473

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 0/112 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +   P EQLV++SQVL+ DIN GYE L   QV   NG  V NL
Sbjct  359  DYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVLAFNGKPVNNL  418

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSD  339
            K L  +VED  +E ++FD+D ++V+VL    AK AT  IL  H IP  MS D
Sbjct  419  KQLATMVEDCKEELLKFDMDYDQVVVLETKTAKAATQDILATHCIPSVMSDD  470



>gb|AFK37778.1| unknown [Lotus japonicus]
Length=144

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE ++  QV K NG  ++N  HL  L++
Sbjct  4    KLLAKARYALARFKGEQIVILSQVLANELNIGYEDMSNQQVVKFNGTRIKNTHHLAHLID  63

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                  + F+ +D  V VL  +    A+S IL  + IP   SSDL+
Sbjct  64   SCKGRYLCFEFEDSYVAVLEREAVAAASSSILTDYGIPSERSSDLL  109



>ref|XP_006476739.1| PREDICTED: protease Do-like 9-like isoform X1 [Citrus sinensis]
Length=585

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  471  DYEYEAPVKLLDKLLYSMPQLPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGNPVKNL  530

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            K L  +VE+   E ++FDL+ ++V+VL    +K AT  IL  H IP AMS DL N
Sbjct  531  KSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDLKN  585



>gb|KDD74963.1| hypothetical protein H632_c960p1 [Helicosporidium sp. ATCC 50920]
Length=538

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ +  +   PG+Q++ILSQVL  + N GYE +   QV  V+G  V +L+ L  
Sbjct  426  APVKLLDKMMHAMAQSPGQQVIILSQVLAAEANVGYEDVVNTQVLAVDGQAVHSLRELVA  485

Query  199  LVEDN-SKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
            LVE    +E IRFDL+ ++ I L+      AT+ IL++H IP   S DL+
Sbjct  486  LVEGGPPREIIRFDLEYQQAIALDRAQVAAATADILRQHCIPADRSVDLL  535



>ref|XP_640805.1| hypothetical protein DDB_G0281081 [Dictyostelium discoideum AX4]
 gb|EAL66837.1| hypothetical protein DDB_G0281081 [Dictyostelium discoideum AX4]
Length=647

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +1

Query  25   RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  204
            RR+ ER + K+ T    Q+VILSQVL D  N GY  L+  +V +VN + V+NLKHL  L+
Sbjct  499  RRVYER-IEKI-TSEDFQVVILSQVLFDKTNHGYSNLSLTEVKRVNDIPVKNLKHLVHLI  556

Query  205  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            E N    +   L+ E  I+L  D A  A  R++K+H IP+  S DL
Sbjct  557  ESNQNPYLVITLEHENFIILKKDEADQANLRVMKQHAIPHLKSEDL  602



>ref|XP_002511438.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF52040.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=569

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +1

Query  19   SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  198
            +P +L ++ +  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  460  APVKLLDKLMHAMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLAN  519

Query  199  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            +VE  + E ++F+L+ E+++VL    AK AT  IL  H IP AMS DL
Sbjct  520  MVESCNDEFLKFELEYEQIVVLRTKTAKAATVDILTTHCIPSAMSEDL  567



>ref|XP_010684759.1| PREDICTED: protease Do-like 2, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=572

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE ++  QV K+NG  + N+ HL  L +
Sbjct  432  KLLTKARYSLARFRGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTHIRNIHHLAHLTD  491

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
              + + + F+ +D  ++VL  + A  A+S ILK + IP   SSDL+
Sbjct  492  SCNDKYLVFEFEDNYLVVLERETAAAASSCILKDYGIPSERSSDLM  537



>ref|XP_007050776.1| DEGP protease 2 isoform 1 [Theobroma cacao]
 gb|EOX94933.1| DEGP protease 2 isoform 1 [Theobroma cacao]
Length=633

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 63/106 (59%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE +   QV K NG+ ++N+ HL  LV 
Sbjct  493  KLLAKARYSLARFKGEQIVILSQVLANEVNIGYEDMGNQQVLKFNGIRIKNIHHLAHLVA  552

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                + + F+ +D  + VL  + A  A+SRILK + IP   S DL+
Sbjct  553  CCKDKYLVFEFEDNYLAVLEREAAMAASSRILKDYGIPSEKSDDLL  598



>ref|XP_002982828.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
 gb|EFJ16073.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
Length=494

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L  + L  +     EQLV++SQVL+ D+N GYE +   QV   NG  V NL
Sbjct  377  DYDYDAPVKLLNKLLHSMAKTEDEQLVVVSQVLVADVNIGYEDIVNTQVLAFNGTSVTNL  436

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            KHL  +VE    E ++FDLD ++V+VL    AK AT  IL  H IP  MSSDL
Sbjct  437  KHLANMVESCKDEFLKFDLDHQQVLVLETQRAKAATPAILATHCIPSPMSSDL  489



>ref|XP_006476740.1| PREDICTED: protease Do-like 9-like isoform X2 [Citrus sinensis]
Length=430

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NL
Sbjct  316  DYEYEAPVKLLDKLLYSMPQLPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGNPVKNL  375

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  348
            K L  +VE+   E ++FDL+ ++V+VL    +K AT  IL  H IP AMS DL N
Sbjct  376  KSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDLKN  430



