BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049M05

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010654405.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   3e-44   Vitis vinifera
ref|XP_010273891.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    165   4e-44   Nelumbo nucifera [Indian lotus]
emb|CAN69528.1|  hypothetical protein VITISV_027246                     166   4e-44   Vitis vinifera
ref|XP_010273890.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    165   5e-44   Nelumbo nucifera [Indian lotus]
emb|CBI35831.3|  unnamed protein product                                163   1e-43   Vitis vinifera
emb|CDO97819.1|  unnamed protein product                                157   2e-41   Coffea canephora [robusta coffee]
ref|XP_010261746.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    155   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_002276214.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    146   3e-37   Vitis vinifera
ref|XP_006342938.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    144   1e-36   
ref|XP_009359705.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    144   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_011072621.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    144   2e-36   
ref|XP_011072618.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    143   2e-36   
ref|XP_011072620.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    143   2e-36   Sesamum indicum [beniseed]
ref|XP_008337819.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    143   3e-36   Malus domestica [apple tree]
ref|XP_010318480.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    141   1e-35   Solanum lycopersicum
ref|XP_010089666.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       136   6e-34   Morus notabilis
ref|XP_007012566.1|  Fatty acid biosynthesis 1 isoform 1                134   5e-33   
gb|AIL53811.1|  beta-ketoacyl-[acyl carrier protein] synthase II        129   4e-31   Gossypium hirsutum [American cotton]
gb|KJB82972.1|  hypothetical protein B456_013G222600                    127   6e-31   Gossypium raimondii
gb|KJB82969.1|  hypothetical protein B456_013G222600                    128   7e-31   Gossypium raimondii
gb|KHG18322.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    128   8e-31   Gossypium arboreum [tree cotton]
gb|KJB82971.1|  hypothetical protein B456_013G222600                    127   1e-30   Gossypium raimondii
gb|ADK23940.1|  KASII                                                   127   1e-30   Gossypium hirsutum [American cotton]
gb|AGH32917.1|  ketoacyl-ACP synthase II                                126   3e-30   Camellia chekiangoleosa
ref|XP_009337174.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    125   4e-30   Pyrus x bretschneideri [bai li]
gb|KDP33964.1|  hypothetical protein JCGZ_07535                         125   5e-30   Jatropha curcas
ref|XP_007204195.1|  hypothetical protein PRUPE_ppa003597mg             125   5e-30   Prunus persica
ref|XP_008242279.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    125   5e-30   Prunus mume [ume]
gb|ABJ90469.2|  beta-ketoacyl-ACP synthase II                           125   5e-30   Jatropha curcas
ref|XP_009337172.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    125   6e-30   Pyrus x bretschneideri [bai li]
ref|XP_008378994.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    123   2e-29   
ref|XP_008338300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   2e-29   
ref|XP_010939870.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    123   3e-29   Elaeis guineensis
ref|XP_010939869.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    122   1e-28   Elaeis guineensis
gb|ACJ07142.1|  beta-ketoacyl-ACP synthase II-1                         117   8e-27   Arachis hypogaea [goober]
ref|XP_010937286.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    113   2e-25   Elaeis guineensis
ref|XP_010937287.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   2e-25   Elaeis guineensis
ref|XP_008782971.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   3e-25   Phoenix dactylifera
ref|XP_007217714.1|  hypothetical protein PRUPE_ppa004479mg             112   3e-25   
ref|XP_010937284.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   3e-25   Elaeis guineensis
ref|XP_010937285.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   4e-25   
ref|XP_010047453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   4e-25   Eucalyptus grandis [rose gum]
gb|KHG11339.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    112   4e-25   Gossypium arboreum [tree cotton]
ref|XP_008782961.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   5e-25   Phoenix dactylifera
ref|XP_008782980.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   5e-25   Phoenix dactylifera
gb|KJB65356.1|  hypothetical protein B456_010G091400                    111   1e-24   Gossypium raimondii
ref|XP_008228351.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    109   4e-24   Prunus mume [ume]
ref|XP_008784350.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    107   4e-23   Phoenix dactylifera
gb|AAB37271.1|  beta-ketoacyl-ACP synthase II                           100   7e-21   Cuphea wrightii
ref|XP_010932371.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  99.0    2e-20   Elaeis guineensis
emb|CBI27767.3|  unnamed protein product                              98.6    2e-20   Vitis vinifera
gb|AAF26738.2|AF220453_1  beta-ketoacyl-ACP synthase II               99.0    2e-20   Elaeis guineensis
ref|XP_010932373.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  99.0    2e-20   Elaeis guineensis
ref|XP_010533238.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  98.6    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_010539937.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  98.2    5e-20   
gb|ACQ41833.1|  beta-ketoacyl-ACP synthase II                         97.1    9e-20   Elaeis oleifera
ref|XP_010932374.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  95.5    3e-19   Elaeis guineensis
ref|XP_010932370.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  95.9    3e-19   Elaeis guineensis
ref|XP_010932372.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  95.5    3e-19   Elaeis guineensis
ref|XP_010049368.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  93.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_006843870.1|  hypothetical protein AMTR_s00007p00265100        92.8    4e-18   
gb|KDO73819.1|  hypothetical protein CISIN_1g008146mg                 87.8    3e-17   Citrus sinensis [apfelsine]
gb|KDO73818.1|  hypothetical protein CISIN_1g008146mg                 87.8    6e-17   Citrus sinensis [apfelsine]
gb|KDO73817.1|  hypothetical protein CISIN_1g008146mg                 87.4    1e-16   Citrus sinensis [apfelsine]
gb|KDO73816.1|  hypothetical protein CISIN_1g008146mg                 87.0    2e-16   Citrus sinensis [apfelsine]
gb|KDO73815.1|  hypothetical protein CISIN_1g008146mg                 87.4    2e-16   Citrus sinensis [apfelsine]
gb|KDO73811.1|  hypothetical protein CISIN_1g008146mg                 87.4    2e-16   Citrus sinensis [apfelsine]
