BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049O02

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788736.1|  PREDICTED: luminal-binding protein 4               385   2e-126   Nicotiana sylvestris
sp|Q03684.1|BIP4_TOBAC  RecName: Full=Luminal-binding protein 4; ...    384   2e-126   Nicotiana tabacum [American tobacco]
ref|XP_009588550.1|  PREDICTED: luminal-binding protein 4               383   5e-126   Nicotiana tomentosiformis
gb|ACK55195.1|  ER luminal-binding protein                              383   6e-126   Nicotiana benthamiana
ref|XP_009773333.1|  PREDICTED: luminal-binding protein 5               377   1e-123   Nicotiana sylvestris
gb|AGS42239.1|  ER luminal-binding protein                              376   4e-123   Capsicum annuum
emb|CDP05035.1|  unnamed protein product                                375   9e-123   Coffea canephora [robusta coffee]
ref|XP_009592769.1|  PREDICTED: luminal-binding protein 5               374   2e-122   Nicotiana tomentosiformis
ref|XP_011075955.1|  PREDICTED: luminal-binding protein 5               374   2e-122   Sesamum indicum [beniseed]
gb|KJB39586.1|  hypothetical protein B456_007G020600                    365   7e-122   Gossypium raimondii
ref|XP_004234985.1|  PREDICTED: luminal-binding protein 5               372   1e-121   Solanum lycopersicum
ref|XP_007211088.1|  hypothetical protein PRUPE_ppa002489mg             372   2e-121   Prunus persica
gb|KJB39579.1|  hypothetical protein B456_007G020300                    365   1e-120   Gossypium raimondii
ref|XP_008437399.1|  PREDICTED: luminal-binding protein 5               368   4e-120   Cucumis melo [Oriental melon]
ref|XP_006350519.1|  PREDICTED: luminal-binding protein 5-like          368   5e-120   Solanum tuberosum [potatoes]
emb|CAC14168.1|  putative luminal binding protein                       367   7e-120   Corylus avellana [European hazelnut]
ref|XP_004143862.1|  PREDICTED: luminal-binding protein 5-like          367   8e-120   
gb|KJB39584.1|  hypothetical protein B456_007G020600                    367   1e-119   Gossypium raimondii
gb|AAW55475.1|  ER-binding protein                                      367   1e-119   Malus pumila [paradise apple]
ref|XP_008239207.1|  PREDICTED: luminal-binding protein 5               367   1e-119   Prunus mume [ume]
gb|AAK21920.1|AF338252_1  BiP-isoform D                                 361   1e-119   Glycine max [soybeans]
ref|XP_008390320.1|  PREDICTED: luminal-binding protein 5               367   2e-119   Malus domestica [apple tree]
gb|KJB39580.1|  hypothetical protein B456_007G020300                    367   2e-119   Gossypium raimondii
ref|XP_011084527.1|  PREDICTED: luminal-binding protein 5-like          367   2e-119   Sesamum indicum [beniseed]
emb|CAB72128.1|  heat shock protein 70                                  365   6e-119   Cucumis sativus [cucumbers]
gb|KHG04866.1|  Luminal-binding 5                                       367   7e-119   Gossypium arboreum [tree cotton]
gb|KHN16716.1|  Luminal-binding protein 5                               366   1e-118   Glycine soja [wild soybean]
ref|XP_009770477.1|  PREDICTED: luminal-binding protein 4-like          364   1e-118   Nicotiana sylvestris
ref|XP_010266594.1|  PREDICTED: luminal-binding protein 5               364   1e-118   Nelumbo nucifera [Indian lotus]
ref|XP_009619852.1|  PREDICTED: luminal-binding protein 4-like          364   1e-118   Nicotiana tomentosiformis
gb|AAA99920.1|  glucose-regulated protein 78                            354   2e-118   Solanum lycopersicum
gb|KHM99873.1|  Luminal-binding protein 5                               363   3e-118   Glycine soja [wild soybean]
ref|XP_008337565.1|  PREDICTED: luminal-binding protein 5-like          363   3e-118   
gb|KDP25255.1|  hypothetical protein JCGZ_20411                         363   3e-118   Jatropha curcas
gb|KDP35832.1|  hypothetical protein JCGZ_10646                         363   4e-118   Jatropha curcas
ref|XP_006476337.1|  PREDICTED: luminal-binding protein 5-like          363   4e-118   Citrus sinensis [apfelsine]
ref|XP_006439283.1|  hypothetical protein CICLE_v10019184mg             362   6e-118   Citrus clementina [clementine]
ref|XP_003530453.1|  PREDICTED: luminal-binding protein 5               362   7e-118   Glycine max [soybeans]
ref|XP_010107258.1|  Luminal-binding protein 5                          362   8e-118   Morus notabilis
gb|KJB18908.1|  hypothetical protein B456_003G074600                    354   9e-118   Gossypium raimondii
ref|XP_009802727.1|  PREDICTED: luminal-binding protein                 362   9e-118   Nicotiana sylvestris
gb|KJB18909.1|  hypothetical protein B456_003G074600                    354   9e-118   Gossypium raimondii
ref|XP_009593820.1|  PREDICTED: luminal-binding protein                 362   1e-117   Nicotiana tomentosiformis
gb|AAB86942.1|  endoplasmic reticulum HSC70-cognate binding prote...    362   1e-117   Glycine max [soybeans]
gb|AJF19166.1|  endoplasmic reticulum chaperone binding protein         362   1e-117   Lycium chinense [Chinese boxthorn]
ref|XP_009358650.1|  PREDICTED: luminal-binding protein 5-like          362   1e-117   Pyrus x bretschneideri [bai li]
gb|AAA81953.1|  BiP isoform C                                           355   2e-117   Glycine max [soybeans]
gb|KHG09348.1|  Luminal-binding 5                                       361   2e-117   Gossypium arboreum [tree cotton]
gb|EYU19660.1|  hypothetical protein MIMGU_mgv1a002500mg                361   2e-117   Erythranthe guttata [common monkey flower]
ref|XP_007040596.1|  Heat shock protein 70 (Hsp 70) family protein      361   2e-117   
gb|KJB18915.1|  hypothetical protein B456_003G074600                    355   2e-117   Gossypium raimondii
gb|KJB18910.1|  hypothetical protein B456_003G074600                    355   2e-117   Gossypium raimondii
gb|KJB24175.1|  hypothetical protein B456_004G131400                    356   3e-117   Gossypium raimondii
ref|XP_009396163.1|  PREDICTED: luminal-binding protein 2-like          360   3e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010671405.1|  PREDICTED: luminal-binding protein                 360   4e-117   Beta vulgaris subsp. vulgaris [field beet]
sp|Q42434.1|BIP_SPIOL  RecName: Full=Luminal-binding protein; Sho...    360   4e-117   Spinacia oleracea
gb|KJB18911.1|  hypothetical protein B456_003G074600                    356   6e-117   Gossypium raimondii
ref|XP_002518865.1|  heat shock protein, putative                       359   9e-117   Ricinus communis
emb|CBI34546.3|  unnamed protein product                                358   9e-117   Vitis vinifera
ref|XP_006286332.1|  hypothetical protein CARUB_v100044651mg            351   1e-116   
gb|KJB18913.1|  hypothetical protein B456_003G074600                    354   2e-116   Gossypium raimondii
ref|XP_007160200.1|  hypothetical protein PHAVU_002G301400g             358   3e-116   Phaseolus vulgaris [French bean]
emb|CBI23034.3|  unnamed protein product                                358   3e-116   Vitis vinifera
ref|XP_002263323.1|  PREDICTED: luminal-binding protein 5               358   4e-116   Vitis vinifera
ref|XP_002276268.2|  PREDICTED: luminal-binding protein 5-like is...    358   4e-116   Vitis vinifera
gb|KHG07305.1|  Luminal-binding 5                                       357   5e-116   Gossypium arboreum [tree cotton]
gb|KJB24174.1|  hypothetical protein B456_004G131400                    357   6e-116   Gossypium raimondii
ref|XP_004503582.1|  PREDICTED: luminal-binding protein-like            357   7e-116   Cicer arietinum [garbanzo]
ref|XP_006286341.1|  hypothetical protein CARUB_v100065121mg            351   9e-116   
ref|XP_011026831.1|  PREDICTED: luminal-binding protein 5               356   2e-115   Populus euphratica
ref|XP_010055986.1|  PREDICTED: luminal-binding protein                 356   2e-115   Eucalyptus grandis [rose gum]
gb|EYU25251.1|  hypothetical protein MIMGU_mgv1a002497mg                356   2e-115   Erythranthe guttata [common monkey flower]
ref|XP_002299448.1|  BiP isoform A family protein                       356   3e-115   Populus trichocarpa [western balsam poplar]
gb|KCW72555.1|  hypothetical protein EUGRSUZ_E01024                     357   4e-115   Eucalyptus grandis [rose gum]
emb|CDP12195.1|  unnamed protein product                                355   4e-115   Coffea canephora [robusta coffee]
gb|KJB18907.1|  hypothetical protein B456_003G074600                    355   6e-115   Gossypium raimondii
ref|XP_006343810.1|  PREDICTED: luminal-binding protein-like            355   7e-115   Solanum tuberosum [potatoes]
gb|ACJ11746.1|  luminal binding protein                                 355   7e-115   Gossypium hirsutum [American cotton]
ref|XP_002303672.1|  BiP isoform A family protein                       355   7e-115   Populus trichocarpa [western balsam poplar]
ref|XP_011022455.1|  PREDICTED: luminal-binding protein 5-like          354   1e-114   Populus euphratica
ref|NP_001234636.1|  luminal-binding protein precursor                  354   1e-114   
ref|XP_006405286.1|  hypothetical protein EUTSA_v10027674mg             354   2e-114   Eutrema salsugineum [saltwater cress]
ref|NP_199017.2|  Luminal-binding protein 2                             352   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300491.1|  PREDICTED: luminal-binding protein                 353   2e-114   Fragaria vesca subsp. vesca
dbj|BAA12348.1|  luminal binding protein (BiP)                          353   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851119.1|  Luminal-binding protein 2                             353   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918502.1|  PREDICTED: luminal-binding protein 4-like          352   5e-114   Elaeis guineensis
ref|XP_006401475.1|  hypothetical protein EUTSA_v10012896mg             352   7e-114   Eutrema salsugineum [saltwater cress]
gb|KEH21274.1|  heat shock 70 kDa protein                               352   8e-114   Medicago truncatula
emb|CDX79726.1|  BnaC03g20620D                                          351   9e-114   
gb|KFK32162.1|  hypothetical protein AALP_AA6G205800                    351   1e-113   Arabis alpina [alpine rockcress]
dbj|BAA13948.1|  luminal binding protein                                351   1e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23972.1|  BnaC03g17190D                                          350   1e-113   Brassica napus [oilseed rape]
ref|XP_009132761.1|  PREDICTED: mediator of RNA polymerase II tra...    351   2e-113   Brassica rapa
ref|XP_002887878.1|  hypothetical protein ARALYDRAFT_892955             350   2e-113   Arabidopsis lyrata subsp. lyrata
ref|XP_008796727.1|  PREDICTED: luminal-binding protein 5               350   3e-113   Phoenix dactylifera
ref|XP_002868566.1|  hypothetical protein ARALYDRAFT_493781             350   3e-113   
emb|CDY63497.1|  BnaC07g48050D                                          350   3e-113   Brassica napus [oilseed rape]
ref|XP_010473721.1|  PREDICTED: mediator of RNA polymerase II tra...    350   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010436161.1|  PREDICTED: mediator of RNA polymerase II tra...    350   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_004503579.1|  PREDICTED: luminal-binding protein-like            350   4e-113   Cicer arietinum [garbanzo]
ref|XP_010430591.1|  PREDICTED: mediator of RNA polymerase II tra...    350   5e-113   Camelina sativa [gold-of-pleasure]
gb|AAZ95244.1|  putative luminal-binding protein                        349   7e-113   Isatis tinctoria [woad]
gb|KDO76632.1|  hypothetical protein CISIN_1g0059551mg                  341   1e-112   Citrus sinensis [apfelsine]
ref|XP_010446984.1|  PREDICTED: mediator of RNA polymerase II tra...    348   1e-112   Camelina sativa [gold-of-pleasure]
dbj|BAD95470.1|  BiP                                                    348   2e-112   Glycine max [soybeans]
gb|KHN16714.1|  Luminal-binding protein 5                               348   2e-112   Glycine soja [wild soybean]
emb|CDY46766.1|  BnaA03g17100D                                          347   3e-112   Brassica napus [oilseed rape]
ref|NP_001045675.1|  Os02g0115900                                       348   3e-112   
gb|KHM99871.1|  Luminal-binding protein 4                               348   3e-112   Glycine soja [wild soybean]
gb|AGT16206.1|  luminal-binding protein                                 347   4e-112   Saccharum hybrid cultivar R570
gb|AGT15890.1|  luminal-binding protein                                 347   4e-112   Saccharum hybrid cultivar R570
gb|AGT16055.1|  luminal-binding protein 2 precursor                     347   4e-112   Saccharum hybrid cultivar R570
gb|ACF86491.1|  unknown                                                 347   5e-112   Zea mays [maize]
ref|NP_001105894.1|  luminal-binding protein 3 precursor                347   5e-112   Zea mays [maize]
dbj|BAA13947.1|  luminal binding protein                                347   6e-112   Arabidopsis thaliana [mouse-ear cress]
gb|KDO76630.1|  hypothetical protein CISIN_1g0059551mg                  342   6e-112   Citrus sinensis [apfelsine]
ref|NP_001105893.1|  luminal-binding protein 2 precursor                347   7e-112   
ref|NP_198206.1|  Luminal-binding protein 1                             347   7e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525327.2|  PREDICTED: luminal-binding protein                 348   8e-112   
gb|EPS69483.1|  luminal-binding protein 5                               347   9e-112   Genlisea aurea
emb|CDX77423.1|  BnaA07g05610D                                          345   1e-111   
gb|KDO76631.1|  hypothetical protein CISIN_1g0059551mg                  340   1e-111   Citrus sinensis [apfelsine]
ref|XP_006827760.1|  hypothetical protein AMTR_s00009p00264000          346   1e-111   Amborella trichopoda
ref|XP_009102505.1|  PREDICTED: mediator of RNA polymerase II tra...    345   3e-111   
ref|XP_004952156.1|  PREDICTED: luminal-binding protein 3-like          344   8e-111   Setaria italica
ref|XP_006648229.1|  PREDICTED: luminal-binding protein 2-like          343   2e-110   Oryza brachyantha
gb|KDO76629.1|  hypothetical protein CISIN_1g0059551mg                  341   7e-110   Citrus sinensis [apfelsine]
ref|XP_010662895.1|  PREDICTED: luminal-binding protein 5-like is...    342   8e-110   Vitis vinifera
ref|XP_010545034.1|  PREDICTED: luminal-binding protein 4               341   9e-110   Tarenaya hassleriana [spider flower]
gb|AAB63469.1|  endosperm lumenal binding protein                       341   1e-109   Oryza sativa [red rice]
ref|XP_009418642.1|  PREDICTED: luminal-binding protein 2-like          341   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392825.1|  PREDICTED: luminal-binding protein 2               341   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573226.1|  PREDICTED: luminal-binding protein 3               339   9e-109   Brachypodium distachyon [annual false brome]
ref|XP_002317789.2|  BiP isoform A family protein                       339   1e-108   Populus trichocarpa [western balsam poplar]
ref|NP_001238736.1|  BiP isoform B precursor                            338   1e-108   
gb|KFK32977.1|  hypothetical protein AALP_AA6G313600                    338   2e-108   Arabis alpina [alpine rockcress]
emb|CDX67525.1|  BnaA07g15650D                                          335   3e-108   
gb|KEH21282.1|  heat shock cognate 70 kDa-like protein                  337   5e-108   Medicago truncatula
ref|XP_010934830.1|  PREDICTED: luminal-binding protein 4               337   5e-108   Elaeis guineensis
gb|AAA62325.1|  HSP70                                                   333   3e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT16454.1|  Luminal-binding protein 4                               335   3e-107   
dbj|BAJ85675.1|  predicted protein                                      334   6e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG03675.1|  Luminal-binding 5                                       334   8e-107   Gossypium arboreum [tree cotton]
gb|EMS58484.1|  Luminal-binding protein 3                               334   1e-106   Triticum urartu
gb|AGN94841.1|  ER molecular chaperone                                  333   2e-106   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009125214.1|  PREDICTED: mediator of RNA polymerase II tra...    333   2e-106   Brassica rapa
ref|XP_001774724.1|  predicted protein                                  329   6e-105   
ref|XP_010259649.1|  PREDICTED: luminal-binding protein 4-like          328   8e-105   Nelumbo nucifera [Indian lotus]
emb|CAA89834.2|  luminal binding protein                                327   4e-104   Pseudotsuga menziesii
gb|ABR18447.1|  unknown                                                 324   6e-103   Picea sitchensis
ref|NP_001290009.1|  mediator of RNA polymerase II transcription ...    322   2e-102   Vitis vinifera
ref|XP_006838409.1|  hypothetical protein AMTR_s00002p00096860          322   3e-102   Amborella trichopoda
ref|NP_001234941.1|  BiP isoform A                                      322   4e-102   
emb|CBI39503.3|  unnamed protein product                                318   6e-102   Vitis vinifera
emb|CDY13371.1|  BnaC06g13860D                                          321   6e-102   Brassica napus [oilseed rape]
ref|XP_010659633.1|  PREDICTED: mediator of RNA polymerase II tra...    319   3e-101   
ref|XP_002969949.1|  hypothetical protein SELMODRAFT_440900             317   3e-100   Selaginella moellendorffii
ref|XP_006405378.1|  hypothetical protein EUTSA_v10028192mg             309   4e-100   
emb|CDP15491.1|  unnamed protein product                                316   5e-100   Coffea canephora [robusta coffee]
ref|XP_002981419.1|  hypothetical protein SELMODRAFT_444846             315   1e-99    Selaginella moellendorffii
ref|XP_001780840.1|  predicted protein                                  315   1e-99    
ref|XP_006433401.1|  hypothetical protein CICLE_v10000531mg             315   1e-99    Citrus clementina [clementine]
ref|XP_006479343.1|  PREDICTED: luminal-binding protein 5-like          314   3e-99    Citrus sinensis [apfelsine]
ref|XP_010458176.1|  PREDICTED: probable mediator of RNA polymera...    313   7e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010458175.1|  PREDICTED: probable mediator of RNA polymera...    313   1e-98    
ref|XP_006423179.1|  hypothetical protein CICLE_v10030400mg             312   2e-98    
gb|AFC88846.1|  putative luminal binding protein 7B4                    313   2e-98    Tetragonia tetragonioides
ref|XP_006423175.1|  hypothetical protein CICLE_v10027975mg             311   2e-98    
ref|XP_006306953.1|  hypothetical protein CARUB_v10008520mg             312   2e-98    Capsella rubella
emb|CDP21572.1|  unnamed protein product                                298   8e-98    Coffea canephora [robusta coffee]
ref|NP_001184944.1|  protein BIP3                                       310   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475731.1|  PREDICTED: probable mediator of RNA polymera...    310   8e-98    Camelina sativa [gold-of-pleasure]
ref|XP_011092383.1|  PREDICTED: luminal-binding protein 5-like          310   1e-97    Sesamum indicum [beniseed]
ref|XP_010475732.1|  PREDICTED: probable mediator of RNA polymera...    310   1e-97    Camelina sativa [gold-of-pleasure]
ref|NP_172382.4|  protein BIP3                                          309   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388543.1|  PREDICTED: luminal-binding protein 5-like          309   3e-97    
gb|AAB70400.1|  Similar to Arabidopsis luminal binding protein (g...    308   5e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KDO56235.1|  hypothetical protein CISIN_1g006194mg                   308   5e-97    Citrus sinensis [apfelsine]
ref|XP_010674036.1|  PREDICTED: luminal-binding protein 5               308   7e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007030985.1|  Heat shock protein 70 (Hsp 70) family protein      308   8e-97    
ref|XP_011088129.1|  PREDICTED: luminal-binding protein 5-like          306   2e-96    Sesamum indicum [beniseed]
ref|XP_006423186.1|  hypothetical protein CICLE_v10030032mg             306   2e-96    
ref|XP_010041040.1|  PREDICTED: luminal-binding protein 5-like          307   2e-96    Eucalyptus grandis [rose gum]
ref|XP_006417615.1|  hypothetical protein EUTSA_v10009566mg             306   3e-96    Eutrema salsugineum [saltwater cress]
ref|XP_006480058.1|  PREDICTED: luminal-binding protein 5-like          306   3e-96    
ref|XP_009118328.1|  PREDICTED: probable mediator of RNA polymera...    306   3e-96    Brassica rapa
emb|CDY22648.1|  BnaC08g42820D                                          305   4e-96    Brassica napus [oilseed rape]
emb|CDY06347.1|  BnaA09g48560D                                          305   5e-96    
ref|XP_007206318.1|  hypothetical protein PRUPE_ppa002572mg             305   8e-96    
ref|XP_008246412.1|  PREDICTED: luminal-binding protein 5               305   1e-95    Prunus mume [ume]
ref|XP_011092073.1|  PREDICTED: luminal-binding protein 5-like          303   3e-95    Sesamum indicum [beniseed]
gb|KFK43208.1|  hypothetical protein AALP_AA1G094300                    303   4e-95    Arabis alpina [alpine rockcress]
gb|KDP23486.1|  hypothetical protein JCGZ_23319                         303   4e-95    Jatropha curcas
gb|KFK43207.1|  hypothetical protein AALP_AA1G094300                    303   7e-95    Arabis alpina [alpine rockcress]
gb|KJB81015.1|  hypothetical protein B456_013G125300                    302   1e-94    Gossypium raimondii
emb|CAC37635.1|  luminal binding protein, BiP                           301   3e-94    Scherffelia dubia
ref|XP_004302398.1|  PREDICTED: luminal-binding protein 4               301   3e-94    Fragaria vesca subsp. vesca
ref|XP_009766974.1|  PREDICTED: luminal-binding protein 5-like          300   8e-94    Nicotiana sylvestris
ref|XP_009622355.1|  PREDICTED: mediator of RNA polymerase II tra...    300   1e-93    Nicotiana tomentosiformis
emb|CDP15493.1|  unnamed protein product                                296   2e-93    Coffea canephora [robusta coffee]
ref|XP_005842772.1|  hypothetical protein CHLNCDRAFT_144025             288   2e-93    Chlorella variabilis
ref|XP_002318993.2|  heat shock protein 70 cognate                      298   4e-93    
ref|XP_011023674.1|  PREDICTED: luminal-binding protein 4-like          296   2e-92    Populus euphratica
ref|XP_006344666.1|  PREDICTED: mediator of RNA polymerase II tra...    296   2e-92    Solanum tuberosum [potatoes]
emb|CDP16233.1|  unnamed protein product                                291   3e-91    Coffea canephora [robusta coffee]
gb|KIY96078.1|  heat shock 70kDa protein 5                              286   5e-91    Monoraphidium neglectum
ref|XP_010553728.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    292   7e-91    
ref|XP_004230233.1|  PREDICTED: mediator of RNA polymerase II tra...    290   4e-90    Solanum lycopersicum
ref|NP_001051048.1|  Os03g0710500                                       290   4e-90    
ref|XP_006650483.1|  PREDICTED: luminal-binding protein 4-like          290   5e-90    Oryza brachyantha
ref|XP_010027237.1|  PREDICTED: luminal-binding protein 5-like          290   6e-90    
ref|XP_006472125.1|  PREDICTED: probable mediator of RNA polymera...    281   3e-89    
emb|CDP16834.1|  unnamed protein product                                285   6e-89    Coffea canephora [robusta coffee]
ref|XP_006472126.1|  PREDICTED: probable mediator of RNA polymera...    283   7e-89    Citrus sinensis [apfelsine]
ref|XP_005651681.1|  binding protein 1                                  286   1e-88    Coccomyxa subellipsoidea C-169
gb|EEC79268.1|  hypothetical protein OsI_20053                          280   1e-88    Oryza sativa Indica Group [Indian rice]
gb|EEE59790.1|  hypothetical protein OsJ_12307                          288   1e-88    Oryza sativa Japonica Group [Japonica rice]
gb|EYU18532.1|  hypothetical protein MIMGU_mgv1a022234mg                285   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_002949576.1|  luminal binding protein Bip1                       285   3e-88    Volvox carteri f. nagariensis
ref|XP_001701685.1|  binding protein 1                                  284   7e-88    Chlamydomonas reinhardtii
dbj|BAJ89190.1|  predicted protein                                      284   1e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002466589.1|  hypothetical protein SORBIDRAFT_01g010460          283   3e-87    Sorghum bicolor [broomcorn]
gb|EEC83049.1|  hypothetical protein OsI_28153                          278   1e-86    Oryza sativa Indica Group [Indian rice]
ref|NP_001055613.1|  Os05g0428600                                       281   3e-86    