>ref|XP_006588605.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X2 
[Glycine max]
Length=513

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  RA   L    GEQ+VILSQVL +++N GYE +   QV K NG  ++N+ HL  L++
Sbjct  371  KLLARARYSLAKFKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLAHLID  430

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                  +RF+ +D  V VL  +    A+  +L  + IP   SSDL+
Sbjct  431  SCKDRYLRFEFEDSYVAVLEKESVTAASPSVLSDYGIPSERSSDLL  476



>ref|XP_010684757.1| PREDICTED: protease Do-like 2, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=632

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE ++  QV K+NG  + N+ HL  L +
Sbjct  492  KLLTKARYSLARFRGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTHIRNIHHLAHLTD  551

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
              + + + F+ +D  ++VL  + A  A+S ILK + IP   SSDL+
Sbjct  552  SCNDKYLVFEFEDNYLVVLERETAAAASSCILKDYGIPSERSSDLM  597



>ref|XP_003536894.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X1 
[Glycine max]
Length=612

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  RA   L    GEQ+VILSQVL +++N GYE +   QV K NG  ++N+ HL  L++
Sbjct  470  KLLARARYSLAKFKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGTRIKNIHHLAHLID  529

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                  +RF+ +D  V VL  +    A+  +L  + IP   SSDL+
Sbjct  530  SCKDRYLRFEFEDSYVAVLEKESVTAASPSVLSDYGIPSERSSDLL  575



>ref|XP_005649879.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
 gb|EIE25335.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
Length=479

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+ + +P +L +R L        E++VILSQVL  D   GYE L   QV K N   V NL
Sbjct  354  DYISETPVKLLDRLLYGQREHIDEEVVILSQVLACDATLGYEDLFNTQVLKFNETPVRNL  413

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  363
            +HL +L    S   +RFDL+   V++L    A  AT  IL  H IP ++S DL++   AP
Sbjct  414  RHLAQLATACSDPFMRFDLEYNEVVILETKNAHAATKEILALHSIPASVSKDLLDIVSAP  473



>ref|XP_004252664.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=582

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +1

Query  4    DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  183
            D+   +P +L ++ L  +     EQLV++SQVL+ DIN GYE L   QV   NG  V+NL
Sbjct  468  DYEFDAPVKLLDKLLHAMAQSMDEQLVVVSQVLVADINIGYEELVNTQVIAFNGKPVKNL  527

Query  184  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
            K L K+VE   +E ++FDLD  +++VL    AK ATS IL  H IP AMS DL
Sbjct  528  KSLAKMVEACKEEYMKFDLDYNQIVVLQTTNAKAATSDILAMHCIPSAMSDDL  580



>ref|XP_011458665.1| PREDICTED: protease Do-like 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
Length=624

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE ++  QV K+NG  ++N+ HL  LV+
Sbjct  484  KLLAKARYSLARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTPIKNIHHLAHLVD  543

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                + + F+ +D  + VL  + A  +++ ILK + IP   SSDL+
Sbjct  544  SCKHKYLVFEFEDNYITVLEREGALASSTSILKDYGIPAERSSDLL  589



>ref|XP_005704063.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
 gb|EME27543.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
Length=584

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 0/109 (0%)
 Frame = +1

Query  7    WYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLK  186
            W   +P +L ++ L        EQ+VILSQVL   IN GYE L   ++   NG  VENL 
Sbjct  471  WDFEAPVKLLDKLLYGYKRTANEQVVILSQVLNARINVGYECLTNTELLHFNGTRVENLC  530

Query  187  HLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  333
            HL  L+++ S+E +RFDL+ + VIV+    A   +S+IL +H IP   S
Sbjct  531  HLANLIDETSEEFLRFDLEFDEVIVIEKQAALEQSSQILVQHGIPTPRS  579



>ref|XP_003520225.1| PREDICTED: protease Do-like 2, chloroplastic-like [Glycine max]
Length=612

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 59/105 (56%), Gaps = 0/105 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  RA   L    GEQ+VILSQVL +++N GYE +   QV K NG  ++N+ HL  L++
Sbjct  470  KLLARARYSLAKFKGEQIVILSQVLANEVNIGYEDMGNQQVVKFNGARIKNIHHLAHLID  529

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  342
                  +RF+ +D  V VL  +    A+  +L  + IP   SSDL
Sbjct  530  SCEDRYLRFEFEDSYVAVLEKEAVAAASPSVLSDYGIPSERSSDL  574



>ref|XP_004290719.1| PREDICTED: protease Do-like 2, chloroplastic isoform X2 [Fragaria 
vesca subsp. vesca]
Length=622

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   RLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVE  207
            +L  +A   L    GEQ+VILSQVL +++N GYE ++  QV K+NG  ++N+ HL  LV+
Sbjct  482  KLLAKARYSLARFKGEQIVILSQVLANEVNIGYEDMSNQQVLKLNGTPIKNIHHLAHLVD  541

Query  208  DNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  345
                + + F+ +D  + VL  + A  +++ ILK + IP   SSDL+
Sbjct  542  SCKHKYLVFEFEDNYITVLEREGALASSTSILKDYGIPAERSSDLL  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780