ref|XP_006452865.1|  hypothetical protein CICLE_v10007846mg           87.4    2e-16   Citrus clementina [clementine]
ref|XP_010687531.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  85.9    6e-16   Beta vulgaris subsp. vulgaris [field beet]
emb|CAC59946.1|  beta-ketoacyl-ACP synthase IV                        85.9    7e-16   Cuphea lanceolata
ref|XP_011039936.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  82.8    7e-15   Populus euphratica
ref|XP_002516228.1|  46 kDa ketoavyl-ACP synthase                     82.8    8e-15   Ricinus communis
ref|XP_011093876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  82.4    9e-15   Sesamum indicum [beniseed]
ref|XP_002889002.1|  hypothetical protein ARALYDRAFT_476635           81.6    2e-14   
ref|XP_006474686.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  81.6    2e-14   Citrus sinensis [apfelsine]
gb|EYU28306.1|  hypothetical protein MIMGU_mgv1a004039mg              80.9    4e-14   Erythranthe guttata [common monkey flower]
emb|CDP03046.1|  unnamed protein product                              79.7    7e-14   Coffea canephora [robusta coffee]
gb|AAC68860.1|  3-ketoacyl-ACP synthase                               79.0    2e-13   Cuphea avigera var. pulcherrima
gb|AAL91174.1|  putative 3-ketoacyl-ACP synthase                      76.6    8e-13   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25822.1|  hypothetical protein MIMGU_mgv1a004003mg              76.6    8e-13   Erythranthe guttata [common monkey flower]
ref|NP_565097.1|  3-oxoacyl-[acyl-carrier-protein] synthase II        76.6    9e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAD55280.1|AC008263_11  Similar to gb|AF060519 3-ketoacyl-ACP ...  76.6    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324139.2|  hypothetical protein POPTR_0018s07450g           76.6    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009104733.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  75.1    3e-12   Brassica rapa
ref|XP_010554926.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  73.2    1e-11   
ref|XP_006300437.1|  hypothetical protein CARUB_v10020101mg           72.8    2e-11   Capsella rubella
gb|AAC68861.1|  3-ketoacyl-ACP synthase                               72.8    2e-11   Cuphea hookeriana
ref|XP_011460975.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  72.4    2e-11   Fragaria vesca subsp. vesca
ref|NP_001289900.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006390366.1|  hypothetical protein EUTSA_v10018368mg           72.0    3e-11   Eutrema salsugineum [saltwater cress]
emb|CDX68154.1|  BnaA07g21940D                                        70.9    6e-11   
emb|CDX85866.1|  BnaC06g22680D                                        70.9    7e-11   
gb|AGC65509.1|  keto acyl-acyl carrier protein synthase II            70.5    1e-10   Carthamus tinctorius
gb|KCW81914.1|  hypothetical protein EUGRSUZ_C03291                   69.7    2e-10   Eucalyptus grandis [rose gum]
gb|AGG36014.1|  beta-ketoacyl-ACP synthase II                         64.3    3e-10   Jatropha curcas
gb|AGG36015.1|  beta-ketoacyl-ACP synthase II                         63.9    4e-10   Jatropha curcas
ref|XP_009380020.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  68.6    4e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011467455.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  67.0    1e-09   Fragaria vesca subsp. vesca
ref|XP_004305765.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  67.0    1e-09   Fragaria vesca subsp. vesca
ref|XP_011467454.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  67.0    1e-09   Fragaria vesca subsp. vesca
gb|AGG36013.1|  beta-ketoacyl-ACP synthase II                         62.8    1e-09   Jatropha platyphylla
ref|NP_001290396.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...  65.9    3e-09   Camelina sativa [gold-of-pleasure]
gb|AGG35992.1|  beta-ketoacyl-ACP synthase II                         61.2    4e-09   Jatropha curcas
gb|AGG35991.1|  beta-ketoacyl-ACP synthase II                         60.8    5e-09   Jatropha curcas
gb|AGG35993.1|  beta-ketoacyl-ACP synthase II                         60.8    5e-09   Jatropha curcas
ref|XP_011006167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  60.8    1e-07   Populus euphratica
gb|AAA33872.1|  chloroplast beta-ketoacyl-ACP synthase precursor      60.5    2e-07   Ricinus communis
gb|AAB37270.1|  beta-ketoacyl-ACP synthase II                         59.3    4e-07   Cuphea wrightii
emb|CDX73128.1|  BnaC06g35760D                                        59.3    4e-07   
ref|XP_010459588.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  58.2    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010459587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  58.2    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010498339.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  57.8    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010498338.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  57.8    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010477132.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  57.4    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010477131.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  57.4    2e-06   Camelina sativa [gold-of-pleasure]
gb|KHG27960.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...  57.4    2e-06   Gossypium arboreum [tree cotton]
emb|CDY45409.1|  BnaA07g31890D                                        57.0    3e-06   Brassica napus [oilseed rape]
gb|AIL53812.1|  beta-ketoacyl-[acyl carrier protein] synthase II      56.6    3e-06   Gossypium hirsutum [American cotton]
ref|XP_010428495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  55.8    7e-06   Camelina sativa [gold-of-pleasure]
gb|KJB27218.1|  hypothetical protein B456_004G285300                  55.1    1e-05   Gossypium raimondii
gb|KJB27220.1|  hypothetical protein B456_004G285300                  55.1    1e-05   Gossypium raimondii
gb|KJB27217.1|  hypothetical protein B456_004G285300                  54.7    1e-05   Gossypium raimondii
gb|KJB27216.1|  hypothetical protein B456_004G285300                  54.7    1e-05   Gossypium raimondii
gb|EPS61225.1|  hypothetical protein M569_13573                       54.3    2e-05   Genlisea aurea
ref|XP_004169836.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  52.8    5e-05   
ref|XP_004144052.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  52.4    7e-05   Cucumis sativus [cucumbers]
ref|XP_009106152.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  52.4    8e-05   Brassica rapa
ref|XP_008450963.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  52.0    1e-04   Cucumis melo [Oriental melon]
gb|AAC04692.1|  beta-ketoacyl-ACP synthase II                         50.8    3e-04   Perilla frutescens [beefsteak-mint]
ref|XP_010104609.1|  3-oxoacyl-[acyl-carrier-protein] synthase II     50.4    4e-04   
ref|XP_009390876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  50.4    4e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_010654405.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Vitis vinifera]
Length=564