ref|XP_001701884.1|  binding protein 2                                  280   4e-86    Chlamydomonas reinhardtii
ref|XP_004964075.1|  PREDICTED: luminal-binding protein 3-like          280   4e-86    Setaria italica
ref|XP_007509232.1|  heat shock protein 70                              268   6e-86    Bathycoccus prasinos
ref|XP_005829514.1|  heat shock protein 70, ER luminal                  280   6e-86    Guillardia theta CCMP2712
ref|XP_004971898.1|  PREDICTED: luminal-binding protein 3-like          280   6e-86    
ref|XP_002507118.1|  heat shock binding protein 70, ER luminal          279   6e-86    Micromonas commoda
ref|XP_003074861.1|  Bip Luminal binding protein precursor, proba...    278   1e-85    
ref|XP_004986284.1|  PREDICTED: luminal-binding protein 4-like          279   1e-85    Setaria italica
emb|CEG00952.1|  Heat shock protein 70 family                           278   2e-85    Ostreococcus tauri
ref|NP_001061194.1|  Os08g0197700                                       278   2e-85    
ref|XP_006433439.1|  hypothetical protein CICLE_v10003341mg             274   2e-85    
ref|XP_004971892.1|  PREDICTED: luminal-binding protein 3-like          278   2e-85    
ref|XP_006433443.1|  hypothetical protein CICLE_v10003511mg             274   2e-85    
ref|XP_002977324.1|  hypothetical protein SELMODRAFT_417280             277   3e-85    
ref|XP_002971962.1|  hypothetical protein SELMODRAFT_412732             277   3e-85    
ref|XP_003055985.1|  luminal binding heat shock protein 70              278   3e-85    Micromonas pusilla CCMP1545
gb|EIE87053.1|  heat shock 70 kDa protein                               266   3e-85    Rhizopus delemar RA 99-880
ref|XP_006644572.1|  PREDICTED: luminal-binding protein 5-like          278   4e-85    Oryza brachyantha
ref|XP_005539525.1|  luminal binding protein BiP                        278   5e-85    Cyanidioschyzon merolae strain 10D
dbj|BAK06498.1|  predicted protein                                      276   8e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDD73887.1|  heat shock protein 70 Hsp70                             276   9e-85    Helicosporidium sp. ATCC 50920
ref|XP_003565461.1|  PREDICTED: luminal-binding protein 2-like          276   9e-85    Brachypodium distachyon [annual false brome]
dbj|BAC67670.1|  Heat shock 70 kDa protein                              278   1e-84    Cyanidioschyzon merolae strain 10D
ref|XP_002456746.1|  hypothetical protein SORBIDRAFT_03g041830          275   3e-84    Sorghum bicolor [broomcorn]
ref|XP_003867956.1|  Ssa2 HSP70 chaperone                               261   3e-84    
ref|XP_001416181.1|  Luminal binding protein precursor, probable        275   3e-84    Ostreococcus lucimarinus CCE9901
gb|EPB86036.1|  glucose-regulated protein                               274   7e-84    Mucor circinelloides f. circinelloides 1006PhL
emb|CEI96781.1|  Putative Hsp70-like protein                            274   8e-84    Rhizopus microsporus
ref|XP_006655245.1|  PREDICTED: luminal-binding protein 4-like          274   1e-83    Oryza brachyantha
dbj|GAN05474.1|  78 kDa glucose-regulated protein precursor             273   1e-83    Mucor ambiguus
ref|XP_008644508.1|  PREDICTED: luminal-binding protein 5-like is...    271   2e-83    Zea mays [maize]
gb|AER57864.1|  heat shock 70 family protein                            273   2e-83    Acytostelium subglobosum
ref|XP_006694812.1|  hypothetical protein CTHT_0044200                  273   2e-83    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_008644507.1|  PREDICTED: luminal-binding protein 5-like is...    271   3e-83    Zea mays [maize]
emb|CEG66501.1|  Putative 70 kDa heat shock protein 3                   272   3e-83    Rhizopus microsporus
ref|XP_009854462.1|  hypothetical protein NEUTE1DRAFT_69229             272   4e-83    Neurospora tetrasperma FGSC 2508
dbj|BAG57068.1|  unnamed protein product                                261   4e-83    Homo sapiens [man]
ref|XP_956567.1|  glucose-regulated protein                             271   5e-83    Neurospora crassa OR74A
ref|XP_002892480.1|  hypothetical protein ARALYDRAFT_311954             271   6e-83    
gb|ELT89714.1|  hypothetical protein CAPTEDRAFT_18512                   271   7e-83    Capitella teleta
ref|XP_003870868.1|  Hsp70 hsp70 chaperone                              257   1e-82    
pdb|3LDL|A  Chain A, Crystal Structure Of Human Grp78 (70kda Heat...    263   1e-82    Homo sapiens [man]
ref|XP_003283993.1|  hypothetical protein DICPUDRAFT_52641              270   2e-82    Dictyostelium purpureum
ref|XP_002977325.1|  hypothetical protein SELMODRAFT_12397              262   2e-82    
gb|KGB79179.1|  glucose-regulated protein                               258   3e-82    Cryptococcus gattii VGII R265
ref|XP_007865808.1|  heat shock protein 70                              270   3e-82    Gloeophyllum trabeum ATCC 11539
gb|ABS87375.1|  Hsp70                                                   269   3e-82    Magnaporthe oryzae [rice blast fungus]
ref|XP_004934153.1|  PREDICTED: major heat shock 70 kDa protein Ba      256   4e-82    
ref|XP_003709308.1|  glucose-regulated protein                          269   5e-82    Magnaporthe oryzae 70-15
gb|ERS99131.1|  chaperone DnaK                                          269   6e-82    Sporothrix schenckii ATCC 58251
pdb|3IUC|A  Chain A, Crystal Structure Of The Human 70kda Heat Sh...    262   6e-82    Homo sapiens [man]
gb|KIH94177.1|  heat shock 70kDa protein 5                              269   6e-82    Sporothrix brasiliensis 5110
emb|CEI88073.1|  Putative Hsp71-like protein                            258   6e-82    Rhizopus microsporus
ref|XP_004934068.1|  PREDICTED: heat shock protein 70 A2-like           254   7e-82    Bombyx mori [silk moth]
ref|XP_006220075.1|  PREDICTED: heat shock 70 kDa protein A-like        254   7e-82    
emb|CAA70214.1|  grp78 homologue                                        268   1e-81    
ref|XP_005838018.1|  heat shock protein 70                              267   2e-81    
gb|AAZ05449.1|  Hsp70                                                   253   2e-81    
ref|XP_002615993.1|  heat shock protein SSA1                            267   2e-81    
ref|XP_008885842.1|  chaperonin protein BiP                             268   2e-81    
gb|EIE83965.1|  heat shock 70 kDa protein                               267   3e-81    
gb|ESA23479.1|  hypothetical protein GLOINDRAFT_342147                  267   3e-81    
ref|XP_004351156.1|  heat shock protein Hsp70 family protein            274   3e-81    
gb|EPS34018.1|  putative Hsp70 molecular chaperone                      267   3e-81    
ref|XP_628228.1|  heat shock protein, Hsp70                             267   3e-81    
ref|XP_005833236.1|  heat shock protein 70                              266   3e-81    
ref|XP_002971966.1|  hypothetical protein SELMODRAFT_96333              259   4e-81    
ref|XP_005833237.1|  heat shock protein 70                              266   4e-81    
ref|XP_002949720.1|  luminal binding protein Bip2                       271   4e-81    
dbj|BAH97106.1|  luminal binding protein BiP                            259   4e-81    
ref|XP_002364404.1|  heat shock protein 70, putative                    267   4e-81    
ref|XP_002787362.1|  heat shock protein,, putative                      256   4e-81    
gb|ESX02879.1|  Heat shock protein 70 2                                 266   4e-81    
ref|XP_001215218.1|  78 kDa glucose-regulated protein precursor         267   4e-81    
ref|XP_643155.1|  heat shock protein Hsp70 family protein               266   5e-81    
gb|AAZ05448.1|  Hsp70                                                   252   5e-81    
dbj|BAE28883.1|  unnamed protein product                                263   5e-81    
dbj|BAH97105.1|  luminal binding protein BiP                            259   5e-81    
dbj|BAE48210.1|  hypothetical protein                                   254   6e-81    
ref|XP_005718499.1|  unnamed protein product                            266   7e-81    
gb|AAC15519.1|  heat shock protein 70                                   266   7e-81    
ref|XP_003664039.1|  glucose-regulated protein                          266   8e-81    
gb|AAH63946.1|  Heat shock protein 5                                    266   8e-81    
ref|XP_010876087.1|  PREDICTED: 78 kDa glucose-regulated protein        266   8e-81    
ref|NP_998223.1|  78 kDa glucose-regulated protein precursor            266   8e-81    
ref|XP_749594.1|  Hsp70 chaperone BiP/Kar2                              266   1e-80    
ref|XP_008931816.1|  PREDICTED: heat shock cognate 71 kDa protein...    251   1e-80    
gb|AAB34280.1|  70 kda heat shock protein                               253   1e-80    
gb|AAM02971.2|AF421538_1  BiP                                           266   1e-80    
gb|EPZ32455.1|  putative heat shock protein ssa1                        265   1e-80    
ref|XP_003919076.1|  PREDICTED: heat shock cognate 71 kDa protein...    250   2e-80    
gb|ABE28012.1|  heat shock protein Hsp70-7                              262   2e-80    
gb|EWC46399.1|  glucose-regulated-like protein                          265   2e-80    
ref|XP_001227133.1|  hypothetical protein CHGG_09206                    265   2e-80    
gb|EDZ71254.1|  YJL034Wp-like protein                                   252   2e-80    
gb|KIL58290.1|  hypothetical protein M378DRAFT_170815                   265   2e-80    
ref|XP_007367087.1|  heat shock protein 70                              265   2e-80    
gb|KGK39738.1|  hypothetical protein JL09_g1001                         264   2e-80    
dbj|BAO42678.1|  heat shock protein SSA3                                264   3e-80    
gb|ETE59912.1|  78 kDa glucose-regulated protein                        263   3e-80    
gb|EKC33663.1|  78 kDa glucose-regulated protein                        265   3e-80    
ref|XP_002743358.1|  PREDICTED: 78 kDa glucose-regulated protein        264   3e-80    
ref|XP_003885152.1|  Heat shock protein 70 (Precursor), related         265   3e-80    
emb|CDH60531.1|  glucose-regulated protein                              265   3e-80    
gb|AER35070.1|  heat shock protein 70 family protein                    264   3e-80    
ref|XP_003667561.1|  hypothetical protein NDAI_0A01600                  264   3e-80    
ref|XP_005998228.1|  PREDICTED: heat shock 70 kDa protein 1-like        252   3e-80    
tpg|DAA24281.1|  TPA: 78 kDa glucose-regulated protein precursor        262   3e-80    
ref|XP_003940675.1|  PREDICTED: 78 kDa glucose-regulated protein        264   3e-80    
ref|XP_008040622.1|  heat shock protein 70                              265   3e-80    
ref|XP_004613383.1|  PREDICTED: 78 kDa glucose-regulated protein        264   4e-80    
gb|AFM73649.1|  heat shock protein 70                                   253   4e-80    
ref|XP_011201513.1|  PREDICTED: heat shock 70 kDa protein cognate 3     264   4e-80    
gb|KFH42267.1|  78 kDa glucose-regulated protein-like protein           264   4e-80    
gb|AAM94003.1|  heat shock protein 70                                   251   4e-80    
ref|XP_011181705.1|  PREDICTED: heat shock 70 kDa protein cognate 3     264   4e-80    
dbj|BAE31281.1|  unnamed protein product                                263   5e-80    
emb|CDO70407.1|  hypothetical protein BN946_scf184999.g48               270   5e-80    
emb|CDO95025.1|  unnamed protein product                                263   5e-80    
ref|XP_006744266.1|  PREDICTED: 78 kDa glucose-regulated protein ...    261   5e-80    
emb|CDS07402.1|  Putative Glucose-regulated protein                     264   5e-80    
ref|XP_007395697.1|  hypothetical protein PHACADRAFT_255953             263   6e-80    
ref|XP_011127440.1|  hypothetical protein AOL_s00210g337                264   6e-80    
ref|XP_008731153.1|  chaperone DnaK                                     264   6e-80    
ref|NP_001292291.1|  78 kDa glucose-regulated protein precursor         263   6e-80    
dbj|BAK63666.1|  78 kDa glucose-regulated protein precursor             259   7e-80    
ref|XP_007761842.1|  glucose-regulated protein                          264   8e-80    
ref|XP_006686275.1|  hypothetical protein CANTEDRAFT_104659             263   8e-80    
ref|XP_004535076.1|  PREDICTED: heat shock 70 kDa protein cognate...    263   8e-80    
ref|XP_009216086.1|  glucose-regulated protein                          263   8e-80    
emb|CCX06963.1|  Similar to Heat shock 70 kDa protein 2; acc. no....    263   8e-80    
gb|ESA16542.1|  hypothetical protein GLOINDRAFT_345509                  263   8e-80    
emb|CCG83891.1|  protein of unknown function                            263   9e-80    
ref|XP_001260092.1|  ER Hsp70 chaperone BiP, putative                   263   9e-80    
dbj|BAG62134.1|  unnamed protein product                                249   9e-80    
ref|XP_001272734.1|  ER Hsp70 chaperone BiP, putative                   263   1e-79    
pir||T43716  dnaK-type molecular chaperone BiP [imported] - Asper...    263   1e-79 
ref|XP_001802699.1|  hypothetical protein SNOG_20135                    250   1e-79    
gb|ERE71182.1|  glucose-regulated protein precursor                     263   1e-79    
ref|XP_001394413.1|  glucose-regulated protein                          263   1e-79    
gb|EFA80174.1|  heat shock protein Hsp70 family protein                 263   1e-79    
ref|XP_005346064.1|  PREDICTED: 78 kDa glucose-regulated protein        263   1e-79    
ref|XP_863385.2|  PREDICTED: 78 kDa glucose-regulated protein iso...    263   1e-79    
ref|XP_008823042.1|  PREDICTED: 78 kDa glucose-regulated protein        263   1e-79    
dbj|BAE39187.1|  unnamed protein product                                263   1e-79    
ref|NP_001233668.1|  78 kDa glucose-regulated protein precursor         263   1e-79    
ref|XP_003848822.1|  Hsp70 family protein                               262   1e-79    
dbj|BAE39999.1|  unnamed protein product                                263   1e-79    
gb|KFH67887.1|  glucose-regulated protein                               263   1e-79    
dbj|BAB23387.1|  unnamed protein product                                263   1e-79    
dbj|BAE35314.1|  unnamed protein product                                263   1e-79    
ref|XP_004641630.1|  PREDICTED: 78 kDa glucose-regulated protein        263   1e-79    
ref|NP_037215.1|  78 kDa glucose-regulated protein precursor            262   1e-79    
ref|NP_071705.3|  78 kDa glucose-regulated protein precursor            263   1e-79    
ref|XP_004662863.1|  PREDICTED: 78 kDa glucose-regulated protein        262   1e-79    
dbj|BAE30705.1|  unnamed protein product                                262   1e-79    
emb|CAA05361.1|  BiP                                                    262   2e-79    
ref|XP_004485131.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    261   2e-79    
ref|XP_010108159.1|  Luminal-binding protein 5                          262   2e-79    
gb|KIW59179.1|  chaperone DnaK                                          263   2e-79    
gb|ESA04718.1|  hypothetical protein GLOINDRAFT_336076                  262   2e-79    
ref|XP_007420669.1|  PREDICTED: 78 kDa glucose-regulated protein ...    262   2e-79    
emb|CCX16990.1|  Similar to 78 kDa glucose-regulated protein homo...    262   2e-79    
gb|EMD35028.1|  hypothetical protein CERSUDRAFT_116540                  263   2e-79    
ref|NP_001068616.1|  78 kDa glucose-regulated protein precursor         262   2e-79    
ref|XP_004005686.1|  PREDICTED: 78 kDa glucose-regulated protein        262   2e-79    
ref|XP_005953889.1|  PREDICTED: 78 kDa glucose-regulated protein        262   2e-79    
gb|KEQ98464.1|  hypothetical protein AUEXF2481DRAFT_46103               262   2e-79    
ref|XP_003046172.1|  predicted protein                                  262   2e-79    
gb|AAF13605.1|AF188611_1  BiP protein                                   261   2e-79    
emb|CDQ63065.1|  unnamed protein product                                262   2e-79    
gb|KFX53237.1|  78 kDa glucose-regulated protein like                   262   3e-79    
ref|XP_008520162.1|  PREDICTED: 78 kDa glucose-regulated protein        261   3e-79    
gb|KID92978.1|  78 Kda glucose-regulated protein                        262   3e-79    
ref|XP_005707456.1|  molecular chaperone DnaK                           262   3e-79    
ref|XP_445544.1|  hypothetical protein                                  262   3e-79    
gb|EPY34179.1|  heat shock 70 kDa protein                               248   3e-79    
ref|XP_008640357.1|  PREDICTED: 78 kDa glucose-regulated protein ...    260   3e-79    
ref|XP_002622883.1|  heat shock protein cognate 4                       261   3e-79    
ref|XP_002492443.1|  ATPase involved in protein folding and the r...    262   3e-79    
ref|XP_002144745.1|  Hsp70 chaperone BiP/Kar2, putative                 262   3e-79    
gb|KIW62812.1|  chaperone DnaK                                          262   3e-79    
gb|EHH24251.1|  hypothetical protein EGK_07878                          261   3e-79    
ref|XP_004716507.1|  PREDICTED: 78 kDa glucose-regulated protein        261   3e-79    
gb|AAA52614.1|  GRP78 precursor                                         261   3e-79    
ref|XP_002541644.1|  heat shock protein 70                              262   3e-79    
emb|CDJ57867.1|  heat shock protein 70, putative                        262   3e-79    
dbj|GAD97314.1|  molecular chaperone Hsp70                              261   3e-79    
ref|XP_002778105.1|  heat shock protein 70 precursor, putative          261   3e-79    
emb|CCE40659.1|  hypothetical protein CPAR2_106940                      261   3e-79    
gb|ERG82498.1|  heat shock 70 kda protein c                             261   3e-79    
ref|XP_008153515.1|  PREDICTED: 78 kDa glucose-regulated protein        261   3e-79    
ref|NP_001269183.1|  78 kDa glucose-regulated protein precursor         261   3e-79    
ref|XP_005881560.1|  PREDICTED: 78 kDa glucose-regulated protein        261   3e-79    
ref|XP_001906199.1|  hypothetical protein                               261   3e-79    
gb|KIJ28212.1|  hypothetical protein M422DRAFT_270532                   262   4e-79    
ref|XP_005321021.1|  PREDICTED: 78 kDa glucose-regulated protein ...    261   4e-79    
ref|XP_005082124.1|  PREDICTED: 78 kDa glucose-regulated protein ...    261   4e-79    
dbj|BAE31621.1|  unnamed protein product                                261   4e-79    
gb|EHH61921.1|  78 kDa glucose-regulated protein                        261   4e-79    
gb|KEQ60096.1|  hsp70-like protein C                                    262   4e-79    
ref|XP_006988789.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_005755726.1|  PREDICTED: 78 kDa glucose-regulated protein-...    261   4e-79    
ref|XP_008271523.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_007006435.1|  hypothetical protein TREMEDRAFT_45220              262   4e-79    
ref|XP_003407784.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_008568189.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_004392650.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_002783461.1|  heat shock protein 70 precursor, putative          261   4e-79    
ref|XP_004677392.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_006918027.1|  PREDICTED: 78 kDa glucose-regulated protein ...    261   4e-79    
ref|XP_006892626.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_006187781.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_004593628.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
tpg|DAA34131.1|  TPA: heat shock protein                                248   4e-79    
ref|XP_006834828.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
gb|KIR24989.1|  hsp72-like protein                                      247   4e-79    
ref|NP_005338.1|  78 kDa glucose-regulated protein precursor            261   4e-79    
emb|CAA62478.1|  Heat shock 70 protein                                  261   4e-79    
ref|XP_008058392.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_003785350.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|NP_001135114.1|  78 kDa glucose-regulated protein precursor         261   4e-79    
ref|XP_006158307.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_003470822.1|  PREDICTED: 78 kDa glucose-regulated protein        261   4e-79    
ref|XP_001248723.1|  heat shock 70 kDa protein                          261   4e-79    
gb|EFQ29972.1|  hsp70-like protein                                      261   5e-79    
ref|XP_007863054.1|  heat shock protein HSS1                            261   5e-79    
emb|CDQ79052.1|  unnamed protein product                                261   5e-79    
gb|ENH61283.1|  Heat shock 70 kDa protein                               261   5e-79    
ref|XP_004888032.1|  PREDICTED: 78 kDa glucose-regulated protein        261   5e-79    
ref|XP_001927830.3|  PREDICTED: 78 kDa glucose-regulated protein        261   5e-79    
gb|KIO06458.1|  hypothetical protein M404DRAFT_483417                   261   5e-79    
emb|CEG73733.1|  Putative KLLA0E20527p                                  261   5e-79    
gb|KIJ60468.1|  hypothetical protein HYDPIDRAFT_160912                  261   5e-79    
gb|KIJ16846.1|  hypothetical protein PAXINDRAFT_162475                  261   5e-79    
ref|XP_001526841.1|  heat shock protein SSA2                            261   6e-79    
ref|XP_007809001.1|  glucose-regulated protein                          261   6e-79    
gb|EWG36868.1|  hsp70-like protein                                      261   6e-79    
gb|EGU81119.1|  hypothetical protein FOXB_08393                         261   6e-79    
ref|XP_002192655.1|  PREDICTED: 78 kDa glucose-regulated protein        261   6e-79    
ref|XP_004375722.1|  PREDICTED: 78 kDa glucose-regulated protein        261   6e-79    
dbj|BAF38391.1|  heat shock protein 70kDa                               261   6e-79    
ref|XP_011107506.1|  hypothetical protein H072_1514                     260   6e-79    
gb|EKG13266.1|  Heat shock protein Hsp70                                261   6e-79    
ref|NP_990822.1|  78 kDa glucose-regulated protein precursor            261   7e-79    
gb|EMT61617.1|  Heat shock 70 kDa protein                               261   7e-79    
ref|XP_004313501.1|  PREDICTED: 78 kDa glucose-regulated protein        261   7e-79    
ref|NP_001274500.1|  heat shock 70kDa protein 5 (glucose-regulate...    261   7e-79    
ref|XP_003230508.1|  PREDICTED: 78 kDa glucose-regulated protein        261   7e-79    
gb|KFG85074.1|  78 Kda glucose-regulated protein                        261   7e-79    
gb|EIE85693.1|  hsp71-like protein                                      260   7e-79    
gb|AAW63770.1|  PPAT5                                                   261   7e-79    
ref|XP_007194739.1|  PREDICTED: 78 kDa glucose-regulated protein ...    261   7e-79    
gb|AAW63769.1|  PPAT5                                                   261   7e-79    
ref|XP_011112275.1|  hypothetical protein H072_6484                     261   7e-79    
ref|XP_005146335.1|  PREDICTED: 78 kDa glucose-regulated protein        261   7e-79    
gb|AHA36969.1|  heat shock protein 70b                                  261   7e-79    
emb|CAA53039.1|  heat shock protein (hsc70)                             260   7e-79    
ref|NP_588421.1|  heat shock protein Ssa2 (predicted)                   260   7e-79    
ref|XP_002142079.1|  heat shock protein 70                              261   7e-79    
ref|XP_007884368.1|  PREDICTED: heat shock 70 kDa protein 1-like        248   7e-79    
ref|XP_008640356.1|  PREDICTED: 78 kDa glucose-regulated protein ...    260   8e-79    
ref|XP_004269273.1|  PREDICTED: 78 kDa glucose-regulated protein        261   8e-79    
ref|XP_007746179.1|  glucose-regulated protein                          261   8e-79    
ref|XP_005279468.1|  PREDICTED: 78 kDa glucose-regulated protein        260   8e-79    
ref|XP_646617.1|  heat shock protein                                    260   8e-79    
ref|XP_005828584.1|  heat shock protein 70, ER luminal                  261   8e-79    
gb|EPB88587.1|  heat shock protein HSS1                                 261   8e-79    
ref|XP_005055797.1|  PREDICTED: 78 kDa glucose-regulated protein ...    260   8e-79    
gb|KFA63583.1|  hypothetical protein S40285_04115                       261   8e-79    
dbj|BAA11462.1|  78 kDa glucose-regulated protein                       260   8e-79    
gb|KFO65501.1|  78 kDa glucose-regulated protein                        260   8e-79    
gb|AET97609.1|  heat shock protein 70b                                  261   9e-79    
gb|AAN52150.1|  70 kDa heat shock protein 1                             256   9e-79    
gb|KIV92759.1|  hsp72-like protein                                      261   9e-79    