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 108/151 (72%), Gaps = 11/151 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRR--KRTLAWSGN----LG  360
            M ASSVASPLCTWLVAACMS ACEKDH  KS S+FQ+P+ L R  KR L  S        
Sbjct  1    MAASSVASPLCTWLVAACMSVACEKDHPLKS-SMFQTPKRLSRWAKRRLQCSNGGVDYFS  59

Query  361  GGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL----PFFGDNALSLFGFKLAPVNRRQ  528
             G++SS YGS IH LMSSC AFEPC+ Y +SKGL     FFGDN  SLFG K +P+N RQ
Sbjct  60   SGWISSFYGSSIHNLMSSCLAFEPCEAYSSSKGLSSSLAFFGDNGFSLFGSKPSPMNHRQ  119

Query  529  RRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            RRMN+AAHS K MAVAV+P  E  +KKKP+T
Sbjct  120  RRMNRAAHSDKNMAVAVKPAAEVTAKKKPLT  150



>ref|XP_010273891.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=565

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 105/149 (70%), Gaps = 12/149 (8%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP----RWLRRKRTL----AWSGN  354
            M ASSVASPLCTWLVAACMS A EK++  K PS FQS     RW  R++ +    A   +
Sbjct  1    MAASSVASPLCTWLVAACMSVAYEKEYSLK-PSSFQSSKRLSRWAMRRKLVSKCSAGGHD  59

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL---PFFGDNALSLFGFKLAPVNRR  525
              G  +S+  GS I GLMSSC AFEPC+EYY+SKGL    FFGDN  SLFG +  P+ RR
Sbjct  60   FPGNLISAFCGSSIQGLMSSCLAFEPCEEYYSSKGLSSLAFFGDNGFSLFGSRNGPMTRR  119

Query  526  QRRMNKAAHSGKTMAVAVQPEKEALSKKK  612
            QRRMN++AHSGKTMAVAVQP KE  +KKK
Sbjct  120  QRRMNRSAHSGKTMAVAVQPAKEVTTKKK  148



>emb|CAN69528.1| hypothetical protein VITISV_027246 [Vitis vinifera]
Length=664

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 108/151 (72%), Gaps = 11/151 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP----RWLRRKRTLAWSG--NLG  360
            M ASSVASPLCTWLVAACMS ACEKDH  KS S+FQ+P    RW +R+   +  G     
Sbjct  1    MAASSVASPLCTWLVAACMSVACEKDHPLKS-SMFQTPKRLSRWAKRRLQCSNGGVDYFS  59

Query  361  GGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL----PFFGDNALSLFGFKLAPVNRRQ  528
             G++SS YGS IH LMSSC AFEPC+ Y +SKGL     FFGDN  SLFG K +PVN RQ
Sbjct  60   SGWISSFYGSSIHNLMSSCLAFEPCEAYSSSKGLSSSLAFFGDNGFSLFGSKPSPVNHRQ  119

Query  529  RRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            RRMN+AAHS K MAVAV+P  E  +KKKP+T
Sbjct  120  RRMNRAAHSDKNMAVAVKPAAEVTAKKKPLT  150



>ref|XP_010273890.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=612

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 105/149 (70%), Gaps = 12/149 (8%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP----RWLRRKRTL----AWSGN  354
            M ASSVASPLCTWLVAACMS A EK++  K PS FQS     RW  R++ +    A   +
Sbjct  1    MAASSVASPLCTWLVAACMSVAYEKEYSLK-PSSFQSSKRLSRWAMRRKLVSKCSAGGHD  59

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL---PFFGDNALSLFGFKLAPVNRR  525
              G  +S+  GS I GLMSSC AFEPC+EYY+SKGL    FFGDN  SLFG +  P+ RR
Sbjct  60   FPGNLISAFCGSSIQGLMSSCLAFEPCEEYYSSKGLSSLAFFGDNGFSLFGSRNGPMTRR  119

Query  526  QRRMNKAAHSGKTMAVAVQPEKEALSKKK  612
            QRRMN++AHSGKTMAVAVQP KE  +KKK
Sbjct  120  QRRMNRSAHSGKTMAVAVQPAKEVTTKKK  148



>emb|CBI35831.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 104/145 (72%), Gaps = 17/145 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSS  378
            M ASSVASPLCTWLVAACMS ACEKDH  KS S+FQ+P+ L R            G++SS
Sbjct  1    MAASSVASPLCTWLVAACMSVACEKDHPLKS-SMFQTPKRLSR------------GWISS  47

Query  379  LYGSGIHGLMSSCFAFEPCQEYYNSKGL----PFFGDNALSLFGFKLAPVNRRQRRMNKA  546
             YGS IH LMSSC AFEPC+ Y +SKGL     FFGDN  SLFG K +P+N RQRRMN+A
Sbjct  48   FYGSSIHNLMSSCLAFEPCEAYSSSKGLSSSLAFFGDNGFSLFGSKPSPMNHRQRRMNRA  107

Query  547  AHSGKTMAVAVQPEKEALSKKKPIT  621
            AHS K MAVAV+P  E  +KKKP+T
Sbjct  108  AHSDKNMAVAVKPAAEVTAKKKPLT  132



>emb|CDO97819.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 106/151 (70%), Gaps = 10/151 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRR-----KRTLAWSGNLGG  363
            M+ASSVASPLCTWLVAACMSA+CEKDH  K PSIF+  R L R     K  +    N GG
Sbjct  1    MMASSVASPLCTWLVAACMSASCEKDHFLKLPSIFRCSRRLSRSARRRKVVVPQFLNAGG  60

Query  364  -GFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLP----FFGDNALSLFGFKLAPVNRRQ  528
             G VSS   SGI   ++SC  FEPC+EYYNS+GL      F +NA SLFG K  PV RRQ
Sbjct  61   AGLVSSFCASGIQNWLNSCLTFEPCEEYYNSEGLASSLSCFSENAFSLFGHKAEPVTRRQ  120

Query  529  RRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            RRMN+AA SGK MAVAV+P+K+ ++KKK +T
Sbjct  121  RRMNRAAISGKAMAVAVKPQKDTIAKKKSLT  151



>ref|XP_010261746.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010261747.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nelumbo nucifera]
Length=565

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 102/151 (68%), Gaps = 12/151 (8%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAW--SGNLGGG--  366
            M ASSV+SPLCTWLVAACMS ACEK+H  K PS+F S + L R        S   GGG  
Sbjct  1    MAASSVSSPLCTWLVAACMSVACEKEHSPK-PSLFMSSKRLSRWARRRRIVSKCSGGGDD  59

Query  367  ----FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNALSLFGFKLAPVNRR  525
                 +SS  GS I GLMSSC AFEPC++YY+SKG   L  FGDN  SLF  K  P+ RR
Sbjct  60   FPRNLISSFCGSSIQGLMSSCLAFEPCEKYYSSKGISSLTLFGDNGFSLFSSKNGPMTRR  119

Query  526  QRRMNKAAHSGKTMAVAVQPEKEALSKKKPI  618
            Q+R+N+A HSGK MAVAVQP KE  +KKKP+
Sbjct  120  QKRINRATHSGKAMAVAVQPAKEVATKKKPL  150



>ref|XP_002276214.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
 ref|XP_010656091.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
Length=555

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 99/144 (69%), Gaps = 14/144 (10%)
 Frame = +1

Query  217  ASPLCTWLVAACMSAACEKDHRGKSPSIFQSP----RWLRRKRTLAWSGNLG-GGFVSSL  381
            ASPLCTWLVAACMS   + +   K PS+ Q      RW +R+R LA   +   GG +SS 
Sbjct  3    ASPLCTWLVAACMSVTADNEFAPK-PSMVQCSKRLSRWGKRRRVLAQCSDFARGGSISS-  60