>ref|XP_009788736.1| PREDICTED: luminal-binding protein 4 [Nicotiana sylvestris]
Length=667

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            MAGGAW RRTSLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRTSLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERTIFDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYIQVKIKDGETK+FSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKIFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNV  203



>sp|Q03684.1|BIP4_TOBAC RecName: Full=Luminal-binding protein 4; Short=BiP 4; AltName: 
Full=78 kDa glucose-regulated protein homolog 4; Short=GRP-78-4; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42659.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=667

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            MAGGAW RRTSLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRTSLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERT+FDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTVFDVKRLIGRKFDDKEVQRDM  120

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYIQVKIKDGETK+FSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKIFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNV  203



>ref|XP_009588550.1| PREDICTED: luminal-binding protein 4 [Nicotiana tomentosiformis]
Length=667

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            MAGGAW RR SLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRASLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERTIFDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNV  203



>gb|ACK55195.1| ER luminal-binding protein [Nicotiana benthamiana]
Length=667

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            MAGGAW RR SLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRASLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERTIFDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNV  203



>ref|XP_009773333.1| PREDICTED: luminal-binding protein 5 [Nicotiana sylvestris]
 sp|Q03685.1|BIP5_TOBAC RecName: Full=Luminal-binding protein 5; Short=BiP 5; AltName: 
Full=78 kDa glucose-regulated protein homolog 5; Short=GRP-78-5; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42660.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=668

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW RR SLIVF IV+FGSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKRRASLIVFAIVLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQRD KLV
Sbjct  63   NDQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQRDKKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PY+IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYEIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|AGS42239.1| ER luminal-binding protein [Capsicum annuum]
Length=668

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            AW  R SL VF IV+FGSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    AWKTRASLTVFAIVLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVK+KDGETKVFSPEEISAMILTKMKETAEA+LGKTIKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKVKDGETKVFSPEEISAMILTKMKETAEAYLGKTIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>emb|CDP05035.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   375 bits (963),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW RR SLIVFGI+ FGS FAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWARRASLIVFGILFFGSFFAFSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYI+VKIKDGE KVFSPEEISAM+LTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIEVKIKDGEKKVFSPEEISAMVLTKMKETAEAYLGKPIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>ref|XP_009592769.1| PREDICTED: luminal-binding protein 5 [Nicotiana tomentosiformis]
Length=668

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW RR SLIVF I++FGSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKRRASLIVFAILLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRD KLV
Sbjct  63   NDQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDRKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PY+IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYEIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_011075955.1| PREDICTED: luminal-binding protein 5 [Sesamum indicum]
Length=665

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW  R S +VFGIV+ GSLFAFSIAKEEA+K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKTRVSTVVFGIVLIGSLFAFSIAKEEAAKVGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTDNERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDNERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYI+VKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIEVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG IAGLNV
Sbjct  183  FNDAQRQATKDAGTIAGLNV  202



>gb|KJB39586.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=439

 Score =   365 bits (937),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>ref|XP_004234985.1| PREDICTED: luminal-binding protein 5 [Solanum lycopersicum]
Length=668

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            A TRR S IVF IV+ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALTRRASSIVFAIVLLGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMKETAEAFLGKTIKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILVKMKETAEAFLGKTIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>ref|XP_007211088.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
 gb|EMJ12287.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
Length=667

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|KJB39579.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=526

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_008437399.1| PREDICTED: luminal-binding protein 5 [Cucumis melo]
Length=665

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>ref|XP_006350519.1| PREDICTED: luminal-binding protein 5-like [Solanum tuberosum]
Length=668

 Score =   368 bits (944),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            A  RR S IVF IV+ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALKRRASSIVFAIVLLGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVN+DGKPYIQVKIKDGETKVFSPEE+SAMIL KMKETAEAFLGKTIKDAVVTVPAYF
Sbjct  124  YKIVNRDGKPYIQVKIKDGETKVFSPEEVSAMILIKMKETAEAFLGKTIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>emb|CAC14168.1| putative luminal binding protein [Corylus avellana]
Length=668

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILIKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>ref|XP_004143862.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 ref|XP_004169474.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 gb|KGN50013.1| hypothetical protein Csa_5G149330 [Cucumis sativus]
Length=665

 Score =   367 bits (943),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKFDDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>gb|KJB39584.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=667

 Score =   367 bits (942),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>gb|AAW55475.1| ER-binding protein [Malus pumila]
Length=667

 Score =   367 bits (942),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SLIV  IV FG LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_008239207.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=667

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|AAK21920.1|AF338252_1 BiP-isoform D [Glycine max]
Length=495

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>ref|XP_008390320.1| PREDICTED: luminal-binding protein 5 [Malus domestica]
 ref|XP_009344042.1| PREDICTED: luminal-binding protein 5 [Pyrus x bretschneideri]
Length=667

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SLIV  IV FG LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|KJB39580.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=667

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_011084527.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=665

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GA  RR S  V GIV+ G LFAFSIAKEEA+K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GARKRRASSTVLGIVLLGCLFAFSIAKEEAAKVGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYI+VKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIEVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG IAGLNV
Sbjct  183  FNDAQRQATKDAGTIAGLNV  202



>emb|CAB72128.1| heat shock protein 70 [Cucumis sativus]
Length=665

 Score =   365 bits (937),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKFDDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAE FLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEDFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>gb|KHG04866.1| Luminal-binding 5 [Gossypium arboreum]
Length=733

 Score =   367 bits (941),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = +3

Query  72   AMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  251
            AMAG +W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  V
Sbjct  66   AMAG-SWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHV  124

Query  252  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  431
            EIIANDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+D
Sbjct  125  EIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKD  184

Query  432  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  611
            MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVT
Sbjct  185  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVT  244

Query  612  VPAYFNDAQRQATKDAGIIAGLNV  683
            VPAYFNDAQRQATKDAG+IAGLNV
Sbjct  245  VPAYFNDAQRQATKDAGVIAGLNV  268



>gb|KHN16716.1| Luminal-binding protein 5 [Glycine soja]
Length=726

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 190/206 (92%), Gaps = 2/206 (1%)
 Frame = +3

Query  66   HRAMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQ  245
             RAMAG +W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+ 
Sbjct  57   ERAMAG-SWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNG  114

Query  246  RVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQ  425
             VEIIANDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ
Sbjct  115  HVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQ  174

Query  426  RDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAV  605
            +DMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAV
Sbjct  175  KDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAV  234

Query  606  VTVPAYFNDAQRQATKDAGIIAGLNV  683
            VTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  235  VTVPAYFNDAQRQATKDAGVIAGLNV  260



>ref|XP_009770477.1| PREDICTED: luminal-binding protein 4-like [Nicotiana sylvestris]
Length=666

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            M GG W R +SL V  IV+FG L A SIAKEEA+KL TVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MGGGYWRRSSSLAVLAIVLFGCLSALSIAKEEATKLRTVIGIDLGTTYSCVGVYKNGHVE  60

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  61   IIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDM  120

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYIQVKIKDGE KVFSPEEISAMIL KMKETAEAFLGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMILIKMKETAEAFLGKKIKDAVVTV  180

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNV  203



>ref|XP_010266594.1| PREDICTED: luminal-binding protein 5 [Nelumbo nucifera]
Length=666

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G W +R SLIV GIV+FG L AF+IAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GVWKKRGSLIVLGIVLFGCLSAFAIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLXKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>ref|XP_009619852.1| PREDICTED: luminal-binding protein 4-like [Nicotiana tomentosiformis]
Length=666

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            M GG W R +SL+V  IV+FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MGGGYWRRSSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DM
Sbjct  61   IIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDM  120

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYIQVKIKD E KVFSPEEISAMIL KMKETAEAFLGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDVEVKVFSPEEISAMILIKMKETAEAFLGKKIKDAVVTV  180

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNV  203



>gb|AAA99920.1| glucose-regulated protein 78, partial [Solanum lycopersicum]
Length=375

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = +3

Query  87   AWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            A +RR  SL+V  IV+ G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    ACSRRGNSLVVLAIVLLGCLSALSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTDNERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIV+KDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PYKIVSKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|KHM99873.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>ref|XP_008337565.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=667

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|KDP25255.1| hypothetical protein JCGZ_20411 [Jatropha curcas]
Length=665

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R  L+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRAR-GLVVLAIVFFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>gb|KDP35832.1| hypothetical protein JCGZ_10646 [Jatropha curcas]
Length=666

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            A  R+ SLIV  IV+FGSL A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALRRQASLIVLAIVLFGSLLAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTDNERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDNERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKI+DGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>ref|XP_006476337.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=667

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NP+RTIFDVKRLIGRKFDDKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFDDKEVQRDMKLF  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            P+KIVNKDGKPYIQV+I+DGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>ref|XP_006439283.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
 gb|ESR52523.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
Length=667

 Score =   362 bits (930),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLA  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVN+DGKPYIQV+I+DGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>ref|XP_003530453.1| PREDICTED: luminal-binding protein 5 [Glycine max]
Length=667

 Score =   362 bits (930),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>ref|XP_010107258.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC14452.1| Luminal-binding protein 5 [Morus notabilis]
Length=667

 Score =   362 bits (930),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQ+D+KL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQKDIKLF  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            P+KIVNKDGKPYIQV IKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVNIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>gb|KJB18908.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18912.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18914.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18916.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=423

 Score =   354 bits (909),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>ref|XP_009802727.1| PREDICTED: luminal-binding protein [Nicotiana sylvestris]
Length=666

 Score =   362 bits (929),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 190/204 (93%), Gaps = 3/204 (1%)
 Frame = +3

Query  75   MAGGAWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  251
            MAG  + RR +SL+V  IV+FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  V
Sbjct  1    MAG--YLRRGSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHV  58

Query  252  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  431
            EIIANDQGNRITPSWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRD
Sbjct  59   EIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRD  118

Query  432  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  611
            MKLVPYKIVNKD KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVT
Sbjct  119  MKLVPYKIVNKDSKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVT  178

Query  612  VPAYFNDAQRQATKDAGIIAGLNV  683
            VPAYFNDAQRQATKDAG+IAGLNV
Sbjct  179  VPAYFNDAQRQATKDAGVIAGLNV  202



>gb|KJB18909.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=427

 Score =   354 bits (909),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>ref|XP_009593820.1| PREDICTED: luminal-binding protein [Nicotiana tomentosiformis]
Length=668

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 190/204 (93%), Gaps = 3/204 (1%)
 Frame = +3

Query  75   MAGGAWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  251
            MAG  + RR +SL+V  IV+FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  V
Sbjct  1    MAG--YLRRGSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHV  58

Query  252  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  431
            EIIANDQGNRITPSWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRD
Sbjct  59   EIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRD  118

Query  432  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  611
            MKLVPYKIVNKD KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVT
Sbjct  119  MKLVPYKIVNKDSKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVT  178

Query  612  VPAYFNDAQRQATKDAGIIAGLNV  683
            VPAYFNDAQRQATKDAG+IAGLNV
Sbjct  179  VPAYFNDAQRQATKDAGVIAGLNV  202



>gb|AAB86942.1| endoplasmic reticulum HSC70-cognate binding protein precursor 
[Glycine max]
Length=668

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            N+QGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NNQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>gb|AJF19166.1| endoplasmic reticulum chaperone binding protein [Lycium chinense]
Length=664

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 186/203 (92%), Gaps = 4/203 (2%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            MAGGA  R  SLIV     FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGALKRSASLIVL----FGCLFALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  56

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  57   IIANDQGNRITPSWVAFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDM  116

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  117  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  176

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  177  PAYFNDAQRQATKDAGVIAGLNV  199



>ref|XP_009358650.1| PREDICTED: luminal-binding protein 5-like [Pyrus x bretschneideri]
Length=667

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLVVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>gb|AAA81953.1| BiP isoform C, partial [Glycine max]
Length=455

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGT+  IDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTLSAIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>gb|KHG09348.1| Luminal-binding 5 [Gossypium arboreum]
Length=667

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+   R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSGRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|EYU19660.1| hypothetical protein MIMGU_mgv1a002500mg [Erythranthe guttata]
Length=666

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GA  RR S IVFGIV+ GSLFAF+IAKEEA K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GALKRRESSIVFGIVLIGSLFAFAIAKEEAPKIGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLF  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            P+KIVN+DGKPYI+VKIKDGETKVFSPEE+SAMIL KMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PFKIVNRDGKPYIEVKIKDGETKVFSPEEVSAMILIKMKETAEAYLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_007040596.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY25097.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=665

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W    SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRASGSLVVLAIVLSGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTDNERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>gb|KJB18915.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=458

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>gb|KJB18910.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=482

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>gb|KJB24175.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=518

 Score =   356 bits (914),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G++  R SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMK+TAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILGKMKDTAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_009396163.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  81   GGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  260
            G +   R S+I+ G++V GSLFAFS+AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    GSSSRNRGSMILLGLLVAGSLFAFSVAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  261  ANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKL  440
            ANDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKL
Sbjct  62   ANDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKL  121

Query  441  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPA  620
            VPYKIVNKDGKPYIQVKIKDGE KVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPA
Sbjct  122  VPYKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPA  181

Query  621  YFNDAQRQATKDAGIIAGLNV  683
            YFNDAQRQATKDAGIIAGLNV
Sbjct  182  YFNDAQRQATKDAGIIAGLNV  202



>ref|XP_010671405.1| PREDICTED: luminal-binding protein [Beta vulgaris subsp. vulgaris]
Length=665

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW  R S IV GIV+ G+LFA +IAK+EA KLGTVIGIDLGTTYSCVGVYKD +VEIIA
Sbjct  3    GAWNSRAS-IVLGIVLCGTLFALTIAKDEAPKLGTVIGIDLGTTYSCVGVYKDGKVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FT++ERLIGEAAKNQAA+NPERT+FDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTNDERLIGEAAKNQAAANPERTVFDVKRLIGRKFEDKEVQRDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQV+++DGETKVFSPEEISAMILTKMKETAE FLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVQVQDGETKVFSPEEISAMILTKMKETAETFLGKKIKDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>sp|Q42434.1|BIP_SPIOL RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Spinacia oleracea]
 gb|AAA21808.1| ER-lumenal protein [Spinacia oleracea]
 gb|AAA21806.1| ER-lumenal protein [Spinacia oleracea]
Length=668

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            AW  R S I FGIV+ GSLFAF  AK+EA KLGTVIGIDLGTTYSCVGVYKD +VEIIAN
Sbjct  4    AWKSRASSIAFGIVLLGSLFAFVSAKDEAPKLGTVIGIDLGTTYSCVGVYKDGKVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FT++ERLIGEAAKNQAA+NPERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTNDERLIGEAAKNQAAANPERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVN+DGKPYIQVK+++GETKVFSPEEISAMILTKMKETAE FLGK IKDAVVTVPAYF
Sbjct  124  YKIVNRDGKPYIQVKVQEGETKVFSPEEISAMILTKMKETAETFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>gb|KJB18911.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=526

 Score =   356 bits (913),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>ref|XP_002518865.1| heat shock protein, putative [Ricinus communis]
 gb|EEF43398.1| heat shock protein, putative [Ricinus communis]
Length=664

 Score =   359 bits (922),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 187/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R + +V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGA-VVSAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>emb|CBI34546.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   358 bits (918),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W RR SLIV  IV FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRRGSLIVAAIVCFGFLAAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            Y IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YNIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>ref|XP_006286332.1| hypothetical protein CARUB_v100044651mg, partial [Capsella rubella]
 gb|EOA19230.1| hypothetical protein CARUB_v100044651mg, partial [Capsella rubella]
Length=415

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>gb|KJB18913.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=505

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>ref|XP_007160200.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
 gb|ESW32194.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
Length=666

 Score =   358 bits (919),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            MAG   +R  SLIV  IV FG +FA SIAKEEA+KLGTVIGIDLGTTYSCVGVY++  VE
Sbjct  1    MAGSLASR--SLIVLAIVTFGCVFAISIAKEEATKLGTVIGIDLGTTYSCVGVYRNGHVE  58

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDM
Sbjct  59   IIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDM  118

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVNKDGKPYI+VKIKDGETKVFSPEE+SAMILTKMKETAEAFLGK I DAVVTV
Sbjct  119  KLVPYKIVNKDGKPYIEVKIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKINDAVVTV  178

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  179  PAYFNDAQRQATKDAGVIAGLNV  201



>emb|CBI23034.3| unnamed protein product [Vitis vinifera]
Length=648

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW  R S +V GI++ G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDDKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            P+KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>ref|XP_002263323.1| PREDICTED: luminal-binding protein 5 [Vitis vinifera]
Length=667

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W RR SLIV  IV FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRRGSLIVAAIVCFGFLAAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            Y IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YNIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>ref|XP_002276268.2| PREDICTED: luminal-binding protein 5-like isoform X2 [Vitis vinifera]
Length=667

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW  R S +V GI++ G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDDKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            P+KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  183  FNDAQRQATKDAGIIAGLNV  202



>gb|KHG07305.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   357 bits (917),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G++  R SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMK+TAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILGKMKDTAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|KJB24174.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=666

 Score =   357 bits (917),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G++  R SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWVGFTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMK+TAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILGKMKDTAEAFLGKKIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_004503582.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   357 bits (916),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W +  SL V  I+ FG LFA SIAKEE +KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSW-KCGSLFVLAIISFGCLFAISIAKEEGTKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTI+DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIRDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>ref|XP_006286341.1| hypothetical protein CARUB_v100065121mg, partial [Capsella rubella]
 gb|EOA19239.1| hypothetical protein CARUB_v100065121mg, partial [Capsella rubella]
Length=484

 Score =   351 bits (901),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>ref|XP_011026831.1| PREDICTED: luminal-binding protein 5 [Populus euphratica]
Length=666

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G WT R  ++V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWTAR-GVVVSAIILFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKL 
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNSERTIFDVKRLIGRKFEDKEVQKDMKLF  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  182  FNDAQRQATKDAGIIAGLNV  201



>ref|XP_010055986.1| PREDICTED: luminal-binding protein [Eucalyptus grandis]
Length=667

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    S +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSFVVLSILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNAERTVFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  184  NDAQRQATKDAGVIAGLNV  202



>gb|EYU25251.1| hypothetical protein MIMGU_mgv1a002497mg [Erythranthe guttata]
Length=667

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 186/201 (93%), Gaps = 2/201 (1%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIA--KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  260
            AW RR S I+F  V+ GSLFAFSIA  +EEA K+GTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  4    AWKRRASSIIFAFVLIGSLFAFSIAAEEEEAPKVGTVIGIDLGTTYSCVGVYKNGHVEII  63

Query  261  ANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKL  440
            ANDQGNRITPSWVGFTD+ERLIGEAAKNQ A NPERT+FDVKRLIGRKF+DKEVQ+DMKL
Sbjct  64   ANDQGNRITPSWVGFTDSERLIGEAAKNQFAVNPERTVFDVKRLIGRKFEDKEVQKDMKL  123

Query  441  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPA  620
            VPYKIVN+DGKPYIQVKI+DGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPA
Sbjct  124  VPYKIVNRDGKPYIQVKIRDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPA  183

Query  621  YFNDAQRQATKDAGIIAGLNV  683
            YFNDAQRQATKDAG IAGLNV
Sbjct  184  YFNDAQRQATKDAGTIAGLNV  204



>ref|XP_002299448.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE84253.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G WT R  ++V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWTAR-GVVVSAIILFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKL 
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLF  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAGIIAGLNV
Sbjct  182  FNDAQRQATKDAGIIAGLNV  201



>gb|KCW72555.1| hypothetical protein EUGRSUZ_E01024 [Eucalyptus grandis]
Length=719

 Score =   357 bits (916),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    S +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  56   SWRASGSFVVLSILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  115

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  116  DQGNRITPSWVAFTDGERLIGEAAKNQAAVNAERTVFDVKRLIGRKFEDKEVQKDMKLVP  175

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  176  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  235

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  236  NDAQRQATKDAGVIAGLNV  254



>emb|CDP12195.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   355 bits (911),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W R  S I   IV FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRSGSFIALAIVFFGCLSAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGE KVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>gb|KJB18907.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=666

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>ref|XP_006343810.1| PREDICTED: luminal-binding protein-like [Solanum tuberosum]
Length=667

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G   R  SL+V  IV+ G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GCLRRGNSLVVLTIVLLGCLSALSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTDNERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKI++KDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PYKIISKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>gb|ACJ11746.1| luminal binding protein [Gossypium hirsutum]
Length=666

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>ref|XP_002303672.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE78651.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G W  R + +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWRARGA-VVSAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>ref|XP_011022455.1| PREDICTED: luminal-binding protein 5-like [Populus euphratica]
Length=666

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G W  R + +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWRARGA-VVSAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  182  FNDAQRQATKDAGVIAGLNV  201



>ref|NP_001234636.1| luminal-binding protein precursor [Solanum lycopersicum]
 sp|P49118.1|BIP_SOLLC RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34139.1| glucose-regulated protein 78 [Solanum lycopersicum]
Length=666

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = +3

Query  87   AWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            A +RR  SL+V  IV+ G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    ACSRRGNSLVVLAIVLLGCLSALSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTDNERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIV+KDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PYKIVSKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>ref|XP_006405286.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
 dbj|BAJ34315.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46739.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
Length=669

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDKKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>ref|NP_199017.2| Luminal-binding protein 2 [Arabidopsis thaliana]
 gb|AED94756.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=613

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  105  SLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  284
            S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRI
Sbjct  9    STVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI  68

Query  285  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  464
            TPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNK
Sbjct  69   TPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNK  128

Query  465  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  644
            DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  129  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  188

Query  645  ATKDAGIIAGLNV  683
            ATKDAG+IAGLNV
Sbjct  189  ATKDAGVIAGLNV  201



>ref|XP_004300491.1| PREDICTED: luminal-binding protein [Fragaria vesca subsp. vesca]
Length=667

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            G+W  R SLIV  IV  G LFA SIAKEE +KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARNSLIVLAIVTLGCLFAISIAKEETAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERT+FDVKRLIGRKF DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNHERTVFDVKRLIGRKFADKEVQRDMKLF  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            P+KIVN+DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I++AVVTVPAY
Sbjct  123  PFKIVNQDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIQNAVVTVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  183  FNDAQRQATKDAGVIAGLNV  202



>dbj|BAA12348.1| luminal binding protein (BiP) [Arabidopsis thaliana]
Length=668

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +3

Query  102  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  281
             S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  282  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  461
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  462  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  641
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  642  QATKDAGIIAGLNV  683
            QATKDAG+IAGLNV
Sbjct  188  QATKDAGVIAGLNV  201



>ref|NP_851119.1| Luminal-binding protein 2 [Arabidopsis thaliana]
 sp|Q39043.2|MD37F_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37f; AltName: Full=Heat shock 70 kDa protein 12; AltName: 
Full=Heat shock protein 70-12; Short=AtHsp70-12; AltName: 
Full=Luminal-binding protein 2; Short=AtBP2; Short=BiP2; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB08435.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAO00752.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAP37765.1| At5g42020 [Arabidopsis thaliana]
 gb|AED94755.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=668

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +3

Query  102  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  281
             S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  282  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  461
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  462  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  641
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  642  QATKDAGIIAGLNV  683
            QATKDAG+IAGLNV
Sbjct  188  QATKDAGVIAGLNV  201



>ref|XP_010918502.1| PREDICTED: luminal-binding protein 4-like [Elaeis guineensis]
Length=664

 Score =   352 bits (904),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R+S I+ G+++ G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  8    RSSGIMLGLLLTGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  67

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV F D ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQRD+KLVPYKIV
Sbjct  68   RITPSWVAFADTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDKEVQRDIKLVPYKIV  127

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKI+DGE KVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQ
Sbjct  128  NKDGKPYIQVKIRDGEVKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQ  187

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAGIIAGLNV
Sbjct  188  RQATKDAGIIAGLNV  202



>ref|XP_006401475.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
 gb|ESQ42928.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
Length=668

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEANKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRK++DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKYEDKEVQKDKKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>gb|KEH21274.1| heat shock 70 kDa protein [Medicago truncatula]
Length=668

 Score =   352 bits (903),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  254
            M  G+W +R SL V  I+  G LFA S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MMAGSW-KRGSLFVLAIISIGCLFACSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  59

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIANDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  60   IIANDQGNRITPSWVSFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDM  119

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KLVPYKIVN+DGKPYIQV++KDGETKVFSPEEISAMIL KMKETAE FLGKTI+DAVVTV
Sbjct  120  KLVPYKIVNRDGKPYIQVRVKDGETKVFSPEEISAMILGKMKETAEGFLGKTIRDAVVTV  179

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG+IAGLNV
Sbjct  180  PAYFNDAQRQATKDAGVIAGLNV  202



>emb|CDX79726.1| BnaC03g20620D [Brassica napus]
Length=642

 Score =   351 bits (901),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>gb|KFK32162.1| hypothetical protein AALP_AA6G205800 [Arabis alpina]
Length=663

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  114  VFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  293
            V   +  G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  7    VLAFIFLGCLFAISIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  66

Query  294  WVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGK  473
            WVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVPYKIVNKDGK
Sbjct  67   WVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKIVNKDGK  126

Query  474  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATK  653
            PYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATK
Sbjct  127  PYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATK  186

Query  654  DAGIIAGLNV  683
            DAG+IAGLNV
Sbjct  187  DAGVIAGLNV  196



>dbj|BAA13948.1| luminal binding protein [Arabidopsis thaliana]
Length=668

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  102  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  281
             S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  282  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  461
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  462  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  641
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKET EA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETTEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  642  QATKDAGIIAGLNV  683
            QATKDAG+IAGLNV
Sbjct  188  QATKDAGVIAGLNV  201



>emb|CDY23972.1| BnaC03g17190D [Brassica napus]
 emb|CDX84809.1| BnaA03g14210D [Brassica napus]
Length=642

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>ref|XP_009132761.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=669

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>ref|XP_002887878.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64137.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I + G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  6    LVLAIFLLGCLFAISIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  65

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVPYKIVNK+G
Sbjct  66   SWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKIVNKEG  125

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  126  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  185

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  186  KDAGVIAGLNV  196



>ref|XP_008796727.1| PREDICTED: luminal-binding protein 5 [Phoenix dactylifera]
Length=664

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  105  SLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  284
            S I+ GI++ G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRI
Sbjct  10   SAILLGILLSGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI  69

Query  285  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  464
            TPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRD+KLVPYKIVNK
Sbjct  70   TPSWVAFTDSERLIGEAAKNQAALNAERTIFDVKRLIGRKFEDKEVQRDIKLVPYKIVNK  129

Query  465  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  644
            DGKPYIQVKI+DGE KVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  130  DGKPYIQVKIRDGEVKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  189

Query  645  ATKDAGIIAGLNV  683
            ATKDAGIIAGLNV
Sbjct  190  ATKDAGIIAGLNV  202



>ref|XP_002868566.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44825.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>emb|CDY63497.1| BnaC07g48050D [Brassica napus]
Length=642

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FGSLFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGSLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWV FTD+ERLIGEAAKNQA  NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>ref|XP_010473721.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 184/196 (94%), Gaps = 2/196 (1%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            R T L+ F  V+ G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  3    RNTVLLAF--VLLGCLFAASIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQG  60

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVPYKI
Sbjct  61   NRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKI  120

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNK+GKPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  121  VNKEGKPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDA  180

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG+IAGLNV
Sbjct  181  QRQATKDAGVIAGLNV  196



>ref|XP_010436161.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X2 [Camelina sativa]
Length=668

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +3

Query  114  VFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  293
            V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  12   VLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  71

Query  294  WVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGK  473
            WVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDGK
Sbjct  72   WVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGK  131

Query  474  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATK  653
            PYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATK
Sbjct  132  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATK  191

Query  654  DAGIIAGLNV  683
            DAG+IAGLNV
Sbjct  192  DAGVIAGLNV  201



>ref|XP_004503579.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  123  IVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  302
            I+ FG LFAFS AKEE SKLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV 
Sbjct  15   IISFGCLFAFSAAKEEGSKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVA  74

Query  303  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  482
            FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYI
Sbjct  75   FTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYI  134

Query  483  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  662
            QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTI+DAVVTVPAYFNDAQRQATKDAG
Sbjct  135  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIRDAVVTVPAYFNDAQRQATKDAG  194

Query  663  IIAGLNV  683
            +IAGLNV
Sbjct  195  VIAGLNV  201



>ref|XP_010430591.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 184/196 (94%), Gaps = 2/196 (1%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            R T L+ F  ++ G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  3    RDTVLLAF--ILLGCLFAVSIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQG  60

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWVGFTD+ERLIGEAAKNQAA NP+RT+FDVKRLIGRKFDDKEVQ+DMKLVPYKI
Sbjct  61   NRITPSWVGFTDSERLIGEAAKNQAAVNPDRTVFDVKRLIGRKFDDKEVQKDMKLVPYKI  120

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNK+GKPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  121  VNKEGKPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDA  180

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG+IAGLNV
Sbjct  181  QRQATKDAGVIAGLNV  196



>gb|AAZ95244.1| putative luminal-binding protein [Isatis tinctoria]
Length=668

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LFA   AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFALCTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>gb|KDO76632.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=409

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  141  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  320
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  321  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  500
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  501  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  680
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  681  V  683
            V
Sbjct  182  V  182



>ref|XP_010446984.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010447007.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010436160.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X1 [Camelina sativa]
Length=668

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  114  VFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  293
            V  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  12   VLAIIFLGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  71

Query  294  WVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGK  473
            WVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDGK
Sbjct  72   WVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGK  131

Query  474  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATK  653
            PYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATK
Sbjct  132  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATK  191

Query  654  DAGIIAGLNV  683
            DAG+IAGLNV
Sbjct  192  DAGVIAGLNV  201



>dbj|BAD95470.1| BiP [Glycine max]
Length=668

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  99   RTSLIVFGIVV-FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            R SL+   I+V  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  7    RGSLLPLAIIVSLGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  66

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD+ERLIGEAAKN AA NPER IFDVKRLIGRKF+DKEVQRDMKLVPYKI
Sbjct  67   NRITPSWVAFTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKLVPYKI  126

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDA
Sbjct  127  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDA  186

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG+IAGLNV
Sbjct  187  QRQATKDAGVIAGLNV  202



>gb|KHN16714.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  99   RTSLIVFGIVV-FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            R SL+   I+V  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  7    RGSLLPLAIIVSLGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  66

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD+ERLIGEAAKN AA NPER IFDVKRLIGRKF+DKEVQRDMKLVPYKI
Sbjct  67   NRITPSWVAFTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKLVPYKI  126

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDA
Sbjct  127  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDA  186

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG+IAGLNV
Sbjct  187  QRQATKDAGVIAGLNV  202



>emb|CDY46766.1| BnaA03g17100D [Brassica napus]
Length=642

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            IV  I+  G +FAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   IVLAIIFVGCVFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>ref|NP_001045675.1| Os02g0115900 [Oryza sativa Japonica Group]
 dbj|BAD07938.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAD07713.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAF07589.1| Os02g0115900 [Oryza sativa Japonica Group]
 gb|EAY84196.1| hypothetical protein OsI_05577 [Oryza sativa Indica Group]
 gb|EAZ21491.1| hypothetical protein OsJ_05115 [Oryza sativa Japonica Group]
 gb|ACA50500.1| dnak-type molecular chaperone Bip [Oryza sativa Japonica Group]
Length=665

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R    + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>gb|KHM99871.1| Luminal-binding protein 4 [Glycine soja]
Length=668

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R SL+   IV    LF  SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  9    RGSLLPLAIVSLVCLFVISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  68

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  69   RITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  128

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDAQ
Sbjct  129  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDAQ  188

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  189  RQATKDAGVIAGLNV  203



>gb|AGT16206.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKITDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>gb|AGT15890.1| luminal-binding protein [Saccharum hybrid cultivar R570]
 gb|AGT16047.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKITDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>gb|AGT16055.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
 gb|AGT16312.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
Length=664

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKITDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>gb|ACF86491.1| unknown [Zea mays]
 gb|AFW66784.1| luminal-binding protein 3 Precursor [Zea mays]
Length=663

 Score =   347 bits (891),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKII  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>ref|NP_001105894.1| luminal-binding protein 3 precursor [Zea mays]
 sp|O24581.1|BIP3_MAIZE RecName: Full=Luminal-binding protein 3; Short=BiP3; Flags: Precursor 
[Zea mays]
 gb|AAC49900.1| lumenal binding protein cBiPe3 [Zea mays]
Length=663

 Score =   347 bits (890),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKII  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>dbj|BAA13947.1| luminal binding protein [Arabidopsis thaliana]
Length=669

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  102  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  281
             S +V  I+ FG LFA S A EEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  282  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  461
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  462  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  641
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  642  QATKDAGIIAGLNV  683
            QATKDAG+IAGLNV
Sbjct  188  QATKDAGVIAGLNV  201



>gb|KDO76630.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=494

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  141  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  320
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  321  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  500
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  501  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  680
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  681  V  683
            V
Sbjct  182  V  182



>ref|NP_001105893.1| luminal-binding protein 2 precursor [Zea mays]
 ref|NP_001278725.1| NHP2-like protein 1 precursor [Zea mays]
 sp|P24067.3|BIP2_MAIZE RecName: Full=Luminal-binding protein 2; Short=BiP2; AltName: 
Full=B-70; Short=B70; AltName: Full=Heat shock protein 70 homolog 
2; Flags: Precursor [Zea mays]
 gb|AAC49899.1| lumenal binding protein cBiPe2 [Zea mays]
 gb|ACF86383.1| unknown [Zea mays]
 gb|AEW66883.1| ER luminal binding protein [Zea mays]
 gb|AFW69798.1| binding protein-like protein [Zea mays]
Length=663

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYKII  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>ref|NP_198206.1| Luminal-binding protein 1 [Arabidopsis thaliana]
 sp|Q9LKR3.1|MD37A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37a; AltName: Full=Heat shock 70 kDa protein 11; AltName: 
Full=Heat shock protein 70-11; Short=AtHsp70-11; AltName: 
Full=Luminal-binding protein 1; Short=AtBP1; Short=BiP1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF88019.1| Hypothetical protein T26D3.10 [Arabidopsis thaliana]
 gb|AAN17430.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN65099.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93812.1| Luminal-binding protein 1 [Arabidopsis thaliana]
Length=669

 Score =   347 bits (890),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  102  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  281
             S +V  I+ FG LFA S A EEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  282  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  461
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  462  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  641
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  642  QATKDAGIIAGLNV  683
            QATKDAG+IAGLNV
Sbjct  188  QATKDAGVIAGLNV  201



>ref|XP_003525327.2| PREDICTED: luminal-binding protein [Glycine max]
Length=701

 Score =   348 bits (892),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R SL+   IV    LF  SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  42   RGSLLPLAIVSLVCLFVISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  101

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  102  RITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  161

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDAQ
Sbjct  162  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDAQ  221

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  222  RQATKDAGVIAGLNV  236



>gb|EPS69483.1| luminal-binding protein 5, partial [Genlisea aurea]
Length=661

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            A   RTS IV GIV+ G   A SIA +EA KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  2    ALKMRTSTIVLGIVLIGCFLATSIAVDEAPKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  61

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  62   DQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  121

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNK+GKPYI+V+IKDGE KVFSPEEISAM+L KMKETAEA+LGK IKDAVVTVPAYF
Sbjct  122  YKIVNKEGKPYIEVQIKDGERKVFSPEEISAMVLIKMKETAEAYLGKKIKDAVVTVPAYF  181

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAG+IAGLNV
Sbjct  182  NDAQRQATKDAGVIAGLNV  200



>emb|CDX77423.1| BnaA07g05610D [Brassica napus]
Length=642

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LF FS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFTFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWV FTD+ERLIGEAAKNQA  NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>gb|KDO76631.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=487

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  141  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  320
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  321  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  500
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  501  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  680
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  681  V  683
            V
Sbjct  182  V  182



>ref|XP_006827760.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
 gb|ERM95176.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
Length=665

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R SL+V  ++  G LFAF +AKEEA+KLGTVIGIDLGTTYSCVGVYK   VEIIANDQGN
Sbjct  8    RGSLMVLALIASGCLFAFVVAKEEATKLGTVIGIDLGTTYSCVGVYKSGHVEIIANDQGN  67

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  68   RITPSWVAFTDTERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  127

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPY+QVK+KDG+TKVFSPEEISAM+L KMKETAE+FLGK IKDAVVTVPAYFNDAQ
Sbjct  128  NKDGKPYVQVKMKDGDTKVFSPEEISAMVLIKMKETAESFLGKDIKDAVVTVPAYFNDAQ  187

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  188  RQATKDAGVIAGLNV  202



>ref|XP_009102505.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Brassica rapa]
Length=666

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V  I+ FG LF FS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFTFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWV FTD+ERLIGEAAKNQA  NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  191  KDAGVIAGLNV  201



>ref|XP_004952156.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=665

 Score =   344 bits (883),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPY IV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYNIV  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NK+GKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKEGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>ref|XP_006648229.1| PREDICTED: luminal-binding protein 2-like [Oryza brachyantha]
Length=665

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R    + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPY+IV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYQIV  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKI+DGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIRDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>gb|KDO76629.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=647

 Score =   341 bits (875),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  141  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  320
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  321  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  500
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  501  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  680
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  681  V  683
            V
Sbjct  182  V  182



>ref|XP_010662895.1| PREDICTED: luminal-binding protein 5-like isoform X1 [Vitis vinifera]
Length=697

 Score =   342 bits (878),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 184/230 (80%), Gaps = 30/230 (13%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GAW  R S +V GI++ G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDDKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP--  617
            P+KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  
Sbjct  123  PFKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPGN  182

Query  618  ----------------------------AYFNDAQRQATKDAGIIAGLNV  683
                                        AYFNDAQRQATKDAGIIAGLNV
Sbjct  183  VKQFDLMDEVNCCFSVEMTYVSILTTSTAYFNDAQRQATKDAGIIAGLNV  232



>ref|XP_010545034.1| PREDICTED: luminal-binding protein 4 [Tarenaya hassleriana]
Length=665

 Score =   341 bits (875),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +   IV FG L+A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VALAIVFFGCLYA-SIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  69

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGR+F DKEVQRDMKL+PYKIVNKDG
Sbjct  70   SWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRQFTDKEVQRDMKLMPYKIVNKDG  129

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQV  KDGETK+FSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  130  KPYIQVNFKDGETKIFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  189

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  190  KDAGVIAGLNV  200



>gb|AAB63469.1| endosperm lumenal binding protein [Oryza sativa]
Length=663

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKR IGRKF++KEVQRDMKLVPYKIV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRDIGRKFEEKEVQRDMKLVPYKIV  124

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NK GKPYIQVKIKDGE KVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKIGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  185  RQATKDAGVIAGLNV  199



>ref|XP_009418642.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            FAFSIAKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERL
Sbjct  22   FAFSIAKEEAIKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERL  81

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+NKDGKPYIQVKIKDG
Sbjct  82   IGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIINKDGKPYIQVKIKDG  141

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            E KVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLNV
Sbjct  142  EVKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  201



>ref|XP_009392825.1| PREDICTED: luminal-binding protein 2 [Musa acuminata subsp. malaccensis]
Length=668

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R S+I+ G+++ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  8    RGSVILLGLLLAGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  67

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGR+F+DKEVQRDMKLVPYKIV
Sbjct  68   RITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRRFEDKEVQRDMKLVPYKIV  127

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDAQ
Sbjct  128  NKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDAQ  187

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAGIIAGLNV
Sbjct  188  RQATKDAGIIAGLNV  202



>ref|XP_003573226.1| PREDICTED: luminal-binding protein 3 [Brachypodium distachyon]
Length=665

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            FAFS AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD+ERL
Sbjct  20   FAFSAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERL  79

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIVN+DGKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNRDGKPYIQVKIKDG  139

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            E KVFSPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ENKVFSPEEISAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199



>ref|XP_002317789.2| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE96009.2| BiP isoform A family protein [Populus trichocarpa]
Length=668

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            R  S +V  I + GSL   SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  8    RAGSFMVVAIFLLGSLLTVSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  67

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD+ERLIGEAAKNQAA+NPERTIFDVKRLIGR + DKEVQ+DMKL PYKI
Sbjct  68   NRITPSWVAFTDSERLIGEAAKNQAAANPERTIFDVKRLIGRVYGDKEVQKDMKLFPYKI  127

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNKDGKPYI+VKIKDGETKVFSPEEISAM++TKMKETAEAFLGK IKDAV+TVPAYFNDA
Sbjct  128  VNKDGKPYIEVKIKDGETKVFSPEEISAMVITKMKETAEAFLGKKIKDAVITVPAYFNDA  187

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG+IAG+ V
Sbjct  188  QRQATKDAGVIAGVRV  203



>ref|NP_001238736.1| BiP isoform B precursor [Glycine max]
 gb|AAA81954.1| BiP isoform B [Glycine max]
Length=666

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 180/201 (90%), Gaps = 4/201 (2%)
 Frame = +3

Query  81   GGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  260
             G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDL TTYSCVGV     VEII
Sbjct  2    AGSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDL-TTYSCVGVT--DAVEII  57

Query  261  ANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKL  440
            ANDQGNRITPSWV FTD+ERLIGEAAK  AA NP RTIFDVKRLIGRKF+DKEVQRDMKL
Sbjct  58   ANDQGNRITPSWVAFTDSERLIGEAAKIVAAVNPVRTIFDVKRLIGRKFEDKEVQRDMKL  117

Query  441  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPA  620
            VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPA
Sbjct  118  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPA  177

Query  621  YFNDAQRQATKDAGIIAGLNV  683
            YFNDAQRQATKDAG+IAGLNV
Sbjct  178  YFNDAQRQATKDAGVIAGLNV  198



>gb|KFK32977.1| hypothetical protein AALP_AA6G313600 [Arabis alpina]
Length=662

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 177/187 (95%), Gaps = 1/187 (1%)
 Frame = +3

Query  126  VVFGSLFAFSIAKEE-ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  302
            +VF   FAFS AKEE A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVG
Sbjct  12   IVFFLGFAFSNAKEEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVG  71

Query  303  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  482
            FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDGKPYI
Sbjct  72   FTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYEIVNKDGKPYI  131

Query  483  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  662
            QVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAG
Sbjct  132  QVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAG  191

Query  663  IIAGLNV  683
            +IAGLNV
Sbjct  192  VIAGLNV  198



>emb|CDX67525.1| BnaA07g15650D [Brassica napus]
Length=577

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 177/193 (92%), Gaps = 3/193 (2%)
 Frame = +3

Query  114  VFGIVVFGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  284
            V  I+ FG LFA FS AKEE   +KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRI
Sbjct  8    VLAIIFFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI  67

Query  285  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  464
            TPSWV FTD+ RLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNK
Sbjct  68   TPSWVAFTDSARLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNK  127

Query  465  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  644
            DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  128  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  187

Query  645  ATKDAGIIAGLNV  683
            ATKDAG+IAGLNV
Sbjct  188  ATKDAGVIAGLNV  200



>gb|KEH21282.1| heat shock cognate 70 kDa-like protein [Medicago truncatula]
Length=669

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = +3

Query  105  SLIVFGIVVFGSLFAFSIAKEEAS-KLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  281
            S+++  I+    LFA S AKEE + KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  9    SVLLLTIISLVCLFATSAAKEEGTTKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  68

Query  282  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  461
            ITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKIVN
Sbjct  69   ITPSWVSFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYKIVN  128

Query  462  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  641
            KDGKPYIQV++KDGETKVFSPEE+SAMILTKMKETAEAFLGKTI+DAVVTVPAYFNDAQR
Sbjct  129  KDGKPYIQVRVKDGETKVFSPEEVSAMILTKMKETAEAFLGKTIRDAVVTVPAYFNDAQR  188

Query  642  QATKDAGIIAGLNV  683
            QATKDAG+IAGLNV
Sbjct  189  QATKDAGVIAGLNV  202



>ref|XP_010934830.1| PREDICTED: luminal-binding protein 4 [Elaeis guineensis]
Length=661

 Score =   337 bits (863),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            R  S+I+ G+ + G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  3    RSRSVILLGLFITGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  62

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD+ERLIGEAAKNQAA+N ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI
Sbjct  63   NRITPSWVAFTDSERLIGEAAKNQAAANAERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  122

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNKDGKPYIQVKIK+GE KVFSPEE+SAM+LTKMKETAEAFLGK IKDAVVTVPAYFNDA
Sbjct  123  VNKDGKPYIQVKIKEGEVKVFSPEEVSAMVLTKMKETAEAFLGKKIKDAVVTVPAYFNDA  182