Query  382  YGSGIHGLMSSCFAFEPCQEYYNSKGLP---FFGDNALS-LFGFKLAPVNRRQRRMNKAA  549
                I GL+SSC AFEPC +Y +SKGLP   FFGDNALS +FG K  P+NRRQRR N+ +
Sbjct  61   ---SIQGLVSSCLAFEPCDQYCSSKGLPYSAFFGDNALSSVFGSKSLPLNRRQRRTNRGS  117

Query  550  HSGKTMAVAVQPEKEALSKKKPIT  621
            HSG+TMAVAVQP KE  +KKKP+T
Sbjct  118  HSGETMAVAVQPAKEVTTKKKPLT  141



>ref|XP_006342938.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum tuberosum]
Length=561

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 101/151 (67%), Gaps = 18/151 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWL----RRKRTLAW--SGNLG  360
            MVASSVASPLCTWLVAACMS + EKD   K  S FQS + +    RR++ +    SG+L 
Sbjct  1    MVASSVASPLCTWLVAACMSVSSEKDQFWKPASNFQSSKLMGRSGRRRKAITKCNSGSLM  60

Query  361  GGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLP-----FFGDNALSLFGFKLAPVNRR  525
             G   S+  S  H    +CF FEPC+EYY S+GL       F +NA S+FGFK  P+NRR
Sbjct  61   NG---SVMNSSWH----TCFGFEPCEEYYKSEGLSASFSSLFAENAFSVFGFKQVPLNRR  113

Query  526  QRRMNKAAHSGKTMAVAVQPEKEALSKKKPI  618
            QRRM+ AAHSGK +AVAVQP  EA +KKKP+
Sbjct  114  QRRMSSAAHSGKPVAVAVQPAMEATAKKKPL  144



>ref|XP_009359705.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=558

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 99/150 (66%), Gaps = 15/150 (10%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS----PRWLRRKRT----LAWSGN  354
            M ASSVASPLCTWLVAACMS  C++D   + PS+  S    P+   R+R      ++SG 
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDRDCSAR-PSMLSSSRRRPKCAGRRRLPSKCSSFSGE  59

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVNRRQR  531
               G +S+  GS I GLMSSC AFEPC EYY+SKGL   G N L SLFG      NRRQR
Sbjct  60   FQKGLISAFSGSSIQGLMSSCLAFEPCDEYYSSKGLSSLGCNGLSSLFG-----SNRRQR  114

Query  532  RMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            R N A++SG+TMAVAVQP +E   +KKP+T
Sbjct  115  RFNGASYSGETMAVAVQPTEELTKQKKPLT  144



>ref|XP_011072621.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Sesamum indicum]
Length=551

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 98/147 (67%), Gaps = 7/147 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRK-RTLAWSGNLGGGFVS  375
            +VASSVASPLCTWLVAACM+A  EK    K     + P+ L R  R  +      G  VS
Sbjct  2    VVASSVASPLCTWLVAACMTAPSEKGTFCKPSEFIKCPKKLSRSARRKSMVAQKSGSLVS  61

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGL----PFFGDNALSL-FGFKLAPVNRRQRRMN  540
            SLYG GI+ LMS C  FEPC+EYYNS+GL      FG+N  SL FG K  P+NR+QRR+N
Sbjct  62   SLYGCGINSLMSFC-PFEPCEEYYNSQGLSPCFALFGENGFSLLFGSKTLPMNRKQRRLN  120

Query  541  KAAHSGKTMAVAVQPEKEALSKKKPIT  621
            +A++SGKTM V VQPEK+   KKK +T
Sbjct  121  QASNSGKTMVVGVQPEKQVSMKKKLVT  147



>ref|XP_011072618.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=571

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 98/147 (67%), Gaps = 7/147 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRK-RTLAWSGNLGGGFVS  375
            +VASSVASPLCTWLVAACM+A  EK    K     + P+ L R  R  +      G  VS
Sbjct  2    VVASSVASPLCTWLVAACMTAPSEKGTFCKPSEFIKCPKKLSRSARRKSMVAQKSGSLVS  61

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGL----PFFGDNALSL-FGFKLAPVNRRQRRMN  540
            SLYG GI+ LMS C  FEPC+EYYNS+GL      FG+N  SL FG K  P+NR+QRR+N
Sbjct  62   SLYGCGINSLMSFC-PFEPCEEYYNSQGLSPCFALFGENGFSLLFGSKTLPMNRKQRRLN  120

Query  541  KAAHSGKTMAVAVQPEKEALSKKKPIT  621
            +A++SGKTM V VQPEK+   KKK +T
Sbjct  121  QASNSGKTMVVGVQPEKQVSMKKKLVT  147



>ref|XP_011072620.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=567

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 98/147 (67%), Gaps = 7/147 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRK-RTLAWSGNLGGGFVS  375
            +VASSVASPLCTWLVAACM+A  EK    K     + P+ L R  R  +      G  VS
Sbjct  2    VVASSVASPLCTWLVAACMTAPSEKGTFCKPSEFIKCPKKLSRSARRKSMVAQKSGSLVS  61

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGL----PFFGDNALSL-FGFKLAPVNRRQRRMN  540
            SLYG GI+ LMS C  FEPC+EYYNS+GL      FG+N  SL FG K  P+NR+QRR+N
Sbjct  62   SLYGCGINSLMSFC-PFEPCEEYYNSQGLSPCFALFGENGFSLLFGSKTLPMNRKQRRLN  120

Query  541  KAAHSGKTMAVAVQPEKEALSKKKPIT  621
            +A++SGKTM V VQPEK+   KKK +T
Sbjct  121  QASNSGKTMVVGVQPEKQVSMKKKLVT  147



>ref|XP_008337819.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Malus domestica]
 ref|XP_008337821.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Malus domestica]
Length=558

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 100/150 (67%), Gaps = 15/150 (10%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS----PRWLRRKRT----LAWSGN  354
            M ASSVASPLCTWLVAACMS  C++D   + PS+  S    P+   R+R      ++SG+
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDRDCSAR-PSMLSSSRRRPKCAGRRRLPSKCSSFSGD  59

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVNRRQR  531
               G +S+  GS I GLMSSC AFEPC EYY+SKGL   G N L SLFG      NRRQR
Sbjct  60   FQKGLISAFSGSSIQGLMSSCLAFEPCDEYYSSKGLSSLGCNGLSSLFG-----SNRRQR  114

Query  532  RMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            + N A++SG+TMAVAVQP +E   +KKP+T
Sbjct  115  QFNGASYSGETMAVAVQPTEELTKQKKPLT  144



>ref|XP_010318480.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum lycopersicum]
Length=558