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAGIIAGLNV
Sbjct  183  QRQATKDAGIIAGLNV  198



>gb|AAA62325.1| HSP70 [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDM+LVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMRLVPYKIVNKEGKPYIQVKIKDG  139

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ETKVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199



>gb|EMT16454.1| Luminal-binding protein 4 [Aegilops tauschii]
 gb|AGN94840.1| ER molecular chaperone [Triticum aestivum]
 gb|AGN94842.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ETKVFSPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEISAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199



>dbj|BAJ85675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   334 bits (857),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ETKVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199



>gb|KHG03675.1| Luminal-binding 5 [Gossypium arboreum]
 gb|KHG17377.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   334 bits (856),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +W    SL+V  IV+ G  FA +IAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVVLAIVLSGCFFAIAIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YKIVNKD KPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDDKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  184  NDAQRQATKDAGIIAGLNV  202



>gb|EMS58484.1| Luminal-binding protein 3 [Triticum urartu]
Length=709

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ETKVFSPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEISAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199



>gb|AGN94841.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ETKVFSPEEISAMIL KMKETAEA+LGK I D VVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEISAMILGKMKETAEAYLGKKINDTVVTVPAYFNDAQRQATKDAGVIAGLNV  199



>ref|XP_009125214.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=665

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 3/193 (2%)
 Frame = +3

Query  114  VFGIVVFGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  284
            V  I+ FG LFA FS AKEE   +KLGTVIGIDLGTTYSCVG YK+  VEIIANDQGNRI
Sbjct  8    VLAIIFFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGAYKNGHVEIIANDQGNRI  67

Query  285  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  464
            TPSWV FTD+ RLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNK
Sbjct  68   TPSWVDFTDSARLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNK  127

Query  465  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  644
            DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  128  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  187

Query  645  ATKDAGIIAGLNV  683
            ATKDAG+IAGLNV
Sbjct  188  ATKDAGVIAGLNV  200



>ref|XP_001774724.1| predicted protein [Physcomitrella patens]
 gb|EDQ60395.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   329 bits (843),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R +L+V G++    +     A EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RHTLLVLGLLFAAGVAGSFGAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  62

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D+KL PYKIV
Sbjct  63   RITPSWVAFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDIKLFPYKIV  122

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKP+IQVK+KDGE KVF+PEEISAM+L KMKETAEA+LGK IKDAVVTVPAYFNDAQ
Sbjct  123  NKDGKPHIQVKVKDGEVKVFTPEEISAMVLVKMKETAEAYLGKKIKDAVVTVPAYFNDAQ  182

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG+IAGLNV
Sbjct  183  RQATKDAGVIAGLNV  197



>ref|XP_010259649.1| PREDICTED: luminal-binding protein 4-like [Nelumbo nucifera]
Length=661

 Score =   328 bits (842),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +3

Query  84   GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            GA  R T+L+V   + F  L   ++A EE+ KLGTVIGIDLGTTYSCVGVY++  VEIIA
Sbjct  2    GAKYRATALLVLFAMEF--LLGLAVASEESPKLGTVIGIDLGTTYSCVGVYRNGHVEIIA  59

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD+ERLIGEAAKNQA+ N ERTIFDVKRLIGRKFDD EVQRD+K +
Sbjct  60   NDQGNRITPSWVAFTDSERLIGEAAKNQASLNAERTIFDVKRLIGRKFDDPEVQRDIKFL  119

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYK+VNKDGKPYIQVKI+DGETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAY
Sbjct  120  PYKVVNKDGKPYIQVKIRDGETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAY  179

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG+IAGLNV
Sbjct  180  FNDAQRQATKDAGVIAGLNV  199



>emb|CAA89834.2| luminal binding protein [Pseudotsuga menziesii]
Length=675

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  108  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  287
            + +   +  G LF+  IA EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  21   MFLAAFITAGFLFSSVIAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  80

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRK++DKEVQ+D+KL+PYKIVNKD
Sbjct  81   PSWVAFTDTERLIGEAAKNQAAMNPERTVFDVKRLIGRKYEDKEVQKDIKLLPYKIVNKD  140

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
            GKPYIQVKI+DGE KVFSPEEISAMIL KMKETAE++LG+ IKDAVVTVPAYFNDAQRQA
Sbjct  141  GKPYIQVKIRDGEIKVFSPEEISAMILLKMKETAESYLGRKIKDAVVTVPAYFNDAQRQA  200

Query  648  TKDAGIIAGLNV  683
            TKDAG+IAGLNV
Sbjct  201  TKDAGVIAGLNV  212



>gb|ABR18447.1| unknown [Picea sitchensis]
Length=687

 Score =   324 bits (831),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = +3

Query  108  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  287
            + +   ++ G L +  IA EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  31   MFLAAFIIAGFLVSSVIAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  90

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRK++DKEVQRD+KL+PYKIVNKD
Sbjct  91   PSWVAFTDTERLIGEAAKNQAAMNPERTVFDVKRLIGRKYEDKEVQRDVKLLPYKIVNKD  150

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
            GKPYIQVKI+D E KVFSPEEISAMIL KMKETAE++LGK IKDAVVTVPAYFNDAQRQA
Sbjct  151  GKPYIQVKIRDDEIKVFSPEEISAMILLKMKETAESYLGKKIKDAVVTVPAYFNDAQRQA  210

Query  648  TKDAGIIAGLNV  683
            TKDAG+IAGLNV
Sbjct  211  TKDAGVIAGLNV  222



>ref|NP_001290009.1| mediator of RNA polymerase II transcription subunit 37a precursor 
[Vitis vinifera]
 gb|AFJ20202.1| putative luminal-binding protein [Vitis vinifera]
Length=660

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            +  ++++  + V   LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNRAVMILQLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIANDQG  63

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKV  123

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNK+GKPYIQVKI+DGE KVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  124  VNKEGKPYIQVKIRDGEIKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDA  183

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAGIIAGLNV
Sbjct  184  QRQATKDAGIIAGLNV  199



>ref|XP_006838409.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
 gb|ERN00978.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
Length=671

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = +3

Query  99   RTSLIVFGIVVF-GSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            ++S+++  ++   G +F   +  EEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  13   KSSILILSVIFLSGFVFESFVKAEEAPKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  72

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD ERL+GEAAKNQAA NPERTIFDVKRLIGR+F DKEVQRDMK +PYK+
Sbjct  73   NRITPSWVAFTDTERLVGEAAKNQAALNPERTIFDVKRLIGRRFSDKEVQRDMKFLPYKV  132

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNKDGKPYI+VKI++ E KVFSPEEISAMIL KMKETAE++LGKTIKDAVVTVPAYFNDA
Sbjct  133  VNKDGKPYIEVKIRENEVKVFSPEEISAMILGKMKETAESYLGKTIKDAVVTVPAYFNDA  192

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG+IAGLNV
Sbjct  193  QRQATKDAGVIAGLNV  208



>ref|NP_001234941.1| BiP isoform A [Glycine max]
 gb|AAA81956.1| BiP isoform A [Glycine max]
Length=664

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 176/201 (88%), Gaps = 7/201 (3%)
 Frame = +3

Query  87   AWTRRTSLIVFGIVV-FGSLFA-FSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  260
            +++R +S     I+V  G LF  FSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  4    SFSRGSSCFPLAIIVSLGCLFRDFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  63

Query  261  ANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKL  440
            ANDQGNRITPSW  FTD+ERLIGEAAKN AA NPER IFDVKRLIGRKF+DKEVQRDMKL
Sbjct  64   ANDQGNRITPSW-SFTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKL  122

Query  441  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPA  620
            VPYKIVNKDGKPYIQ KIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAV    A
Sbjct  123  VPYKIVNKDGKPYIQEKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAV----A  178

Query  621  YFNDAQRQATKDAGIIAGLNV  683
            YFNDAQRQATKDAG+IAGLNV
Sbjct  179  YFNDAQRQATKDAGVIAGLNV  199



>emb|CBI39503.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   318 bits (816),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            +  ++++  + V   LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNRAVMILQLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIANDQG  63

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKV  123

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNK+GKPYIQV I+DGE KVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  124  VNKEGKPYIQVTIRDGEIKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDA  183

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAGIIAGLNV
Sbjct  184  QRQATKDAGIIAGLNV  199



>emb|CDY13371.1| BnaC06g13860D [Brassica napus]
Length=673

 Score =   321 bits (823),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 177/206 (86%), Gaps = 10/206 (5%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            R    +V  I++FG LFA FS AKEE   +KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  3    RSFGAVVLAIILFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  62

Query  267  DQGNRITPSWVGFTDNERLIG-------EAAKNQAASNPERTIFDVKRLIGRKFDDKEVQ  425
            DQGNRITPSWV FTD+ERLIG        A  N+AA NPERTIF VKRLIGRKF+DKEVQ
Sbjct  63   DQGNRITPSWVAFTDSERLIGSLYSKLFHAYLNKAAVNPERTIFGVKRLIGRKFEDKEVQ  122

Query  426  RDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAV  605
            +D KLVPY+IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAV
Sbjct  123  KDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAV  182

Query  606  VTVPAYFNDAQRQATKDAGIIAGLNV  683
            VTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  183  VTVPAYFNDAQRQATKDAGVIAGLNV  208



>ref|XP_010659633.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Vitis vinifera]
Length=649

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            +  ++++  + V   LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNRAVMILQLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIANDQG  63

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKV  123

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNK+GKPYIQV I+DGE KVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  124  VNKEGKPYIQVTIRDGEIKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDA  183

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAGIIAGLNV
Sbjct  184  QRQATKDAGIIAGLNV  199



>ref|XP_002969949.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
 gb|EFJ29073.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
Length=660

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 174/195 (89%), Gaps = 3/195 (2%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R+ +++F +++ G+          A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RSVILLFALLIAGAAVVAKEE---AAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  59

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKL P+KIV
Sbjct  60   RITPSWVAFTETERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLFPFKIV  119

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVK+KDGETKVFSPEEISAMILT+MKETAE++LGK IKDAVVTVPAYFNDAQ
Sbjct  120  NKDGKPYIQVKVKDGETKVFSPEEISAMILTRMKETAESYLGKKIKDAVVTVPAYFNDAQ  179

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG IAGLNV
Sbjct  180  RQATKDAGAIAGLNV  194



>ref|XP_006405378.1| hypothetical protein EUTSA_v10028192mg, partial [Eutrema salsugineum]
 gb|ESQ46831.1| hypothetical protein EUTSA_v10028192mg, partial [Eutrema salsugineum]
Length=415

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = +3

Query  159  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAA  338
            AKE+A+K GT+IGIDLGT YSCVGVYK+  VEIIANDQGNRITPSWVGFTD+E LIGEAA
Sbjct  26   AKEDATKFGTLIGIDLGTAYSCVGVYKNDHVEIIANDQGNRITPSWVGFTDSESLIGEAA  85

Query  339  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  518
            KNQAA NPERTIFDVKRLIGRKF+DK+VQ+D KLVPY+IVNKDGKPYIQVKIK GETKVF
Sbjct  86   KNQAAVNPERTIFDVKRLIGRKFEDKQVQKDRKLVPYQIVNKDGKPYIQVKIKAGETKVF  145

Query  519  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            SPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFND QRQA K+AG+IAGLNV
Sbjct  146  SPEEISAMILIKMKETAEAYLGKKITDAVVTVPAYFNDDQRQAIKNAGVIAGLNV  200



>emb|CDP15491.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 172/200 (86%), Gaps = 2/200 (1%)
 Frame = +3

Query  90   WTRRTSLIVFGIVVFGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIA  263
            + +  +L +F + V   L   ++A EE+ K  LGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    YKKSKALWIFFLFVSEFLLGITLAAEESQKKNLGTVIGIDLGTTYSCVGVYKNGNVEIIA  62

Query  264  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  443
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDD EVQRDMK++
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAINAERTIFDVKRLIGRKFDDPEVQRDMKML  122

Query  444  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  623
            PYKIVNKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAE++LGK I+ AV+TVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMILQKMKQTAESYLGKEIRSAVITVPAY  182

Query  624  FNDAQRQATKDAGIIAGLNV  683
            FNDAQRQATKDAG IAGLNV
Sbjct  183  FNDAQRQATKDAGTIAGLNV  202



>ref|XP_002981419.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
 gb|EFJ17607.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
Length=660

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 174/195 (89%), Gaps = 3/195 (2%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R+ +++F +++ G+          A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RSVILLFALLIAGAAVVAKEE---AAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  59

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKL P+KIV
Sbjct  60   RITPSWVAFTETERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLFPFKIV  119

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKDGKPYIQVK+KDGETKVFSPEEISAMILT+MKETAE++LGK IKDAVVTVPAYFNDAQ
Sbjct  120  NKDGKPYIQVKVKDGETKVFSPEEISAMILTRMKETAESYLGKKIKDAVVTVPAYFNDAQ  179

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG IAGLNV
Sbjct  180  RQATKDAGAIAGLNV  194



>ref|XP_001780840.1| predicted protein [Physcomitrella patens]
 gb|EDQ54319.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  159  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAA  338
            A EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERLIGEAA
Sbjct  23   AAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAA  82

Query  339  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  518
            KNQAA NPERT+FDVKRLIGRKF+DKEVQ+D+KL PYKI+NKDGKP+IQV++KD E KVF
Sbjct  83   KNQAAVNPERTVFDVKRLIGRKFEDKEVQKDIKLFPYKIINKDGKPHIQVQVKDDEAKVF  142

Query  519  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +PEEISAM+L KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  143  TPEEISAMVLLKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV  197



>ref|XP_006433401.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
 ref|XP_006472078.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
 gb|ESR46641.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
Length=657

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 171/188 (91%), Gaps = 2/188 (1%)
 Frame = +3

Query  123  IVVFGSLFAFSIAK-EEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  299
            +++F   F+ ++A  ++ +KLGTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV
Sbjct  11   LLLFAFEFSLALAAADDTTKLGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWV  70

Query  300  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  479
             FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDD EVQRD+K +PYKIVNKDGKPY
Sbjct  71   AFTDTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDPEVQRDIKFLPYKIVNKDGKPY  130

Query  480  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  659
            IQVK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDA
Sbjct  131  IQVKVK-GETKVFSPEEISAMILQKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDA  189

Query  660  GIIAGLNV  683
            GIIAGLNV
Sbjct  190  GIIAGLNV  197



>ref|XP_006479343.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
               + A +  +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD ERL
Sbjct  20   LGLAAADDTTTKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERL  79

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K G
Sbjct  80   IGEAAKNQAAFNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-G  138

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  139  ETKVFSPEEISAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV  198



>ref|XP_010458176.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=664

 Score =   313 bits (802),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +3

Query  126  VVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  302
            +VF +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV 
Sbjct  19   LVFLTALMSSVAVEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVA  78

Query  303  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  482
            FTD ERLIGEAAKNQAA NPERTIFD KRL+GRKFDD +VQRD+K +PYK+VNKDGKPYI
Sbjct  79   FTDTERLIGEAAKNQAAKNPERTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYI  138

Query  483  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  662
            QVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG
Sbjct  139  QVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAG  197

Query  663  IIAGLNV  683
            +IAGLNV
Sbjct  198  VIAGLNV  204



>ref|XP_010458175.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=665

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V+ + +  +L +    + E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITP
Sbjct  16   LVYLVFLTAALMSSVAVEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITP  75

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWV FTD ERLIGEAAKNQAA NPERTIFD KRL+GRKFDD +VQRD+K +PYK+VNKDG
Sbjct  76   SWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDG  135

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQAT
Sbjct  136  KPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQAT  194

Query  651  KDAGIIAGLNV  683
            KDAG+IAGLNV
Sbjct  195  KDAGVIAGLNV  205



>ref|XP_006423179.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
 gb|ESR36419.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
Length=655

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  174  SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAA  353
            +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD ERLIGEAAKNQAA
Sbjct  24   TKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAA  83

Query  354  SNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEI  533
             NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSPEEI
Sbjct  84   FNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-GETKVFSPEEI  142

Query  534  SAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            SAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  143  SAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV  192



>gb|AFC88846.1| putative luminal binding protein 7B4, partial [Tetragonia tetragonioides]
Length=699

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 176/207 (85%), Gaps = 2/207 (1%)
 Frame = +3

Query  69   RAMAGGAWTRRTSLIVFGIVVFGSLF--AFSIAKEEASKLGTVIGIDLGTTYSCVGVYKD  242
            + MA    TR   L +  +++F + F    ++A ++ +  GTVIGIDLGTTYSCVGVYKD
Sbjct  32   QTMAKKLSTRSRDLSLMFLILFVTEFLAGVTLAADDQALKGTVIGIDLGTTYSCVGVYKD  91

Query  243  QRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEV  422
              VEII NDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGR+FDD EV
Sbjct  92   GHVEIIPNDQGNRITPSWVAFTDTERLIGEAAKNQAALNPERTIFDVKRLIGRRFDDPEV  151

Query  423  QRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDA  602
            QRD+K++PYK+VN+DGKPYI+VKIK+G+ KVFSPEEISAMIL KMKETAE+FLG+ IK+A
Sbjct  152  QRDIKMLPYKVVNRDGKPYIEVKIKEGDVKVFSPEEISAMILQKMKETAESFLGRKIKNA  211

Query  603  VVTVPAYFNDAQRQATKDAGIIAGLNV  683
            VVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  212  VVTVPAYFNDAQRQATKDAGVIAGLNV  238



>ref|XP_006423175.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
 gb|ESR36415.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
Length=655

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  174  SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAA  353
            +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD ERLIGEAAKNQAA
Sbjct  24   TKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAA  83

Query  354  SNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEI  533
             NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSPEEI
Sbjct  84   FNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-GETKVFSPEEI  142

Query  534  SAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            SAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  143  SAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV  192



>ref|XP_006306953.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
 gb|EOA39851.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
Length=665

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 169/198 (85%), Gaps = 2/198 (1%)
 Frame = +3

Query  93   TRRTSLIVFGIVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  269
            T  T+  +  +V   +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIAND
Sbjct  9    TNMTNRALVCLVFLMTALMSSVAIEGEDQKLGTVIGIDLGTTYSCVGVYHNKHVEIIAND  68

Query  270  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  449
            QGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFD KRLIGRKFDD +VQRD+K +PY
Sbjct  69   QGNRITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPY  128

Query  450  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  629
            K+VNKDGKPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFN
Sbjct  129  KVVNKDGKPYIQVKVK-GEVKVFSPEEISAMILTKMKETAEAFLGKNIKDAVITVPAYFN  187

Query  630  DAQRQATKDAGIIAGLNV  683
            DAQRQATKDAG IAGLNV
Sbjct  188  DAQRQATKDAGAIAGLNV  205



>emb|CDP21572.1| unnamed protein product, partial [Coffea canephora]
Length=286

 Score =   298 bits (764),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = +3

Query  108  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  287
            L++  +  F +  A +    +   LGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRIT
Sbjct  14   LLLLFVSEFLAGIALAAEGTQKQNLGTVIGIDLGTTYSCVGVYRNGNVEIIANDQGNRIT  73

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PSWV FTD ERLIGEAAKNQAA NPE T+FDVKR IGRKFDD EVQRDMKL+PYK+VNKD
Sbjct  74   PSWVAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRKFDDPEVQRDMKLLPYKVVNKD  133

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
            GKPYI VK+K+GE K+ SPEE+SAM+L +MK+TAE++LGK +K+AVVTVPAYFNDAQRQA
Sbjct  134  GKPYIDVKMKNGEMKLLSPEEVSAMVLQRMKQTAESYLGKEVKNAVVTVPAYFNDAQRQA  193

Query  648  TKDAGIIAGLNV  683
            TKDAG IAGLNV
Sbjct  194  TKDAGTIAGLNV  205



>ref|NP_001184944.1| protein BIP3 [Arabidopsis thaliana]
 gb|AEE28393.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=665

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +3

Query  126  VVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  302
            +VF +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV 
Sbjct  20   LVFLTALMSSLAIEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVA  79

Query  303  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  482
            FTD ERLIGEAAKNQAA NPERTIFD KRLIGRKFDD +VQRD+K +PYK+VNKDGKPYI
Sbjct  80   FTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYI  139

Query  483  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  662
            QVK+K GE K+FSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG
Sbjct  140  QVKVK-GEEKLFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAG  198

Query  663  IIAGLNV  683
             IAGLNV
Sbjct  199  AIAGLNV  205



>ref|XP_010475731.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=666

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  290
            +V+ + +  +L +    + E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITP
Sbjct  16   LVYLVFLTAALMSIVAIEAEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITP  75

Query  291  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  470
            SWV FTD ERLIGEAAKNQAA NPERT+FD KRL+GRKFDD +VQRD+K +PYK+VNKDG
Sbjct  76   SWVAFTDTERLIGEAAKNQAAKNPERTVFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDG  135

Query  471  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  650
            KPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQAT
Sbjct  136  KPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQAT  194

Query  651  KDAGIIAGLNV  683
            KDAG IAGLNV
Sbjct  195  KDAGAIAGLNV  205



>ref|XP_011092383.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=658

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +3

Query  123  IVVFGSLFAFSIAKEEASK-LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  299
            +++F S F   IA   A +  GTVIGIDLGTTYSCVGVY++ +VEIIANDQGNRITPSWV
Sbjct  11   LLLFVSEFFMGIAPAAARENSGTVIGIDLGTTYSCVGVYRNGKVEIIANDQGNRITPSWV  70

Query  300  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  479
             FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRDMK++PYK+V+KDGKPY
Sbjct  71   AFTDTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDMKMLPYKVVDKDGKPY  130

Query  480  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  659
            IQVKI+DGE KVFSPEEISAMIL KMKETAE++LGK IK AV+TVPAYFNDAQRQATKDA
Sbjct  131  IQVKIRDGEIKVFSPEEISAMILQKMKETAESYLGKKIKSAVITVPAYFNDAQRQATKDA  190

Query  660  GIIAGLNV  683
            G IAGLNV
Sbjct  191  GTIAGLNV  198



>ref|XP_010475732.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=665

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 168/197 (85%), Gaps = 1/197 (1%)
 Frame = +3

Query  93   TRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  272
            T  T+  +  +V   +L +    + E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQ
Sbjct  9    TNMTNKALVYLVFLTALMSIVAIEAEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQ  68

Query  273  GNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYK  452
            GNRITPSWV FTD ERLIGEAAKNQAA NPERT+FD KRL+GRKFDD +VQRD+K +PYK
Sbjct  69   GNRITPSWVAFTDTERLIGEAAKNQAAKNPERTVFDPKRLMGRKFDDPDVQRDIKFLPYK  128

Query  453  IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFND  632
            +VNKDGKPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFND
Sbjct  129  VVNKDGKPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFND  187

Query  633  AQRQATKDAGIIAGLNV  683
            AQRQATKDAG IAGLNV
Sbjct  188  AQRQATKDAGAIAGLNV  204



>ref|NP_172382.4| protein BIP3 [Arabidopsis thaliana]
 sp|Q8H1B3.1|MD37B_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37b; AltName: Full=BiP chaperone BIP-L; AltName: 
Full=Heat shock 70 kDa protein 13; AltName: Full=Heat shock 
protein 70-13; Short=AtHsp70-13; AltName: Full=Hsp70 protein 
BiP chaperone BIP-L; AltName: Full=Luminal-binding protein 
3; Short=AtBP3; Short=BiP3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAN60163.1| BiP chaperone BIP-L [Arabidopsis thaliana]
 gb|AEE28392.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=675

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = +3

Query  123  IVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  299
            ++  G+    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV
Sbjct  29   LMNIGAALMSSLAIEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWV  88