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 96/148 (65%), Gaps = 15/148 (10%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKR---TLAWSGNLGGGF  369
            MVASS+ASPLCTWLVAACMS + EKD   K  S FQS +++ R+R   T   SG+L    
Sbjct  1    MVASSLASPLCTWLVAACMSVSSEKDQFSKPASSFQSSKFMGRRRKAITKFKSGSL----  56

Query  370  VSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLP-----FFGDNALSLFGFKLAPVNRRQRR  534
               + GS ++    +CF FEPC+EYY S G        F +N  S+FGFK  P+NRRQRR
Sbjct  57   ---MNGSVMNTSWHNCFGFEPCEEYYKSDGFSASFSSLFAENPFSVFGFKQVPLNRRQRR  113

Query  535  MNKAAHSGKTMAVAVQPEKEALSKKKPI  618
            M+ AAH GK MAVAVQP  EA + KKP+
Sbjct  114  MSSAAHPGKPMAVAVQPAMEATTMKKPL  141



>ref|XP_010089666.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
 gb|EXB38185.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
Length=557

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 90/140 (64%), Gaps = 3/140 (2%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            AS+VASPLCTWLVAACMS  C  DH   +PS+         +R    +   G  F ++L 
Sbjct  4    ASTVASPLCTWLVAACMSVTCGGDHP-STPSLASKRLNRWARRRRISAAKCGAEFKTALM  62

Query  385  -GSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALS-LFGFKLAPVNRRQRRMNKAAHSG  558
             GS I GLMSSC AFEPC EYYNS GL   G N  S LF  K    NRRQRR+N+A HSG
Sbjct  63   RGSSIQGLMSSCLAFEPCNEYYNSNGLSSLGCNGFSSLFRSKTGSSNRRQRRINRANHSG  122

Query  559  KTMAVAVQPEKEALSKKKPI  618
            +T+AVAVQP +E  S+KKP+
Sbjct  123  ETVAVAVQPAEEVTSRKKPV  142



>ref|XP_007012566.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012567.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012568.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012569.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012571.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30185.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30186.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30187.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30188.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30190.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
Length=575

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 97/163 (60%), Gaps = 24/163 (15%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP----------RWLRRKRTLAWS  348
            M +SS+ASPLCTWLVAACMS  C KD + +SP +  SP          RW R +R    S
Sbjct  1    MASSSLASPLCTWLVAACMSVTCGKD-QSQSP-MLHSPASSSSSKRLGRWARNRRKALIS  58

Query  349  -------GNLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGF  501
                    N  GG +SS  GS I GLM+SC AFEPC +YY+SK    FG N    S FG 
Sbjct  59   QCCGSSTSNRNGGLISSFCGSSIQGLMASCLAFEPCNDYYSSKNGSLFGQNGSFSSFFGS  118

Query  502  KLAPV--NRRQRRMNK-AAHSGKTMAVAVQPEKEALSKKKPIT  621
            K  P   NR+ RR+N+ A HSG+ MAVAVQP +E  +KKKP T
Sbjct  119  KNIPFNNNRKHRRLNRGAVHSGEAMAVAVQPTREITTKKKPPT  161



>gb|AIL53811.1| beta-ketoacyl-[acyl carrier protein] synthase II [Gossypium hirsutum]
Length=576

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 96/162 (59%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP--------RWLRRKRTLAWSGN  354
            M +SS+ASPLCTWLVAACMS    KD + +SP    S         RW R +R    S  
Sbjct  2    MASSSLASPLCTWLVAACMSVTYGKD-QSRSPLFNSSASASSNRLGRWARNRRKALLSQC  60

Query  355  LGGG--------FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGFK  504
             GGG         +SS  GS I GLM+SC AFEPC +YY+SK   FFG N    S FG K
Sbjct  61   CGGGATPNKDVGLISSFRGSTIQGLMASCLAFEPCNDYYSSKNGSFFGQNGSFSSFFGSK  120

Query  505  LAPV--NRRQRRMN-KAAHSGKTMAVAVQPEKEALSKKKPIT  621
              P   NR+Q+R+N +A HSG+ MA+AVQP +E  +KKKP T
Sbjct  121  TVPFNNNRKQKRLNRRAHHSGQAMAIAVQPTREITTKKKPPT  162



>gb|KJB82972.1| hypothetical protein B456_013G222600 [Gossypium raimondii]
Length=451

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 95/162 (59%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP--------RWLRRKRTLAWSGN  354
            M +SS+ASPLCTWLVAACMS    KD + +SP    S         RW R +R    S  
Sbjct  2    MASSSLASPLCTWLVAACMSVTYGKD-QSRSPLFNSSASASSNRLGRWARNRRKALLSQC  60

Query  355  LGGG--------FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGFK  504
             GGG         +SS  GS I GLM+SC AFEPC +YY+SK   FFG N    S FG K
Sbjct  61   CGGGATPNKDVGLISSFRGSTIQGLMASCLAFEPCNDYYSSKNGSFFGQNGSFSSFFGSK  120

Query  505  LAPV--NRRQRRMN-KAAHSGKTMAVAVQPEKEALSKKKPIT  621
              P   NR+Q+R+N +A HSG  MA+AVQP +E  +KKKP T
Sbjct  121  TVPFNNNRKQKRLNRRAHHSGHAMAIAVQPTREITTKKKPPT  162



>gb|KJB82969.1| hypothetical protein B456_013G222600 [Gossypium raimondii]
Length=576

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 95/162 (59%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP--------RWLRRKRTLAWSGN  354
            M +SS+ASPLCTWLVAACMS    KD + +SP    S         RW R +R    S  
Sbjct  2    MASSSLASPLCTWLVAACMSVTYGKD-QSRSPLFNSSASASSNRLGRWARNRRKALLSQC  60

Query  355  LGGG--------FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGFK  504
             GGG         +SS  GS I GLM+SC AFEPC +YY+SK   FFG N    S FG K
Sbjct  61   CGGGATPNKDVGLISSFRGSTIQGLMASCLAFEPCNDYYSSKNGSFFGQNGSFSSFFGSK  120

Query  505  LAPV--NRRQRRMN-KAAHSGKTMAVAVQPEKEALSKKKPIT  621
              P   NR+Q+R+N +A HSG  MA+AVQP +E  +KKKP T
Sbjct  121  TVPFNNNRKQKRLNRRAHHSGHAMAIAVQPTREITTKKKPPT  162



>gb|KHG18322.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic -like 
protein [Gossypium arboreum]
Length=576

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 96/162 (59%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP--------RWLRRKRTLAWSGN  354
            M +SS+ASPLCTWLVAACMS    KD + +SP    S         RW R +R    S  
Sbjct  2    MASSSLASPLCTWLVAACMSVTYGKD-QSRSPLFNSSASASSNRLGRWARNRRKALLSQC  60

Query  355  LGGG--------FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGFK  504
             GGG         +SS  GS I GLM+SC AFEPC +YY+SK   FFG N    S FG K
Sbjct  61   CGGGATPNKDVGLISSFRGSTIQGLMASCLAFEPCDDYYSSKNGSFFGQNGSFSSFFGSK  120

Query  505  LAPV--NRRQRRMN-KAAHSGKTMAVAVQPEKEALSKKKPIT  621
              P   NR+Q+R+N +A HSG+ MA+AVQP +E  +KKKP T
Sbjct  121  NVPFNKNRKQKRLNRRAHHSGQAMAIAVQPTREITTKKKPPT  162



>gb|KJB82971.1| hypothetical protein B456_013G222600 [Gossypium raimondii]
Length=545

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 95/162 (59%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP--------RWLRRKRTLAWSGN  354
            M +SS+ASPLCTWLVAACMS    KD + +SP    S         RW R +R    S  
Sbjct  2    MASSSLASPLCTWLVAACMSVTYGKD-QSRSPLFNSSASASSNRLGRWARNRRKALLSQC  60

Query  355  LGGG--------FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGFK  504
             GGG         +SS  GS I GLM+SC AFEPC +YY+SK   FFG N    S FG K
Sbjct  61   CGGGATPNKDVGLISSFRGSTIQGLMASCLAFEPCNDYYSSKNGSFFGQNGSFSSFFGSK  120

Query  505  LAPV--NRRQRRMN-KAAHSGKTMAVAVQPEKEALSKKKPIT  621
              P   NR+Q+R+N +A HSG  MA+AVQP +E  +KKKP T
Sbjct  121  TVPFNNNRKQKRLNRRAHHSGHAMAIAVQPTREITTKKKPPT  162



>gb|ADK23940.1| KASII [Gossypium hirsutum]
Length=576

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 95/162 (59%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP--------RWLRRKRTLAWSGN  354
            M +SS+ASPLCTWLVAACMS    KD + +SP    S         RW R +R    S  
Sbjct  2    MASSSLASPLCTWLVAACMSVTYGKD-QSRSPLFNSSASASSNRLGRWARNRRKALLSQC  60

Query  355  LGGG--------FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGFK  504
             GGG         +SS  GS I GLM+SC AFEPC +YY+SK   FFG N    S FG K
Sbjct  61   CGGGATPNKDVGLISSFRGSTIQGLMASCLAFEPCDDYYSSKNGSFFGQNGSFSSFFGSK  120

Query  505  LAPV--NRRQRRMN-KAAHSGKTMAVAVQPEKEALSKKKPIT  621
              P   NR Q+R+N +A HSG+ MA+AVQP +E  +KKKP T
Sbjct  121  NVPFNKNREQKRLNRRAHHSGQAMAIAVQPTREITTKKKPPT  162



>gb|AGH32917.1| ketoacyl-ACP synthase II [Camellia chekiangoleosa]
Length=564

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 96/157 (61%), Gaps = 23/157 (15%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS-------PRWLRRKRTLA-----  342
            M ASSV   +CTWLVAACMS ACEK  + +   +  +        RW R++R L+     
Sbjct  1    MAASSV---VCTWLVAACMSVACEKGQQQQPMMMMMNQSSSMRFSRWARKRRVLSKCRAG  57

Query  343  WSGNLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL---PFFGDNALS-LFGFKLA  510
             SG   G  +SS    GI GLMSS   FEPC EYY+SKGL    FFGDN  S LFG    
Sbjct  58   CSGIPKGRLISS----GIQGLMSSYLPFEPCDEYYSSKGLCSSDFFGDNGFSSLFGSTNV  113

Query  511  PVNRRQRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            P++RRQRR N+A HSG+ MAVAV+P KE  ++KKP T
Sbjct  114  PLSRRQRRFNRAVHSGEAMAVAVRPAKEVTARKKPPT  150



>ref|XP_009337174.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=482

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 93/148 (63%), Gaps = 7/148 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS---PRWLRRK---RTLAWSGNLG  360
            M ASSVASPLCTWLVAACMS  C++D   ++  +  S   P+   R+   +  ++SG   
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDRDCSPRASMLSSSRRRPKCAGRRLPSKCSSFSGEFQ  60

Query  361  GGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRM  537
             G +S+  GS I GLMSSC AFEPC EYY+S+           SLFG K    NRRQR  
Sbjct  61   KGLISAFSGSSIQGLMSSCLAFEPCDEYYSSRGLSSLGCSGLSSLFGSKYGASNRRQRCF  120

Query  538  NKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            + AA+SG+TMAVAVQP +E   +KKP+T
Sbjct  121  DGAAYSGETMAVAVQPTEELTKQKKPLT  148



>gb|KDP33964.1| hypothetical protein JCGZ_07535 [Jatropha curcas]
Length=572

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 93/171 (54%), Gaps = 43/171 (25%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP-------RWLRRKRTLAWSGN-  354
            M ++S ASPLCTWLVAACMS  C K++R  +P  F S        RW RR++TL    N 
Sbjct  1    MGSASFASPLCTWLVAACMSVTCAKENR-TAPHAFHSSQPSNRLSRWARRRKTLHAQYNS  59

Query  355  ----------------------LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPF  468
                                  L    VS+L GS   GLMSSC AFEPC +YY+S GL  
Sbjct  60   DSSNSIAAGGGGGGGGGYSTEFLSNSLVSTLCGSSFQGLMSSCLAFEPCSQYYSSNGL--  117

Query  469  FGDNALSLFGFKLAPVNRRQRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
                      F+   +NR+QRR+N+ A SG+ MA+AVQPEKE  +KKKP T
Sbjct  118  ----------FRSRNLNRKQRRLNRLALSGEAMAIAVQPEKEVATKKKPAT  158



>ref|XP_007204195.1| hypothetical protein PRUPE_ppa003597mg [Prunus persica]
 gb|EMJ05394.1| hypothetical protein PRUPE_ppa003597mg [Prunus persica]
Length=563

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 91/150 (61%), Gaps = 10/150 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS----PRWLRRKRT----LAWSGN  354
            M ASSVASPLCTWLVAACMS  C+ D   + PS+  S    P+   R+R      ++S +
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDGDCSTR-PSMLSSSKRRPKCAARRRLPSKCSSFSAD  59

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYY-NSKGLPFFGDNALSLFGFKLAPVNRRQR  531
               G  S+  GS I GLMSSC AFEPC EYY +        +   SLFG K    NRRQR
Sbjct  60   FQKGLNSAFSGSSIQGLMSSCLAFEPCDEYYSSKGLSSLGSNGLSSLFGSKTGTTNRRQR  119