Query  300  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  479
             FTD ERLIGEAAKNQAA NPERTIFD KRLIGRKFDD +VQRD+K +PYK+VNKDGKPY
Sbjct  89   AFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPY  148

Query  480  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  659
            IQVK+K GE K+FSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDA
Sbjct  149  IQVKVK-GEEKLFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDA  207

Query  660  GIIAGLNV  683
            G IAGLNV
Sbjct  208  GAIAGLNV  215



>ref|XP_008388543.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=662

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 172/199 (86%), Gaps = 4/199 (2%)
 Frame = +3

Query  96   RRTSLIVFG-IVVFGSLF--AFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  266
            +R   + F  +++F S F    ++A E++ K+GTVIGIDLGTTYSCV VYK+  VEIIAN
Sbjct  4    KRIHALSFAFLLLFVSEFLCGIAVAAEDSPKVGTVIGIDLGTTYSCVAVYKNGHVEIIAN  63

Query  267  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  446
            DQGNRITPSWV FTD ERLIGEAAKNQA  N ERTIFDVKRLIGRKFDD EVQRD+K +P
Sbjct  64   DQGNRITPSWVAFTDTERLIGEAAKNQAPLNAERTIFDVKRLIGRKFDDPEVQRDIKYLP  123

Query  447  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  626
            YK+VNKDGKPYIQVK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYF
Sbjct  124  YKVVNKDGKPYIQVKVK-GETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYF  182

Query  627  NDAQRQATKDAGIIAGLNV  683
            NDAQRQATKDAGIIAGLNV
Sbjct  183  NDAQRQATKDAGIIAGLNV  201



>gb|AAB70400.1| Similar to Arabidopsis luminal binding protein (gb|D89342) [Arabidopsis 
thaliana]
Length=655

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = +3

Query  168  EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQ  347
            E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV FTD ERLIGEAAKNQ
Sbjct  9    EEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQ  68

Query  348  AASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPE  527
            AA NPERTIFD KRLIGRKFDD +VQRD+K +PYK+VNKDGKPYIQVK+K GE K+FSPE
Sbjct  69   AAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVK-GEEKLFSPE  127

Query  528  EISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            EISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG IAGLNV
Sbjct  128  EISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAGLNV  179



>gb|KDO56235.1| hypothetical protein CISIN_1g006194mg [Citrus sinensis]
Length=657

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 165/186 (89%), Gaps = 6/186 (3%)
 Frame = +3

Query  141  LFAFSIAKEEA-----SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGF  305
            LFAF  +   A     +KLGTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV F
Sbjct  13   LFAFEFSLALAAADDATKLGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAF  72

Query  306  TDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQ  485
            TD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDD EVQRD+K +PYKIVNK GKPYIQ
Sbjct  73   TDTERLIGEAAKNQAALNAERTVFDVKRLIGRKFDDPEVQRDIKFLPYKIVNKGGKPYIQ  132

Query  486  VKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGI  665
            VK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAGI
Sbjct  133  VKVK-GETKVFSPEEISAMILQKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGI  191

Query  666  IAGLNV  683
            IAGLNV
Sbjct  192  IAGLNV  197



>ref|XP_010674036.1| PREDICTED: luminal-binding protein 5 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   308 bits (788),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 169/196 (86%), Gaps = 3/196 (2%)
 Frame = +3

Query  105  SLIVFGIVVFGSLFAFSI---AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            +L ++ +++F S F   +   A ++ +  GTVIGIDLGTTYSCVGVYKD  VEIIANDQG
Sbjct  7    NLALYFLLLFVSEFLLGVTVLAADDQTIKGTVIGIDLGTTYSCVGVYKDGHVEIIANDQG  66

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD+ERL GEAAKNQAA NPERTIFDVKRLIGRKF D EVQRDMK++PYK+
Sbjct  67   NRITPSWVAFTDSERLTGEAAKNQAAINPERTIFDVKRLIGRKFSDPEVQRDMKMLPYKV  126

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VN+DGKPYIQVK K+GE KVFSPEE+SAMIL KMKETAE++LG T+K AVVTVPAYFNDA
Sbjct  127  VNRDGKPYIQVKTKEGEVKVFSPEEVSAMILQKMKETAESYLGSTVKHAVVTVPAYFNDA  186

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG IAGLNV
Sbjct  187  QRQATKDAGTIAGLNV  202



>ref|XP_007030985.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY11487.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=659

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 167/188 (89%), Gaps = 2/188 (1%)
 Frame = +3

Query  123  IVVFGSLFAFSIA-KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  299
            + +F S F   IA   + +K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV
Sbjct  11   LFLFISEFFLGIAVAADETKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWV  70

Query  300  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  479
             FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPY
Sbjct  71   AFTDTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPY  130

Query  480  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  659
            IQ+K+K GETKVFSPEEISAM+LTKMKETAEA+LGK IKDAV+TVPAYFNDAQRQATKDA
Sbjct  131  IQIKVK-GETKVFSPEEISAMVLTKMKETAEAYLGKKIKDAVITVPAYFNDAQRQATKDA  189

Query  660  GIIAGLNV  683
            G IAGLNV
Sbjct  190  GTIAGLNV  197



>ref|XP_011088129.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=656

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +3

Query  123  IVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  299
            +++F S F   IA   E+S+  TVIGIDLGTTYSCVGVY+  +++IIANDQGNRITPSWV
Sbjct  11   LLLFASEFLIGIAAAAESSQSQTVIGIDLGTTYSCVGVYRHGKLDIIANDQGNRITPSWV  70

Query  300  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  479
             FTD ERLIGEAAKNQA  NPERTIFDVKRLIGRKFDD EVQRDMK++PYK+V KDGKPY
Sbjct  71   AFTDTERLIGEAAKNQATLNPERTIFDVKRLIGRKFDDPEVQRDMKMLPYKVVVKDGKPY  130

Query  480  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  659
            IQVKIKDGE KVFSPEE+SAMIL KMKETAEA+LGK IK AV+TVPAYFNDAQRQATKDA
Sbjct  131  IQVKIKDGEVKVFSPEEVSAMILQKMKETAEAYLGKKIKRAVITVPAYFNDAQRQATKDA  190

Query  660  GIIAGLNV  683
            G IAGL+V
Sbjct  191  GTIAGLHV  198



>ref|XP_006423186.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
 gb|ESR36426.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
Length=639

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 163/183 (89%), Gaps = 3/183 (2%)
 Frame = +3

Query  141  LFAFSIA--KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN  314
            LFA  +A   +  +KL TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD 
Sbjct  13   LFALRLAAADDTTTKLKTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDT  72

Query  315  ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKI  494
            ERLIGEAAKNQAA NPERTIFDVKRLIG KFDD EVQRD+K +PYK+VNK GKPYIQVK+
Sbjct  73   ERLIGEAAKNQAALNPERTIFDVKRLIGGKFDDPEVQRDIKFLPYKVVNKGGKPYIQVKV  132

Query  495  KDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAG  674
            K GETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAG
Sbjct  133  K-GETKVFSPEEISAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAG  191

Query  675  LNV  683
            LNV
Sbjct  192  LNV  194



>ref|XP_010041040.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=665

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = +3

Query  171  ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQA  350
            + K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERLIGEAAKNQA
Sbjct  33   SPKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQA  92

Query  351  ASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEE  530
            A N ERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSPEE
Sbjct  93   AMNAERTIFDVKRLIGRKFDDAEVQRDIKYLPYKVVNKDGKPYIQVKVK-GETKVFSPEE  151

Query  531  ISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ISAMIL KMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  152  ISAMILGKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGVIAGLNV  202



>ref|XP_006417615.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
 gb|ESQ35968.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
Length=657

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 167/193 (87%), Gaps = 3/193 (2%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFS-IAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  284
            + + + V  SL   S +A E E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRI
Sbjct  6    LAYLVFVTASLVLISSVATEGEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRI  65

Query  285  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  464
            TPSWV FTD ERLIGEAAKNQAA NPERTI D KRL+GRKFDD +VQRD+K +PYK+VNK
Sbjct  66   TPSWVAFTDTERLIGEAAKNQAAKNPERTIHDPKRLMGRKFDDPDVQRDIKFLPYKVVNK  125

Query  465  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  644
            DGKPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQ
Sbjct  126  DGKPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQ  184

Query  645  ATKDAGIIAGLNV  683
            ATKDAG IAGLNV
Sbjct  185  ATKDAGAIAGLNV  197



>ref|XP_006480058.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            +  +L +F +         + A +  +KL TVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNKALAIFFLFALHFSSGLAAADDTTTKLKTVIGIDLGTTYSCVGVYRNDHVEIIANDQG  63

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIG KFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVAFTDTERLIGEAAKNQAALNPERTIFDVKRLIGGKFDDPEVQRDIKFLPYKV  123

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNK GKPYIQVK+K GETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAYFNDA
Sbjct  124  VNKGGKPYIQVKVK-GETKVFSPEEISAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDA  182

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG+IAGLNV
Sbjct  183  QRQATKDAGVIAGLNV  198



>ref|XP_009118328.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b [Brassica rapa]
Length=653

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 166/192 (86%), Gaps = 2/192 (1%)
 Frame = +3

Query  111  IVFGIVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  287
            + + + +   +F  S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRIT
Sbjct  6    LAYLVFMMTLVFMSSVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRIT  65

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PSWV FTD ERLIGEAAKNQAA NPE TIFD KRL+GRKFDD +VQRD+K +PYK+VNKD
Sbjct  66   PSWVAFTDTERLIGEAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKD  125

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
            GKPYIQVK+K GE KVFSPEEISAMIL+KMKETAEAFLGK IKDAV+TVPAYFNDAQRQA
Sbjct  126  GKPYIQVKVK-GEVKVFSPEEISAMILSKMKETAEAFLGKKIKDAVITVPAYFNDAQRQA  184

Query  648  TKDAGIIAGLNV  683
            TKDAG IAGLNV
Sbjct  185  TKDAGAIAGLNV  196



>emb|CDY22648.1| BnaC08g42820D [Brassica napus]
Length=605

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = +3

Query  153  SIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIG  329
            S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRITPSWV FTD ERLIG
Sbjct  3    SVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRITPSWVAFTDTERLIG  62

Query  330  EAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGET  509
            EAAKNQAA NPE TIFD KRL+GRKFDD +VQRD+K +PYK+VNKDGKPYIQVK+K GE 
Sbjct  63   EAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVK-GEV  121

Query  510  KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG IAGLNV
Sbjct  122  KVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAGLNV  179



>emb|CDY06347.1| BnaA09g48560D [Brassica napus]
Length=642

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = +3

Query  138  SLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN  314
            ++F  S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRITPSWV FTD 
Sbjct  35   AVFMSSVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRITPSWVAFTDT  94

Query  315  ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKI  494
            ERLIGEAAKNQAA NPE TIFD KRL+GRKFDD +VQRD+K +PYK+VNKDGKPYIQVK+
Sbjct  95   ERLIGEAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKV  154

Query  495  KDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAG  674
            K GE KVFSPEEISAMIL+KMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG IAG
Sbjct  155  K-GEVKVFSPEEISAMILSKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAG  213

Query  675  LNV  683
            LNV
Sbjct  214  LNV  216



>ref|XP_007206318.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
 gb|EMJ07517.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
Length=657

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 163/184 (89%), Gaps = 1/184 (1%)
 Frame = +3

Query  132  FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTD  311
            F  LF  + A   +SK+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD
Sbjct  13   FLLLFISASAAGGSSKVGTVIGIDLGTTYSCVGVYKNGNVEIIANDQGNRITPSWVAFTD  72

Query  312  NERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVK  491
             ERLIGEAAKNQA  N ERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK
Sbjct  73   TERLIGEAAKNQAPLNAERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVK  132

Query  492  IKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIA  671
            +K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAGIIA
Sbjct  133  VK-GETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGIIA  191

Query  672  GLNV  683
            GLNV
Sbjct  192  GLNV  195



>ref|XP_008246412.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=664

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = +3

Query  123  IVVFGSLFAFSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSW  296
            +++F S F   IA     +SK+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSW
Sbjct  14   LLLFISEFLCGIASAAGGSSKVGTVIGIDLGTTYSCVGVYKNGNVEIIANDQGNRITPSW  73

Query  297  VGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKP  476
            V FTD ERLIGEAAKNQA  N ERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGKP
Sbjct  74   VAFTDTERLIGEAAKNQAPLNAERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKP  133

Query  477  YIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKD  656
            YIQVK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKD
Sbjct  134  YIQVKVK-GETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKD  192

Query  657  AGIIAGLNV  683
            AGIIAGLNV
Sbjct  193  AGIIAGLNV  201



>ref|XP_011092073.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=657

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  123  IVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  302
            +++F S  A +    +   LGTVIGIDLGTTYSCVGVY + +VEIIANDQGNRITPSWV 
Sbjct  11   LLLFVSGIAIAAQDSQNRDLGTVIGIDLGTTYSCVGVYTNGKVEIIANDQGNRITPSWVA  70

Query  303  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  482
            FT+ +RLIGEAAKNQAA NPERT+FDVKRLIGRKFDD +VQRDMK++PY++V+KDGKPY+
Sbjct  71   FTNTDRLIGEAAKNQAALNPERTVFDVKRLIGRKFDDPDVQRDMKMLPYQVVDKDGKPYV  130

Query  483  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  662
            QVK KDGE KVFSPEEISAM+L KMKETAE++LGK + DAVVTVPAYFNDAQRQATKDAG
Sbjct  131  QVKTKDGEVKVFSPEEISAMVLRKMKETAESYLGKKVHDAVVTVPAYFNDAQRQATKDAG  190

Query  663  IIAGLNV  683
             IAGLNV
Sbjct  191  AIAGLNV  197



>gb|KFK43208.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=659

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +3

Query  90   WTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  269
             T ++   +F ++   +L +  + K E   LGTVIGIDLGTTYSCVGVY+++ VEIIAND
Sbjct  3    MTNKSLAYLFFMIAISALMSSEVTKAEEQTLGTVIGIDLGTTYSCVGVYRNKHVEIIAND  62

Query  270  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  449
            QGNRITPSWV FTD+ERLIGEAAKNQA  NPE TI D KR IGR+FDD EVQRD+K +PY
Sbjct  63   QGNRITPSWVAFTDSERLIGEAAKNQATKNPEGTICDPKRFIGRQFDDPEVQRDIKFLPY  122

Query  450  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  629
            K+VNKDGKPY QVK+K GE KVFSPEEISAMILTKMKETAEA+LG  IKDAV+TVPAYFN
Sbjct  123  KVVNKDGKPYFQVKVK-GEKKVFSPEEISAMILTKMKETAEAYLGHKIKDAVITVPAYFN  181

Query  630  DAQRQATKDAGIIAGLNV  683
            DAQRQATKDAG IAGLNV
Sbjct  182  DAQRQATKDAGAIAGLNV  199



>gb|KDP23486.1| hypothetical protein JCGZ_23319 [Jatropha curcas]
Length=662

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = +3

Query  153  SIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGE  332
            ++A +++ KLGTVIGIDLGTTYSCVGV ++  +EIIANDQGNRITPSWV FTD ERLIGE
Sbjct  23   AVAADDSPKLGTVIGIDLGTTYSCVGVSRNGHIEIIANDQGNRITPSWVAFTDTERLIGE  82

Query  333  AAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETK  512
            AAKNQAA NPE T+FDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETK
Sbjct  83   AAKNQAAFNPENTVFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-GETK  141

Query  513  VFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +FSPEEISAM+L KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAG IAGLNV
Sbjct  142  LFSPEEISAMVLGKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGAIAGLNV  198



>gb|KFK43207.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=660

 Score =   303 bits (775),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 164/196 (84%), Gaps = 1/196 (1%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  275
            +  + + F I +  +L +  + K E   LGTVIGIDLGTTYSCVGVY+++ VEIIANDQG
Sbjct  6    KSLAYLFFMIAISAALMSSEVTKAEEQTLGTVIGIDLGTTYSCVGVYRNKHVEIIANDQG  65

Query  276  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  455
            NRITPSWV FTD+ERLIGEAAKNQA  NPE TI D KR IGR+FDD EVQRD+K +PYK+
Sbjct  66   NRITPSWVAFTDSERLIGEAAKNQATKNPEGTICDPKRFIGRQFDDPEVQRDIKFLPYKV  125

Query  456  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  635
            VNKDGKPY QVK+K GE KVFSPEEISAMILTKMKETAEA+LG  IKDAV+TVPAYFNDA
Sbjct  126  VNKDGKPYFQVKVK-GEKKVFSPEEISAMILTKMKETAEAYLGHKIKDAVITVPAYFNDA  184

Query  636  QRQATKDAGIIAGLNV  683
            QRQATKDAG IAGLNV
Sbjct  185  QRQATKDAGAIAGLNV  200



>gb|KJB81015.1| hypothetical protein B456_013G125300 [Gossypium raimondii]
Length=656

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 165/188 (88%), Gaps = 2/188 (1%)
 Frame = +3

Query  123  IVVFGSLFAFSIA-KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  299
            + +F S F   IA     SK+G VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV
Sbjct  11   LFLFISEFLLGIAVASNDSKVGAVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWV  70

Query  300  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  479
             FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPY
Sbjct  71   AFTDSERLIGEAAKNQAALNAERTIFDVKRLIGRKFNDPEVQRDVKFLPYKVVNKDGKPY  130

Query  480  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  659
            IQVK+K GETKVFS EEISAM+LTKMKETAEA+LGK IKDAV+TVPAYFNDAQRQATKDA
Sbjct  131  IQVKVK-GETKVFSAEEISAMVLTKMKETAEAYLGKKIKDAVITVPAYFNDAQRQATKDA  189

Query  660  GIIAGLNV  683
            G IAGLNV
Sbjct  190  GTIAGLNV  197



>emb|CAC37635.1| luminal binding protein, BiP, partial [Scherffelia dubia]
Length=665

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = +3

Query  72   AMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  251
            AMAG    R  + +V  +     L A   A+EEA K+GTVIGIDLGTTYSCVGVYK+ RV
Sbjct  5    AMAG----RGRAFVVSAVCALALLCAVVRAEEEAKKIGTVIGIDLGTTYSCVGVYKNGRV  60

Query  252  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  431
            EIIANDQGNRITPS+V FTDNERLIG+AAKNQA SNPER ++DVKRLIGRKF DK+VQRD
Sbjct  61   EIIANDQGNRITPSYVAFTDNERLIGDAAKNQATSNPERPVYDVKRLIGRKFTDKDVQRD  120

Query  432  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  611
            MKLV Y I++ +GKPYIQV +K GE K FSPEE+SAMIL KMKETAEAFLGKT+K AV T
Sbjct  121  MKLVSYTIIDHNGKPYIQVDVK-GEKKSFSPEEVSAMILVKMKETAEAFLGKTVKHAVXT  179

Query  612  VPAYFNDAQRQATKDAGIIAGLNV  683
            VPAYFNDAQRQATKDAG+IAGL V
Sbjct  180  VPAYFNDAQRQATKDAGVIAGLAV  203



>ref|XP_004302398.1| PREDICTED: luminal-binding protein 4 [Fragaria vesca subsp. vesca]
Length=662

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  93   TRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  272
            TR  SL    + V   L   ++A E +S  GTVIGIDLGTTYSCVGVY++  VEII NDQ
Sbjct  4    TRALSLTFLLLFVSEFLCGIALAAEGSSTPGTVIGIDLGTTYSCVGVYRNGNVEIIVNDQ  63

Query  273  GNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYK  452
            GNRITPSWV FTD ERLIGEAAKNQA  N ERTIFDVKRLIGRKF+D EVQRD+K +PYK
Sbjct  64   GNRITPSWVAFTDTERLIGEAAKNQAPQNAERTIFDVKRLIGRKFNDPEVQRDIKFLPYK  123

Query  453  IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFND  632
            +VNK+GKPYIQVK+K GE KVFSPEEISAMIL+KMKETAEA+LGK I +AVVTVPAYFND
Sbjct  124  VVNKEGKPYIQVKVK-GEDKVFSPEEISAMILSKMKETAEAYLGKKITNAVVTVPAYFND  182

Query  633  AQRQATKDAGIIAGLNV  683
            AQRQATKDAGIIAGLNV
Sbjct  183  AQRQATKDAGIIAGLNV  199



>ref|XP_009766974.1| PREDICTED: luminal-binding protein 5-like [Nicotiana sylvestris]
Length=667

 Score =   300 bits (768),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 165/192 (86%), Gaps = 5/192 (3%)
 Frame = +3

Query  123  IVVFGSLFAFSIA----KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRIT  287
            +++F S F   +     K +   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRIT
Sbjct  16   LLLFVSEFCLEVTLAAEKNQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRIT  75

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PSWV FTD ERLIGEAAKNQAA NPERTI+DVKRLIGRKFDD EVQ+ +K++P+++VNKD
Sbjct  76   PSWVAFTDTERLIGEAAKNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFEVVNKD  135

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
            GKPY+QVKIKDGE K FSPEEISAMIL KMKETAEA+LGK+IK AV+TVPAYFNDAQRQA
Sbjct  136  GKPYVQVKIKDGEVKKFSPEEISAMILQKMKETAEAYLGKSIKHAVITVPAYFNDAQRQA  195

Query  648  TKDAGIIAGLNV  683
            TKDAG IAGLNV
Sbjct  196  TKDAGAIAGLNV  207



>ref|XP_009622355.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Nicotiana tomentosiformis]
Length=668

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 165/192 (86%), Gaps = 5/192 (3%)
 Frame = +3

Query  123  IVVFGSLFAFSIA----KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRIT  287
            +++F S F   +     K +   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRIT
Sbjct  16   LLLFVSEFCLEVTLAAEKNQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRIT  75

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PSWV FTD ERLIGEAAKNQAA NPERTI+DVKRLIGRKFDD EVQ+ +K++P+++VNKD
Sbjct  76   PSWVAFTDTERLIGEAAKNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFEVVNKD  135

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
            GKPY+QVKIKDGE K FSPEEISAMIL KMKETAEA+LGK+IK AV+TVPAYFNDAQRQA
Sbjct  136  GKPYVQVKIKDGEVKKFSPEEISAMILQKMKETAEAYLGKSIKHAVITVPAYFNDAQRQA  195

Query  648  TKDAGIIAGLNV  683
            TKDAG IAGLNV
Sbjct  196  TKDAGAIAGLNV  207



>emb|CDP15493.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 169/205 (82%), Gaps = 2/205 (1%)
 Frame = +3

Query  75   MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQR  248
            MA  +  +  +  +  + V   L   ++A E++ K  LGTVIGIDLGTTYSCVGVY++  
Sbjct  1    MASSSSVKNKAFWLLLLFVSEFLAGVTLAAEDSQKQNLGTVIGIDLGTTYSCVGVYRNGN  60

Query  249  VEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQR  428
            VEIIANDQGNRITPSWV FTD ERLIGEAAKNQAA NPE T+FDVKR IGRKF+D EVQR
Sbjct  61   VEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRKFNDPEVQR  120

Query  429  DMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVV  608
            DMKL+PYK+VNK GKPYI VK+K+GE K+ SPEE+SAM+L +MK+TAE++LGK +K+AVV
Sbjct  121  DMKLLPYKVVNKVGKPYIDVKMKNGEMKLLSPEEVSAMVLQRMKQTAESYLGKEVKNAVV  180

Query  609  TVPAYFNDAQRQATKDAGIIAGLNV  683
            TVPAYFNDAQRQATKDAG IAGLNV
Sbjct  181  TVPAYFNDAQRQATKDAGTIAGLNV  205



>ref|XP_005842772.1| hypothetical protein CHLNCDRAFT_144025, partial [Chlorella variabilis]
 gb|EFN50655.1| hypothetical protein CHLNCDRAFT_144025 [Chlorella variabilis]
Length=310

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +3

Query  168  EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQ  347
            E  KLGTVIGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPS+V FTD ERLIG+AAKNQ
Sbjct  30   EQEKLGTVIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSYVAFTDTERLIGDAAKNQ  89

Query  348  AASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPE  527
            A  NP+RT++DVKRLIGRKF D EVQRD KLV Y IV+K  KPYIQV++  GE+K FSPE
Sbjct  90   ATVNPKRTVYDVKRLIGRKFSDAEVQRDAKLVSYNIVDKQSKPYIQVEVA-GESKSFSPE  148

Query  528  EISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            EISAMILTKMK+TAEAFLGKT+K AVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  149  EISAMILTKMKDTAEAFLGKTVKHAVVTVPAYFNDAQRQATKDAGVIAGLNV  200



>ref|XP_002318993.2| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE94916.2| heat shock protein 70 cognate [Populus trichocarpa]
Length=660

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = +3

Query  141  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  320
                 +A ++  KLGTVIGIDLGTTYSCV V +D  VEIIANDQGNR+TPSWV FTD ER
Sbjct  21   FLGLVVAADDGPKLGTVIGIDLGTTYSCVAVSRDGHVEIIANDQGNRVTPSWVAFTDTER  80

Query  321  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  500
            LIGEAAKNQA  NPERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGK YIQVK+K 
Sbjct  81   LIGEAAKNQAPMNPERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKSYIQVKVK-  139

Query  501  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  680
            GETKVFSPEEISAMIL KMKETAE++LGK IK+AVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  140  GETKVFSPEEISAMILGKMKETAESYLGKKIKNAVVTVPAYFNDAQRQATKDAGIIAGLN  199

Query  681  V  683
            V
Sbjct  200  V  200



>ref|XP_011023674.1| PREDICTED: luminal-binding protein 4-like [Populus euphratica]
Length=660

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = +3

Query  141  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  320
                 +A +   KLGTVIGIDLGTTYSCV V +D  VEIIANDQGNR+TPSWV FTD ER
Sbjct  21   FLGLVVAADGGPKLGTVIGIDLGTTYSCVAVSRDGHVEIIANDQGNRVTPSWVAFTDTER  80

Query  321  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  500
            LIGEAAKNQA  NPERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGK YIQVK+K 
Sbjct  81   LIGEAAKNQAPMNPERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKSYIQVKVK-  139

Query  501  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  680
            GETKVFSPEEISAMIL KMKETAE++LGK IK+AVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  140  GETKVFSPEEISAMILGKMKETAESYLGKKIKNAVVTVPAYFNDAQRQATKDAGIIAGLN  199

Query  681  V  683
            V
Sbjct  200  V  200



>ref|XP_006344666.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Solanum tuberosum]
Length=669

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 170/214 (79%), Gaps = 8/214 (4%)
 Frame = +3

Query  45   RTRAQSDHRAMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSC  224
            R R   D + +A        S    G+ V       +  K++   LGTVIGIDLGTTYSC
Sbjct  2    RMRRSKDFKNLAFLILLLFASEFCLGVTV-------AAEKKQKQNLGTVIGIDLGTTYSC  54

Query  225  VGVYK-DQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGR  401
            VGVYK +  VEIIANDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTI+DVKRLIGR
Sbjct  55   VGVYKGENNVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAALNPERTIYDVKRLIGR  114

Query  402  KFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFL  581
            KFDD EVQ+ +K++P+ IVNKDGKPY++VKIK+G+ KVFSPEEISAMIL KMKETAEA+L
Sbjct  115  KFDDPEVQKIIKMLPFNIVNKDGKPYVEVKIKEGDVKVFSPEEISAMILQKMKETAEAYL  174

Query  582  GKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            GK+IK AV+TVPAYFNDAQRQATKDAG IAGLNV
Sbjct  175  GKSIKHAVITVPAYFNDAQRQATKDAGTIAGLNV  208



>emb|CDP16233.1| unnamed protein product [Coffea canephora]
Length=592

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  117  FGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSW  296
            F I+ F  +F F +       LGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSW
Sbjct  36   FLILYFSWVFFFFLHVYFHQNLGTVIGIDLGTTYSCVGVYRNGNVEIIANDQGNRITPSW  95

Query  297  VGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKP  476
            V FTD ERLIGEAAKNQAA NPE T+FDVKR IGR+ DD EVQRDMKL+PYK+ NKDGKP
Sbjct  96   VAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRRVDDPEVQRDMKLLPYKVANKDGKP  155

Query  477  YIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKD  656
            YI VK+K+ E K+ SPEE+SAM+L +MK+TAE++LGK +K+A++TVPAYFNDAQRQATKD
Sbjct  156  YIDVKMKNSEMKLLSPEEVSAMVLQRMKKTAESYLGKEVKNAIITVPAYFNDAQRQATKD  215

Query  657  AGIIAGLNV  683
            AG IAGLNV
Sbjct  216  AGTIAGLNV  224



>gb|KIY96078.1| heat shock 70kDa protein 5 [Monoraphidium neglectum]
Length=433

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = +3

Query  141  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  320
            +F  ++  +E  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD+ER
Sbjct  18   VFGMAVQAKEEEKLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSER  77

Query  321  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  500
            LIG+AAKNQA  NP+RTI+DVKRLIGRKF+DKEVQRD KL+ Y IV+K GKP +QV +  
Sbjct  78   LIGDAAKNQATVNPKRTIYDVKRLIGRKFEDKEVQRDKKLMSYDIVDKAGKPMVQVDVA-  136

Query  501  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  680
            GE KVFSPEEISAMIL KMK+TAEAFLGK++K AVVTVPAYFNDAQRQATKDAG I+GLN
Sbjct  137  GEKKVFSPEEISAMILQKMKDTAEAFLGKSVKHAVVTVPAYFNDAQRQATKDAGTISGLN  196

Query  681  V  683
            V
Sbjct  197  V  197



>ref|XP_010553728.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37b [Tarenaya hassleriana]
Length=658

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  90   WTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  269
             TRR  L     V   +  +  +   E  KLGTVIGIDLGTTYSCVGV+++  VEIIAND
Sbjct  3    MTRRVFLYFLLFVAASAFMSNLMIDGEEQKLGTVIGIDLGTTYSCVGVFRNGHVEIIAND  62

Query  270  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  449
            QGNRITPSWV FTD+ERLIGEAAKNQAA NPERT+ D KRLIGR+FDD EVQ ++K + Y
Sbjct  63   QGNRITPSWVAFTDSERLIGEAAKNQAAMNPERTVSDAKRLIGRRFDDPEVQGNVKYLSY  122

Query  450  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  629
            K+VNKDGKPYIQ+K+K GE K+FSPEEISAMIL KMKETAEA+LGK IKDAV+TVPAYFN
Sbjct  123  KVVNKDGKPYIQMKVK-GEEKLFSPEEISAMILGKMKETAEAYLGKKIKDAVITVPAYFN  181

Query  630  DAQRQATKDAGIIAGLNV  683
            DAQRQATKDAG IAGLNV
Sbjct  182  DAQRQATKDAGTIAGLNV  199



>ref|XP_004230233.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Solanum lycopersicum]
Length=669

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 158/175 (90%), Gaps = 1/175 (1%)
 Frame = +3

Query  162  KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRITPSWVGFTDNERLIGEAA  338
            K++   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRITPSWV FTD ERLIGEAA
Sbjct  34   KKQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRITPSWVAFTDTERLIGEAA  93

Query  339  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  518
            KNQAA NPERTI+DVKRLIGRKFDD EVQ+ +K++P+ +VNK GKP+++VKIK+G+ KVF
Sbjct  94   KNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFNVVNKAGKPHVEVKIKEGDVKVF  153

Query  519  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            SPEEISAMIL KMKETAEA+LGK+IK AV+TVPAYFNDAQRQATKDAG IAGLNV
Sbjct  154  SPEEISAMILQKMKETAEAYLGKSIKHAVITVPAYFNDAQRQATKDAGTIAGLNV  208



>ref|NP_001051048.1| Os03g0710500 [Oryza sativa Japonica Group]
 gb|AAX95660.1| dnaK protein [Oryza sativa Japonica Group]
 gb|ABF98501.1| Luminal binding protein 5 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12962.1| Os03g0710500 [Oryza sativa Japonica Group]
Length=669

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 170/202 (84%), Gaps = 3/202 (1%)
 Frame = +3

Query  87   AWTRRTSLIV--FGIVVFGSLFAFSIAKEEASKL-GTVIGIDLGTTYSCVGVYKDQRVEI  257
            A  ++++LIV  F ++  G L   +   +   K  G VIGIDLGTTYSCVGVY++  V+I
Sbjct  2    ARDKQSALIVAAFVLLCSGCLCGVADGAKGGRKTKGPVIGIDLGTTYSCVGVYRNGHVDI  61

Query  258  IANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMK  437
            +ANDQGNRITPSWV FTD+ERL+GEAAKNQAA NP+RTIFD+KRLIGR+FDD+EVQRD+K
Sbjct  62   VANDQGNRITPSWVAFTDDERLVGEAAKNQAALNPDRTIFDIKRLIGRRFDDEEVQRDVK  121

Query  438  LVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  617
             +PYK+V+K GKPY++V++K GE KVFSPEEISAMIL KMKETAE++LG+ + DAVVTVP
Sbjct  122  YLPYKVVDKGGKPYVEVRVKAGEVKVFSPEEISAMILAKMKETAESYLGQRVTDAVVTVP  181

Query  618  AYFNDAQRQATKDAGIIAGLNV  683
            AYFNDAQRQATKDAG IAGLNV
Sbjct  182  AYFNDAQRQATKDAGTIAGLNV  203



>ref|XP_006650483.1| PREDICTED: luminal-binding protein 4-like [Oryza brachyantha]
Length=665

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  189  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPER  368
            VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWV FTD+ERL+GEAAKNQAA NP+R
Sbjct  39   VIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNPDR  98

Query  369  TIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL  548
            TIFD+KRLIGR+FDD+EVQRD+K +PYK+V+KDGKPY++V++K GE KVFSPEEISAMIL
Sbjct  99   TIFDIKRLIGRRFDDEEVQRDVKYLPYKVVSKDGKPYVEVRVKGGERKVFSPEEISAMIL  158

Query  549  TKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            TKMKETAE++LG+ + DAVVTVPAYFNDAQRQATKDAG IAGLNV
Sbjct  159  TKMKETAESYLGQRVTDAVVTVPAYFNDAQRQATKDAGTIAGLNV  203



>ref|XP_010027237.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=667

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +3

Query  165  EEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKN  344
            +++ K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERLIGEAAKN
Sbjct  32   DDSPKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKN  91

Query  345  QAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSP  524
            QAA N ERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSP
Sbjct  92   QAAMNAERTIFDVKRLIGRKFDDAEVQRDIKYLPYKVVNKDGKPYIQVKVK-GETKVFSP  150

Query  525  EEISAMILTKMKETAEAFLGKTIKDAVV-TVPAYFNDAQRQATKDAGIIAGLNV  683
            EEISAMIL KMKETAEAFLGK IK  ++  V  YFNDAQRQATKDAGIIAGLNV
Sbjct  151  EEISAMILGKMKETAEAFLGKKIKGCLLGAVANYFNDAQRQATKDAGIIAGLNV  204



>ref|XP_006472125.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like, partial [Citrus sinensis]
Length=435

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  189  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPER  368
            VIGID+GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PER
Sbjct  33   VIGIDMGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPER  92

Query  369  TIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL  548
            TIFDVKRLIG++FDD EVQRD+K +PYK+VNKDGKPY+QV +K GETKVFSPEEISAMIL
Sbjct  93   TIFDVKRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVNVK-GETKVFSPEEISAMIL  151

Query  549  TKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
             KMKETAE FLG  IK+AV+TVPAYFNDAQ+QATKDAGIIAGLNV
Sbjct  152  QKMKETAETFLGMKIKNAVLTVPAYFNDAQKQATKDAGIIAGLNV  196



>emb|CDP16834.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = +3

Query  108  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  287
            L++  +  F +  A +    +   LGTVIGI+LGTTYSCVGVY++  VEII NDQGNRIT
Sbjct  14   LLLLFVSEFLAGIALAAEGTQKQNLGTVIGIELGTTYSCVGVYRNGNVEIIPNDQGNRIT  73

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PSWV FTD ERLIGEAAKNQAA NPE T+FDVKR IGR+ DD EVQRDMKL+PYK+ NKD
Sbjct  74   PSWVAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRRVDDPEVQRDMKLLPYKVANKD  133

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
            GKPYI VK+K+ E K+ SPEE+SAM+L +MK+TAE++LGK +K+A++TVPAYFNDAQRQA
Sbjct  134  GKPYIDVKMKNSEMKLLSPEEVSAMVLQRMKKTAESYLGKEVKNAIITVPAYFNDAQRQA  193

Query  648  TKDAGIIAGLNV  683
            TKDAG IAGLNV
Sbjct  194  TKDAGTIAGLNV  205



>ref|XP_006472126.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like [Citrus sinensis]
 ref|XP_006472127.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like [Citrus sinensis]
Length=503

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  189  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPER  368
            VIGID+GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PER
Sbjct  41   VIGIDMGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPER  100

Query  369  TIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL  548
            TIFDVKRLIG++FDD EVQRD+K +PYK+VNKDGKPY+QVK+K GETKVFSPEEISAM+L
Sbjct  101  TIFDVKRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVKVK-GETKVFSPEEISAMML  159

Query  549  TKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
             KMKETAE FLG  IK+AV+TVPAYFNDAQ+QATKDAGIIAGLNV
Sbjct  160  QKMKETAETFLGMKIKNAVLTVPAYFNDAQKQATKDAGIIAGLNV  204



>ref|XP_005651681.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE27137.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
Length=639

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  180  LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASN  359
            LGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD+ERLIG+AAKNQA +N
Sbjct  11   LGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSERLIGDAAKNQATTN  70

Query  360  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  539
            P+RT++DVKRLIGRKF DKEVQRD K+V YK+V+K  KPY++V I D E K FSPEEISA
Sbjct  71   PDRTVYDVKRLIGRKFKDKEVQRDAKMVSYKVVDKAAKPYVEVTISD-EKKTFSPEEISA  129

Query  540  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            MILTKMK+TAEA+LGKTIK+AVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  130  MILTKMKDTAEAYLGKTIKNAVVTVPAYFNDAQRQATKDAGVIAGLNV  177



>gb|EEC79268.1| hypothetical protein OsI_20053 [Oryza sativa Indica Group]
Length=433

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  186  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  362
            TVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  57   TVIGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  116

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  117  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  176

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGL  677
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL
Sbjct  177  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGL  221



>gb|EEE59790.1| hypothetical protein OsJ_12307 [Oryza sativa Japonica Group]
Length=726

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  183  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  362
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWV FTD+ERL+GEAAKNQAA NP
Sbjct  94   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNP  153

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
            +RTIFD+KRLIGR+FDD+EVQRD+K +PYK+V+K GKPY++V++K GE KVFSPEEISAM
Sbjct  154  DRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVKAGEVKVFSPEEISAM  213

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            IL KMKETAE++LG+ + DAVVTVPAYFNDAQRQATKDAG IAGLNV
Sbjct  214  ILAKMKETAESYLGQRVTDAVVTVPAYFNDAQRQATKDAGTIAGLNV  260



>gb|EYU18532.1| hypothetical protein MIMGU_mgv1a022234mg, partial [Erythranthe 
guttata]
Length=625

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +3

Query  186  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPE  365
            T+IGIDLGTTYSCVGVY+  ++EIIANDQGNRITPSWV FTD ERLIGEAAKNQA+ NPE
Sbjct  1    TIIGIDLGTTYSCVGVYRQGKLEIIANDQGNRITPSWVAFTDTERLIGEAAKNQASLNPE  60

Query  366  RTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKI-KDGETKVFSPEEISAM  542
            RTIFDVKRLIGRKFDD EVQRDMK++PYK+V+KDGK YI+VKI K+GE +VFSPEEISAM
Sbjct  61   RTIFDVKRLIGRKFDDVEVQRDMKMLPYKVVDKDGKAYIEVKINKEGEIRVFSPEEISAM  120

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ILTKMK+TAEA+LG  +  AV+TVPAYFNDAQRQATKDAG IAGL V
Sbjct  121  ILTKMKQTAEAYLGNKVNRAVITVPAYFNDAQRQATKDAGTIAGLQV  167



>ref|XP_002949576.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
 gb|EFJ49128.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
Length=653

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 3/175 (2%)
 Frame = +3

Query  159  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAA  338
            A EE  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD+ERLIG+AA
Sbjct  22   ASEE--KLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSERLIGDAA  79

Query  339  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  518
            KNQA  NP+RTI+DVKRLIGR+F+DKEVQRD KLV Y IV+K GKPY+ V + +GET+VF
Sbjct  80   KNQATVNPKRTIYDVKRLIGRRFEDKEVQRDKKLVSYDIVDKSGKPYVSVDV-NGETRVF  138

Query  519  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            SPEEISAMIL KMKETAEA+LGKT+K AVVTVPAYFNDAQRQATKDAG I+GLNV
Sbjct  139  SPEEISAMILQKMKETAEAYLGKTVKHAVVTVPAYFNDAQRQATKDAGTISGLNV  193



>ref|XP_001701685.1| binding protein 1 [Chlamydomonas reinhardtii]
 gb|EDP06660.1| binding protein 1 [Chlamydomonas reinhardtii]
Length=656

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 2/180 (1%)
 Frame = +3

Query  144  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  323
            + F +  EE  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD ERL
Sbjct  18   YGFGVWAEE-EKLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDEERL  76

Query  324  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  503
            IG+AAKNQA  NP+RT++DVKRLIGRK++DKEVQRD KLV Y IV++ GKPY+ V +K G
Sbjct  77   IGDAAKNQATVNPKRTVYDVKRLIGRKYEDKEVQRDKKLVSYDIVDRQGKPYVAVDVK-G  135

Query  504  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            E KVFSPEEISAMIL KMK+TAEA+LGKT+K AVVTVPAYFNDAQRQATKDAG I+GLNV
Sbjct  136  EQKVFSPEEISAMILQKMKDTAEAYLGKTVKHAVVTVPAYFNDAQRQATKDAGTISGLNV  195



>dbj|BAJ89190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = +3

Query  159  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEA  335
            A  E    GTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV FTD  ERLIGEA
Sbjct  30   APAEGGSTGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAFTDGGERLIGEA  89

Query  336  AKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKV  515
            AKNQAA+NPERTI+D KRLIGR F D  VQRD+KL+PY +V+++GKP+IQV++KDG+ +V
Sbjct  90   AKNQAAANPERTIYDAKRLIGRDFADAVVQRDIKLLPYSVVDRNGKPHIQVQVKDGDVRV  149

Query  516  FSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            FSPEE+SAM+LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  150  FSPEEVSAMVLTRMKETAEAYLGEKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNV  205



>ref|XP_002466589.1| hypothetical protein SORBIDRAFT_01g010460 [Sorghum bicolor]
 gb|EER93587.1| hypothetical protein SORBIDRAFT_01g010460 [Sorghum bicolor]
Length=676

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  183  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  362
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWV FTD ERL+GEAAKNQA  NP
Sbjct  43   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDEERLVGEAAKNQAPLNP  102

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
            +RTIFD+KRLIGR+FDD+EVQRD++ +PYK+VNK GKPY++V +K GE K FSPEEISAM
Sbjct  103  QRTIFDIKRLIGRRFDDEEVQRDVRYLPYKVVNKGGKPYVEVPMKGGERKTFSPEEISAM  162

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            IL+KM+ETAE++LG  + DAVVTVPAYFNDAQRQATKDAG IAGLNV
Sbjct  163  ILSKMRETAESYLGHRVADAVVTVPAYFNDAQRQATKDAGTIAGLNV  209



>gb|EEC83049.1| hypothetical protein OsI_28153 [Oryza sativa Indica Group]
Length=529

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  186  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  362
            TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  133  TVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  192

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  193  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  252

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGL  677
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL
Sbjct  253  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGL  297



>ref|NP_001055613.1| Os05g0428600 [Oryza sativa Japonica Group]
 gb|AAS90667.1| putative Luminal binding protein [Oryza sativa Japonica Group]
 gb|AAV59416.1| putative luminal binding protein 5 [Oryza sativa Japonica Group]
 dbj|BAF17527.1| Os05g0428600 [Oryza sativa Japonica Group]
Length=687

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +3

Query  186  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  362
            TVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  57   TVIGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  116

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  117  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  176

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V
Sbjct  177  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTV  223



>ref|XP_001701884.1| binding protein 2 [Chlamydomonas reinhardtii]
 gb|EDP06859.1| binding protein 2 [Chlamydomonas reinhardtii]
Length=662

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = +3

Query  132  FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTD  311
              S+     A     KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD
Sbjct  16   LASIPQAKAASPTTDKLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTD  75

Query  312  NERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVK  491
             ERLIG+AAKNQA  NP+RTI+DVKRLIGRKF D +VQRD KLV Y IV++ GKPY+ V 
Sbjct  76   EERLIGDAAKNQATVNPKRTIYDVKRLIGRKFSDADVQRDRKLVSYDIVDRQGKPYVAVD  135

Query  492  IKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIA  671
            +K GE KVFSPEEISAMIL KMK+TAEA+LGKT+K AVVTVPAYFNDAQRQATKDAG I+
Sbjct  136  VK-GEQKVFSPEEISAMILQKMKDTAEAYLGKTVKHAVVTVPAYFNDAQRQATKDAGTIS  194

Query  672  GLNV  683
            GLNV
Sbjct  195  GLNV  198



>ref|XP_004964075.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = +3

Query  81   GGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  260
            G  WT   +L+V  +V      A           GTVIGIDLGTTYSCVGVY++  VEII
Sbjct  4    GRVWTLLFALLVADLVAPIHAAAPPHGGGGDKNTGTVIGIDLGTTYSCVGVYRNGHVEII  63

Query  261  ANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMK  437
            ANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NPERTI+D KRLIGR+FDD  VQRDMK
Sbjct  64   ANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANPERTIYDAKRLIGRQFDDAVVQRDMK  123

Query  438  LVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  617
            L+PY +V+++GKP+++V+++DG+ + FSPEE+SAM+LTKMKETAEA+LG+ +  AVVTVP
Sbjct  124  LLPYAVVDRNGKPHVRVQVRDGDVREFSPEEVSAMVLTKMKETAEAYLGEKVTHAVVTVP  183

Query  618  AYFNDAQRQATKDAGIIAGLNV  683
            AYFNDAQRQATKDAG+IAGL V
Sbjct  184  AYFNDAQRQATKDAGVIAGLTV  205



>ref|XP_007509232.1| heat shock protein 70 [Bathycoccus prasinos]
 emb|CCO19689.1| heat shock protein 70 [Bathycoccus prasinos]
Length=263

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 155/192 (81%), Gaps = 7/192 (4%)
 Frame = +3

Query  126  VVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGF  305
            V F  L   + A +   KLGTVIGIDLGTTYSCVG Y + +VEIIANDQGNRITPS+V F
Sbjct  9    VSFVLLLLSAFADDSGEKLGTVIGIDLGTTYSCVGAYVNGKVEIIANDQGNRITPSYVAF  68