Query  532  RMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            R + AAHSG+TMAVAVQP +E   +KKP T
Sbjct  120  RFHGAAHSGETMAVAVQPTEERTKQKKPTT  149



>ref|XP_008242279.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Prunus mume]
Length=563

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 91/150 (61%), Gaps = 10/150 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS----PRWLRRKRT----LAWSGN  354
            M ASSVASPLCTWLVAACMS  C+ D   + PS+  S    P+   R+R      ++S +
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDGDCSTR-PSMLSSSKRRPKCAARRRLPSKRSSFSAD  59

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYY-NSKGLPFFGDNALSLFGFKLAPVNRRQR  531
               G  S+  GS I GLMSSC AFEPC EYY +        +   SLFG K    NRRQR
Sbjct  60   FQKGLNSAFSGSSIQGLMSSCLAFEPCDEYYSSKGLSSLGSNGLSSLFGSKTGTTNRRQR  119

Query  532  RMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            R + AAHSG+TMAVAVQP +E   +KKP T
Sbjct  120  RFHGAAHSGETMAVAVQPTEERTKQKKPTT  149



>gb|ABJ90469.2| beta-ketoacyl-ACP synthase II [Jatropha curcas]
Length=573

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 93/171 (54%), Gaps = 43/171 (25%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSP-------RWLRRKRTLAWSGN-  354
            M ++S ASPLCTWLVAACMS  C K++R  +P  F S        RW RR++TL    N 
Sbjct  2    MGSASFASPLCTWLVAACMSVTCAKENR-TAPHAFHSSQPSNRLSRWARRRKTLHAQYNS  60

Query  355  ----------------------LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPF  468
                                  L    VS+L GS   GLMSSC AFEPC +YY+S GL  
Sbjct  61   DSSNSIAAGGGGGGGGGYSTEFLSNSLVSTLCGSSFQGLMSSCLAFEPCSQYYSSNGL--  118

Query  469  FGDNALSLFGFKLAPVNRRQRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
                      F+   +NR+QRR+N+ A SG+ MA+AVQPEKE  +KKKP T
Sbjct  119  ----------FRSRNLNRKQRRLNRLALSGEAMAIAVQPEKEVATKKKPAT  159



>ref|XP_009337172.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337173.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=562

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 93/148 (63%), Gaps = 7/148 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS---PRWLRRK---RTLAWSGNLG  360
            M ASSVASPLCTWLVAACMS  C++D   ++  +  S   P+   R+   +  ++SG   
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDRDCSPRASMLSSSRRRPKCAGRRLPSKCSSFSGEFQ  60

Query  361  GGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRM  537
             G +S+  GS I GLMSSC AFEPC EYY+S+           SLFG K    NRRQR  
Sbjct  61   KGLISAFSGSSIQGLMSSCLAFEPCDEYYSSRGLSSLGCSGLSSLFGSKYGASNRRQRCF  120

Query  538  NKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            + AA+SG+TMAVAVQP +E   +KKP+T
Sbjct  121  DGAAYSGETMAVAVQPTEELTKQKKPLT  148



>ref|XP_008378994.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Malus domestica]
Length=482

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 90/149 (60%), Gaps = 8/149 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD---HRGKSPSIFQSPRWLRR----KRTLAWSGNL  357
            M ASSVASPLCTWLVAACMS  C++D         S  + P+   R     +  ++SG  
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDRDCSPRXSMLSSSRRRPKCAGRXXLPSKCSSFSGEF  60

Query  358  GGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRR  534
              G +S+  GS I GLMSSC AFEPC EYY+SK           SLFG K    NRRQR 
Sbjct  61   QKGLISAFSGSSIQGLMSSCLAFEPCDEYYSSKGXSSLGCSGLSSLFGSKSGASNRRQRC  120

Query  535  MNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
             N AA+SG+TMAVAVQP +E   +KKP+T
Sbjct  121  FNGAAYSGETMAVAVQPTEELTKQKKPLT  149



>ref|XP_008338300.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Malus domestica]
Length=563

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 90/149 (60%), Gaps = 8/149 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD---HRGKSPSIFQSPRWLRR----KRTLAWSGNL  357
            M ASSVASPLCTWLVAACMS  C++D         S  + P+   R     +  ++SG  
Sbjct  1    MAASSVASPLCTWLVAACMSVTCDRDCSPRXSMLSSSRRRPKCAGRXXLPSKCSSFSGEF  60

Query  358  GGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRR  534
              G +S+  GS I GLMSSC AFEPC EYY+SK           SLFG K    NRRQR 
Sbjct  61   QKGLISAFSGSSIQGLMSSCLAFEPCDEYYSSKGXSSLGCSGLSSLFGSKSGASNRRQRC  120

Query  535  MNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
             N AA+SG+TMAVAVQP +E   +KKP+T
Sbjct  121  FNGAAYSGETMAVAVQPTEELTKQKKPLT  149



>ref|XP_010939870.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=557

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 96/147 (65%), Gaps = 10/147 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG----  366
            M  ++VASPLCTWLVAACM+ AC+K+ R   P    SPR  RR R  + SG +G G    
Sbjct  1    MAGAAVASPLCTWLVAACMTVACDKE-RPLGPG-SASPR--RRWRRASLSGGVGRGSPRR  56

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNK  543
             +S+  G+GI GLMSSC AFEPC E+Y+S+ G  FFG +  SL G + A   RRQRR  +
Sbjct  57   LISAFCGAGIQGLMSSCLAFEPCAEFYSSRNGSAFFGGDGFSLLGRQNAETTRRQRRGAR  116

Query  544  AA-HSGKTMAVAVQPEKEALSKKKPIT  621
            ++  SGK M++AVQPEK+   K++  T
Sbjct  117  SSPSSGKVMSIAVQPEKKVAEKERTQT  143



>ref|XP_010939869.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=559

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 12/149 (8%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG----  366
            M  ++VASPLCTWLVAACM+ AC+K+ R   P    SPR  RR R  + SG +G G    
Sbjct  1    MAGAAVASPLCTWLVAACMTVACDKE-RPLGPG-SASPR--RRWRRASLSGGVGRGSPRR  56

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNK  543
             +S+  G+GI GLMSSC AFEPC E+Y+S+ G  FFG +  SL G + A   RRQRR  +
Sbjct  57   LISAFCGAGIQGLMSSCLAFEPCAEFYSSRNGSAFFGGDGFSLLGRQNAETTRRQRRGAR  116

Query  544  AAHS---GKTMAVAVQPEKEALSKKKPIT  621
            ++ S   GK M++AVQPEK+   K++  T
Sbjct  117  SSPSSVAGKVMSIAVQPEKKVAEKERTQT  145