Query  306  TDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQ  485
            TD ERLIG+AAKNQA SNP RT+FD KRLIGRK+ DK+VQRD+K+ P+K+VNK+ KP I+
Sbjct  69   TDTERLIGDAAKNQATSNPTRTVFDAKRLIGRKYSDKDVQRDLKMFPFKVVNKESKPCIE  128

Query  486  VKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP------AYFNDAQRQA  647
            V +K+G+ KVF  EEISAM+L KMKETAE +LGK IK+AVVTVP      AYFNDAQRQA
Sbjct  129  VDLKEGK-KVFQAEEISAMVLVKMKETAEGYLGKQIKNAVVTVPAYFSFLAYFNDAQRQA  187

Query  648  TKDAGIIAGLNV  683
            TKDAG IAGLNV
Sbjct  188  TKDAGTIAGLNV  199



>ref|XP_005829514.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
 gb|EKX42534.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
Length=662

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +3

Query  90   WTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  269
            +TRR+  + F      +L    +   E  ++ T IGIDLGTTYSCVGVYK+ +VEIIAND
Sbjct  2    FTRRS--VAF-FAACAALVCLGVRAAEEGQVDTTIGIDLGTTYSCVGVYKNGKVEIIAND  58

Query  270  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  449
            QGNRITPSWV FTD+ERLIG+AAKNQ A NPE T+FDVKRLIGRK+ D  VQ D KL+PY
Sbjct  59   QGNRITPSWVAFTDDERLIGDAAKNQGALNPENTVFDVKRLIGRKYTDTTVQHDKKLLPY  118

Query  450  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  629
             IV++ GKPY+QVK + GE K +SPEEISAM+LTKMKETAEAFLGK IK+AVVTVPAYFN
Sbjct  119  DIVDQGGKPYVQVKFR-GEKKTYSPEEISAMVLTKMKETAEAFLGKEIKNAVVTVPAYFN  177

Query  630  DAQRQATKDAGIIAGLNV  683
            DAQRQATKDAG I+GLNV
Sbjct  178  DAQRQATKDAGTISGLNV  195



>ref|XP_004971898.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = +3

Query  81   GGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  260
            G  WT   +L+V  +V      A           GTVIGIDLGTTYSCVGVY++  VEII
Sbjct  4    GRVWTLLFALLVADLVAPIHAAAPPHGGGGDKNTGTVIGIDLGTTYSCVGVYRNGHVEII  63

Query  261  ANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMK  437
            ANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NPERTI+D KRLIGR+FDD  VQRDMK
Sbjct  64   ANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANPERTIYDAKRLIGRQFDDAVVQRDMK  123

Query  438  LVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  617
            L+PY +V+++GKP+++V+++DG+ + FSPEE+SAM+LTKMKETAEA+LG+ +  AVVTVP
Sbjct  124  LLPYAVVDRNGKPHMRVQVRDGDVREFSPEEVSAMVLTKMKETAEAYLGEKVTHAVVTVP  183

Query  618  AYFNDAQRQATKDAGIIAGLNV  683
            AYFNDAQRQATKDAG+IAGL V
Sbjct  184  AYFNDAQRQATKDAGVIAGLTV  205



>ref|XP_002507118.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
 gb|ACO68376.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
Length=660

 Score =   279 bits (714),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 162/192 (84%), Gaps = 4/192 (2%)
 Frame = +3

Query  108  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  287
            +  F  VV   L   + A+E + +LGTVIGIDLGTTYSCVGVY + +VEIIANDQGNRIT
Sbjct  11   IYAFATVV---LLQGTKAEESSEQLGTVIGIDLGTTYSCVGVYVNGKVEIIANDQGNRIT  67

Query  288  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  467
            PS+V FTD ERLIG+AAKNQA +NP RT+FD KRLIGRK+ DKEVQRDMK+ P+K+VNKD
Sbjct  68   PSYVAFTDGERLIGDAAKNQATANPTRTVFDAKRLIGRKYTDKEVQRDMKMFPFKVVNKD  127

Query  468  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  647
             KP I+V++K+G+ K F  EEISAM+LTKMKETAEA+LGK IK+AVVTVPAYFNDAQRQA
Sbjct  128  SKPCIEVELKEGK-KTFQAEEISAMVLTKMKETAEAYLGKDIKNAVVTVPAYFNDAQRQA  186

Query  648  TKDAGIIAGLNV  683
            TKDAG I+GLNV
Sbjct  187  TKDAGTISGLNV  198



>ref|XP_003074861.1| Bip Luminal binding protein precursor, probable (IC) [Ostreococcus 
tauri]
Length=663

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 163/198 (82%), Gaps = 3/198 (2%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIAND  269
            RR +L     V+F +  A     E  +    GTVIGIDLGTTYSCVG Y + +VEIIAND
Sbjct  9    RRLTLCTLLAVIFAAACAPQGRAESTTSEITGTVIGIDLGTTYSCVGAYVNGKVEIIAND  68

Query  270  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  449
            QGNRITPS+V FTD ERLIG++AKNQA++NP RT+FD KRLIGRKF DKEVQRD+K+ P+
Sbjct  69   QGNRITPSYVAFTDTERLIGDSAKNQASANPTRTVFDAKRLIGRKFTDKEVQRDLKMFPF  128

Query  450  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  629
            KIV+KD KP I++++KDG+ K+F  EEISAM+LTKMKETAEA+LGK IK+AVVTVPAYFN
Sbjct  129  KIVDKDSKPCIEIELKDGK-KIFQAEEISAMVLTKMKETAEAYLGKDIKNAVVTVPAYFN  187

Query  630  DAQRQATKDAGIIAGLNV  683
            DAQRQATKDAGIIAGLNV
Sbjct  188  DAQRQATKDAGIIAGLNV  205



>ref|XP_004986284.1| PREDICTED: luminal-binding protein 4-like [Setaria italica]
Length=679

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  171  ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQA  350
            AS  G VIGIDLGTTYSCVG Y++  V+IIANDQGNRITPSWV FTD+ERL+GEAAKNQA
Sbjct  38   ASASGPVIGIDLGTTYSCVGAYQNGHVDIIANDQGNRITPSWVAFTDDERLVGEAAKNQA  97

Query  351  ASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEE  530
              NP+RTIFD+KRLIGR+FDD+EVQRD++ +PYK+VN+ GKPY++V +K GE K FSPEE
Sbjct  98   PLNPQRTIFDIKRLIGRRFDDEEVQRDIRYLPYKVVNRGGKPYVEVPMKGGERKAFSPEE  157

Query  531  ISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            ISAMIL+KM+ETAE++LG+ +  AVVTVPAYFNDAQRQATKDAG IAGL V
Sbjct  158  ISAMILSKMRETAESYLGRRVAGAVVTVPAYFNDAQRQATKDAGTIAGLTV  208



>emb|CEG00952.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=656

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 163/198 (82%), Gaps = 3/198 (2%)
 Frame = +3

Query  96   RRTSLIVFGIVVFGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIAND  269
            RR +L     V+F +  A     E  +    GTVIGIDLGTTYSCVG Y + +VEIIAND
Sbjct  2    RRLTLCTLLAVIFAAACAPQGRAESTTSEITGTVIGIDLGTTYSCVGAYVNGKVEIIAND  61

Query  270  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  449
            QGNRITPS+V FTD ERLIG++AKNQA++NP RT+FD KRLIGRKF DKEVQRD+K+ P+
Sbjct  62   QGNRITPSYVAFTDTERLIGDSAKNQASANPTRTVFDAKRLIGRKFTDKEVQRDLKMFPF  121

Query  450  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  629
            KIV+KD KP I++++KDG+ K+F  EEISAM+LTKMKETAEA+LGK IK+AVVTVPAYFN
Sbjct  122  KIVDKDSKPCIEIELKDGK-KIFQAEEISAMVLTKMKETAEAYLGKDIKNAVVTVPAYFN  180

Query  630  DAQRQATKDAGIIAGLNV  683
            DAQRQATKDAGIIAGLNV
Sbjct  181  DAQRQATKDAGIIAGLNV  198



>ref|NP_001061194.1| Os08g0197700 [Oryza sativa Japonica Group]
 dbj|BAD03698.1| putative Luminal binding protein 5 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF23108.1| Os08g0197700 [Oryza sativa Japonica Group]
Length=676

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +3

Query  186  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  362
            TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  45   TVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  104

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  105  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  164

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V
Sbjct  165  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTV  211



>ref|XP_006433439.1| hypothetical protein CICLE_v10003341mg, partial [Citrus clementina]
 gb|ESR46679.1| hypothetical protein CICLE_v10003341mg, partial [Citrus clementina]
Length=502

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  204  LGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDV  383
            +GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PERTIFDV
Sbjct  1    MGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPERTIFDV  60

Query  384  KRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKE  563
            KRLIG++FDD EVQRD+K +PYK+VNKDGKPY+QV +K GETKVFSPEEISAMIL KMKE
Sbjct  61   KRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVNVK-GETKVFSPEEISAMILQKMKE  119

Query  564  TAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            TAE FLG  IK+AV+TVPAYFNDAQRQATKDAGIIAGLNV
Sbjct  120  TAETFLGMKIKNAVLTVPAYFNDAQRQATKDAGIIAGLNV  159



>ref|XP_004971892.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  183  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASN  359
            GTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+N
Sbjct  38   GTVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAAN  97

Query  360  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  539
            PERTI+D KRLIGR+FDD  VQRDMKL+PY +V+++GKP+++V+++DG+ + FSPEE+SA
Sbjct  98   PERTIYDAKRLIGRQFDDAVVQRDMKLLPYAVVDRNGKPHMRVQVRDGDVREFSPEEVSA  157

Query  540  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            M+LTKMKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V
Sbjct  158  MVLTKMKETAEAYLGEKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTV  205



>ref|XP_006433443.1| hypothetical protein CICLE_v10003511mg, partial [Citrus clementina]
 gb|ESR46683.1| hypothetical protein CICLE_v10003511mg, partial [Citrus clementina]
Length=521

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  204  LGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDV  383
            +GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PERTIFDV
Sbjct  1    MGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPERTIFDV  60

Query  384  KRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKE  563
            KRLIG++FDD EVQRD+K +PYKIVNKDGKPY+QVK+K GETKVFSPEEISAM+L KMKE
Sbjct  61   KRLIGKRFDDAEVQRDIKFLPYKIVNKDGKPYVQVKVK-GETKVFSPEEISAMMLQKMKE  119

Query  564  TAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            TAE FLG  IK+AV+TVPAYFNDAQ+QATKDAGIIAGLNV
Sbjct  120  TAETFLGMKIKNAVLTVPAYFNDAQKQATKDAGIIAGLNV  159



>ref|XP_002977324.1| hypothetical protein SELMODRAFT_417280 [Selaginella moellendorffii]
 gb|EFJ21328.1| hypothetical protein SELMODRAFT_417280 [Selaginella moellendorffii]
Length=654

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  183  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  362
             T IGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPSWV FT+NERLIGEAAKNQA SNP
Sbjct  24   ATSIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSWVAFTENERLIGEAAKNQATSNP  83

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
             RTI DVKRLIG K+DDKEVQRDMK + +KIVNKDGKPYI+V++  G+TK++SPEEISAM
Sbjct  84   TRTIHDVKRLIGMKYDDKEVQRDMKHLGFKIVNKDGKPYIEVEVS-GKTKIYSPEEISAM  142

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +LTKMKETAEA+LG+ + DAV+TVPAYFNDAQR AT DAG IAGLNV
Sbjct  143  VLTKMKETAEAYLGEKVTDAVITVPAYFNDAQRGATSDAGRIAGLNV  189



>ref|XP_002971962.1| hypothetical protein SELMODRAFT_412732 [Selaginella moellendorffii]
 gb|EFJ26879.1| hypothetical protein SELMODRAFT_412732 [Selaginella moellendorffii]
Length=654

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  183  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  362
             T IGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPSWV FT+NERLIGEAAKNQA SNP
Sbjct  24   ATSIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSWVAFTENERLIGEAAKNQATSNP  83

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
             RTI DVKRLIG K+DDKEVQRDMK + +KIVNKDGKPYI+V++  G+TK++SPEEISAM
Sbjct  84   TRTIHDVKRLIGMKYDDKEVQRDMKHLGFKIVNKDGKPYIEVEVS-GKTKIYSPEEISAM  142

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +LTKMKETAEA+LG+ + DAV+TVPAYFNDAQR AT DAG IAGLNV
Sbjct  143  VLTKMKETAEAYLGEKVTDAVITVPAYFNDAQRGATSDAGRIAGLNV  189



>ref|XP_003055985.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH59361.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=659

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 163/195 (84%), Gaps = 5/195 (3%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  278
            R+ L++F      +L   +  +E   +LGTVIGIDLGTTYSCVGVY + +VEIIANDQGN
Sbjct  7    RSLLVIF----LATLVGAANGQEATEQLGTVIGIDLGTTYSCVGVYVNGKVEIIANDQGN  62

Query  279  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  458
            RITPS+V FTD+ERLIG+AAKNQA +NP RT+FD KRLIGRKF DKEVQRD+K+ P+K+V
Sbjct  63   RITPSYVAFTDSERLIGDAAKNQATANPTRTVFDAKRLIGRKFTDKEVQRDVKMFPFKVV  122

Query  459  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  638
            NKD KP I+V +K+G+ KVF  EEISAM+L KMKETAEA+LGK IK+AVVTVPAYFNDAQ
Sbjct  123  NKDSKPCIEVDLKEGK-KVFQAEEISAMVLVKMKETAEAYLGKEIKNAVVTVPAYFNDAQ  181

Query  639  RQATKDAGIIAGLNV  683
            RQATKDAG I+G+NV
Sbjct  182  RQATKDAGTISGMNV  196



>gb|EIE87053.1| heat shock 70 kDa protein, partial [Rhizopus delemar RA 99-880]
Length=271

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = +3

Query  99   RTSLIVFGIVVFGSLFAFSI--AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  272
            + SL+     +F    A ++  A E+    GTVIGIDLGTTYSCV V K+ RVEIIANDQ
Sbjct  4    KASLLALFAFIFTLFIASNVVEAAEDKESYGTVIGIDLGTTYSCVAVQKNGRVEIIANDQ  63

Query  273  GNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYK  452
            G+RITPS+V FTD+ERLIG+AAKNQ ++NP RT+FD KRLIGR+++DKEVQ+DMK  P+ 
Sbjct  64   GHRITPSYVAFTDDERLIGDAAKNQYSANPRRTVFDAKRLIGRRYEDKEVQQDMKHFPFD  123

Query  453  IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFND  632
            +V+++G P+IQV +K GE +VF+PEEIS M+LTKMKETAEA+LGK +  AVVTVPAYFND
Sbjct  124  VVSRNGAPHIQVPVK-GEDRVFTPEEISGMVLTKMKETAEAYLGKPVTHAVVTVPAYFND  182

Query  633  AQRQATKDAGIIAGLNV  683
            AQRQATKDAG IAGL +
Sbjct  183  AQRQATKDAGTIAGLTI  199



>ref|XP_006644572.1| PREDICTED: luminal-binding protein 5-like [Oryza brachyantha]
Length=679

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +3

Query  186  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  362
            TVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  52   TVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  111

Query  363  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  542
            ERTI+D KRLIGR+F D EVQ+DMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  112  ERTIYDAKRLIGRQFADAEVQQDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  171

Query  543  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V
Sbjct  172  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLRV  218



>ref|XP_005539525.1| luminal binding protein BiP [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83489.1| luminal binding protein BiP [Cyanidioschyzon merolae strain 10D]
Length=687

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 168/211 (80%), Gaps = 7/211 (3%)
 Frame = +3

Query  66   HRAMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASK-----LGTVIGIDLGTTYSCVG  230
            +R ++   W     L+     +FG   A  +  ++AS       G VIGIDLGTTYSCVG
Sbjct  8    YRRVSIWNWALVAVLVHVCCCLFGR--AVLVGAKDASSGGGKIEGPVIGIDLGTTYSCVG  65

Query  231  VYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFD  410
            V+K+ +VEIIAN+QGNRITPS+V FTD ERLIG+AAKNQ A NPERTIFDVKRLIGR+FD
Sbjct  66   VFKNGKVEIIANEQGNRITPSYVAFTDKERLIGDAAKNQLALNPERTIFDVKRLIGRRFD  125

Query  411  DKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKT  590
            ++ VQ+D+KL+PYK+VNKDGKPYI+V+++DGE K FSPEEISAMIL KMK+ AE +LGK 
Sbjct  126  EETVQKDIKLLPYKVVNKDGKPYIRVEVRDGEVKTFSPEEISAMILGKMKKIAEDYLGKP  185

Query  591  IKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            +K+AVVTVPAYFNDAQRQATKDAG IAGL V
Sbjct  186  VKNAVVTVPAYFNDAQRQATKDAGTIAGLTV  216



>dbj|BAK06498.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score =   276 bits (707),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  183  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASN  359
            G VIGIDLGTTYSCV VY++ RVEIIANDQGNRITPSWV FTD+ ERLIGEAAKNQAA+N
Sbjct  39   GPVIGIDLGTTYSCVAVYRNGRVEIIANDQGNRITPSWVAFTDSGERLIGEAAKNQAAAN  98

Query  360  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  539
            P RT++D KRLIGR+F D EVQRDMKL+P+K+V+K+GKP+++V++K G+ + FSPEE+SA
Sbjct  99   PLRTVYDAKRLIGRQFIDAEVQRDMKLLPFKVVDKNGKPHVEVEVKAGDVRTFSPEEVSA  158

Query  540  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            M+LT+MKETAEA+LG+ ++DAV+T+PAYFNDAQRQATKDAG IAGLNV
Sbjct  159  MVLTRMKETAEAYLGEKVRDAVITIPAYFNDAQRQATKDAGAIAGLNV  206



>gb|KDD73887.1| heat shock protein 70 Hsp70 [Helicosporidium sp. ATCC 50920]
Length=651

 Score =   276 bits (706),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 158/193 (82%), Gaps = 1/193 (1%)
 Frame = +3

Query  105  SLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  284
            +     +V   +  AF+  +E+   +GTVIGIDLGTTYSCVGVYK+ +VEII NDQGNRI
Sbjct  2    AFFCLAVVALCAGTAFAKEEEKKENVGTVIGIDLGTTYSCVGVYKNGKVEIIPNDQGNRI  61

Query  285  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  464
            TPS+V FTD ERLIG+AAKNQA SNP+RTI+DVKRLIGR F+D  VQRDMKLV Y +VN 
Sbjct  62   TPSYVAFTDGERLIGDAAKNQATSNPKRTIYDVKRLIGRDFNDANVQRDMKLVSYDLVNN  121

Query  465  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  644
             GKPY+ V++ + E K+FSPEE+SAMILTKMK+TAE +LGK +  AVVTVPAYFNDAQRQ
Sbjct  122  GGKPYVSVEV-NKEVKMFSPEEVSAMILTKMKQTAEDYLGKAVTHAVVTVPAYFNDAQRQ  180

Query  645  ATKDAGIIAGLNV  683
            ATKDAG+IAGLN+
Sbjct  181  ATKDAGVIAGLNI  193



>ref|XP_003565461.1| PREDICTED: luminal-binding protein 2-like [Brachypodium distachyon]
Length=671

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  183  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASN  359
            G VIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD+ ERLIGEAAKNQAASN
Sbjct  43   GPVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDSGERLIGEAAKNQAASN  102

Query  360  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  539
            P RTI+D KRLIGR++ D EV +DMK +PYKIV K GKP+++V++KDG+ +  SPEE+SA
Sbjct  103  PLRTIYDAKRLIGRQYGDAEVHKDMKHLPYKIVEKRGKPHMEVEVKDGDVRTLSPEEVSA  162

Query  540  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            M+LT+MKETAEAFLG+ +KDAV+T+PAYFNDAQRQATKDAG IAGLNV
Sbjct  163  MVLTRMKETAEAFLGEPVKDAVITIPAYFNDAQRQATKDAGAIAGLNV  210



>dbj|BAC67670.1| Heat shock 70 kDa protein [Cyanidioschyzon merolae]
Length=775

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 164/203 (81%), Gaps = 7/203 (3%)
 Frame = +3

Query  90   WTRRTSLIVFGIVVFGSLFAFSIAKEEASK-----LGTVIGIDLGTTYSCVGVYKDQRVE  254
            W     L+     +FG   A  +  ++AS       G VIGIDLGTTYSCVGV+K+ +VE
Sbjct  104  WALVAVLVHVCCCLFGR--AVLVGAKDASSGGGKIEGPVIGIDLGTTYSCVGVFKNGKVE  161

Query  255  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  434
            IIAN+QGNRITPS+V FTD ERLIG+AAKNQ A NPERTIFDVKRLIGR+FD++ VQ+D+
Sbjct  162  IIANEQGNRITPSYVAFTDKERLIGDAAKNQLALNPERTIFDVKRLIGRRFDEETVQKDI  221

Query  435  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  614
            KL+PYK+VNKDGKPYI+V+++DGE K FSPEEISAMIL KMK+ AE +LGK +K+AVVTV
Sbjct  222  KLLPYKVVNKDGKPYIRVEVRDGEVKTFSPEEISAMILGKMKKIAEDYLGKPVKNAVVTV  281

Query  615  PAYFNDAQRQATKDAGIIAGLNV  683
            PAYFNDAQRQATKDAG IAGL V
Sbjct  282  PAYFNDAQRQATKDAGTIAGLTV  304



>ref|XP_002456746.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
 gb|EES01866.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
Length=667

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 168/210 (80%), Gaps = 12/210 (6%)
 Frame = +3

Query  78   AGGAWTRRTSLIVFGIVVFGSLFAFSIAK-------EEASKLGTVIGIDLGTTYSCVGVY  236
            A G WT+    ++F ++V G L   +  +       E     GTVIGIDLGTTYSCVGVY
Sbjct  3    ARGGWTK----LLFALLVAGLLPVVAPTRTYAAAAAEGGGARGTVIGIDLGTTYSCVGVY  58

Query  237  KDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDD  413
            ++ RVEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NPERTI+D KRLIGR+FDD
Sbjct  59   RNGRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANPERTIYDAKRLIGRQFDD  118

Query  414  KEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTI  593
              VQRDMKL+ Y +V ++GKP+++V++++G+ +  SPEE+SAM+LTKMKETAEA+LG+ +
Sbjct  119  AVVQRDMKLLSYDVVERNGKPHVRVQVREGDVRELSPEEVSAMVLTKMKETAEAYLGEKV  178

Query  594  KDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
             DAVVTVPAYF+DAQRQATKDAG IAGLNV
Sbjct  179  TDAVVTVPAYFDDAQRQATKDAGTIAGLNV  208



>ref|XP_003867956.1| Ssa2 HSP70 chaperone, partial [Candida orthopsilosis Co 90-125]
 emb|CCG22520.1| Ssa2 HSP70 chaperone, partial [Candida orthopsilosis]
Length=211

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +3

Query  180  LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASN  359
            +   +GIDLGTTYSCV  Y + RVEIIANDQGNR TPS+V FTD ERLIG+AAKNQAA N
Sbjct  1    MSKAVGIDLGTTYSCVAHYANDRVEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAIN  60

Query  360  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  539
            P  T+FD KRLIGRKFDD EVQ D+K  P+KIV+K GKP IQV+ K GETKVF+PEEIS+
Sbjct  61   PANTVFDAKRLIGRKFDDAEVQNDLKHFPFKIVDKGGKPNIQVEYK-GETKVFTPEEISS  119

Query  540  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  683
            M+L KMKETAE +LG T+KDAVVTVPAYFND+QRQATKDAG+IAGLNV
Sbjct  120  MVLGKMKETAEGYLGGTVKDAVVTVPAYFNDSQRQATKDAGLIAGLNV  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880