>gb|ACJ07142.1| beta-ketoacyl-ACP synthase II-1 [Arachis hypogaea]
Length=548

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 83/140 (59%), Gaps = 12/140 (9%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTL-AWSGNLGGGFVSSL  381
            ASS+ASPLCTWLVAACMS  C  D  G   +  +S +  RR + L   +  L    +SSL
Sbjct  6    ASSMASPLCTWLVAACMSVTCHADRAGTPKAALRSSKRSRRTKALPPNTSQLNMRLISSL  65

Query  382  YGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHSGK  561
            YGS I GL+SS   FEPC +Y N+        NA S   F+    NRR  R+NK AHSGK
Sbjct  66   YGSSIQGLISS---FEPCDDYCNTH-------NAFSSL-FRSTTPNRRHTRLNKLAHSGK  114

Query  562  TMAVAVQPEKEALSKKKPIT  621
            TMAVAV+P  E  + KKP T
Sbjct  115  TMAVAVEPAHEVTTTKKPPT  134



>ref|XP_010937286.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=557

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 88/148 (59%), Gaps = 18/148 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG----  366
            M  ++VASPLCTWLVAACMS AC+++      S F  P W RR   +  SG  G G    
Sbjct  1    MAGATVASPLCTWLVAACMSVACDEERPLGRRSSF--PGWRRR---VPLSGGEGRGLPRR  55

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNK  543
             +S+L GSGI GLMSS  A EPC E+Y+S+ GL F G N  S FG   A   RRQRR   
Sbjct  56   LISALRGSGIQGLMSSFLALEPCAEFYSSRNGLAFVGKNGFSPFGQWNAESTRRQRR---  112

Query  544  AAHSG-----KTMAVAVQPEKEALSKKK  612
            AAHS      K M++A+QPE E   KK+
Sbjct  113  AAHSSPSSGKKVMSIAMQPETEGAQKKR  140



>ref|XP_010937287.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X4 [Elaeis guineensis]
Length=499

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 88/150 (59%), Gaps = 20/150 (13%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG----  366
            M  ++VASPLCTWLVAACMS AC+++      S F  P W RR   +  SG  G G    
Sbjct  1    MAGATVASPLCTWLVAACMSVACDEERPLGRRSSF--PGWRRR---VPLSGGEGRGLPRR  55

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNK  543
             +S+L GSGI GLMSS  A EPC E+Y+S+ GL F G N  S FG   A   RRQRR   
Sbjct  56   LISALRGSGIQGLMSSFLALEPCAEFYSSRNGLAFVGKNGFSPFGQWNAESTRRQRR---  112

Query  544  AAHSG-------KTMAVAVQPEKEALSKKK  612
            AAHS        K M++A+QPE E   KK+
Sbjct  113  AAHSSPSSVAGKKVMSIAMQPETEGAQKKR  142



>ref|XP_008782971.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=555

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 86/146 (59%), Gaps = 16/146 (11%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG---F  369
            M  ++VASPLCTWLV ACMS AC ++      S F       R+R L   G + G     
Sbjct  1    MAGAAVASPLCTWLVTACMSVACNEERSLGRRSAFPG-----RRRALLSGGEVQGSPRRL  55

Query  370  VSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNKA  546
            +S+  G GI GLMSS  A EPC E+++S+ G  FFG+N   LFG   A  NRRQRR   A
Sbjct  56   ISAFRGLGIRGLMSSFLALEPCAEFHSSRNGSAFFGENGFFLFGPWNAESNRRQRR---A  112

Query  547  AHS----GKTMAVAVQPEKEALSKKK  612
            AHS    GK M++AVQPEKE   KK+
Sbjct  113  AHSSTSFGKVMSIAVQPEKEVAEKKR  138



>ref|XP_007217714.1| hypothetical protein PRUPE_ppa004479mg [Prunus persica]
 gb|EMJ18913.1| hypothetical protein PRUPE_ppa004479mg [Prunus persica]
Length=508

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 94/150 (63%), Gaps = 18/150 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPR----WLRRKRTLAWSGNLGGG  366
            M +SS ASP CTWL+AAC+S+  EKDH  +S SIFQSP+    W RRK+ ++    +GG 
Sbjct  1    MASSSTASPFCTWLLAACISSPYEKDHPMRS-SIFQSPKRLSQWARRKKLISKCSYVGGA  59

Query  367  FVS-----SLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQR  531
              +     S   SGIH LMSS  AFEPC   Y+SK L      +L+ FG K +   RRQR
Sbjct  60   DFASNLSSSFSVSGIHHLMSSFLAFEPC---YDSKVLY----ESLAFFGSKRSRT-RRQR  111

Query  532  RMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            +MN A HSG TMAV VQ  ++  +KKKP+T
Sbjct  112  QMNGAVHSGITMAVPVQRAEQGTTKKKPLT  141



>ref|XP_010937284.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=559

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 88/150 (59%), Gaps = 20/150 (13%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG----  366
            M  ++VASPLCTWLVAACMS AC+++      S F  P W RR   +  SG  G G    
Sbjct  1    MAGATVASPLCTWLVAACMSVACDEERPLGRRSSF--PGWRRR---VPLSGGEGRGLPRR  55

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNK  543
             +S+L GSGI GLMSS  A EPC E+Y+S+ GL F G N  S FG   A   RRQRR   
Sbjct  56   LISALRGSGIQGLMSSFLALEPCAEFYSSRNGLAFVGKNGFSPFGQWNAESTRRQRR---  112

Query  544  AAHSG-------KTMAVAVQPEKEALSKKK  612
            AAHS        K M++A+QPE E   KK+
Sbjct  113  AAHSSPSSVAGKKVMSIAMQPETEGAQKKR  142



>ref|XP_010937285.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=559

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 88/150 (59%), Gaps = 20/150 (13%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG----  366
            M  ++VASPLCTWLVAACMS AC+++      S F  P W RR   +  SG  G G    
Sbjct  1    MAGATVASPLCTWLVAACMSVACDEERPLGRRSSF--PGWRRR---VPLSGGEGRGLPRR  55

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNK  543
             +S+L GSGI GLMSS  A EPC E+Y+S+ GL F G N  S FG   A   RRQRR   
Sbjct  56   LISALRGSGIQGLMSSFLALEPCAEFYSSRNGLAFVGKNGFSPFGQWNAESTRRQRR---  112

Query  544  AAHSG-------KTMAVAVQPEKEALSKKK  612
            AAHS        K M++A+QPE E   KK+
Sbjct  113  AAHSSPSSVAGKKVMSIAMQPETEGAQKKR  142



>ref|XP_010047453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79359.1| hypothetical protein EUGRSUZ_C00778 [Eucalyptus grandis]
Length=558

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 87/154 (56%), Gaps = 23/154 (15%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWL--RRKRTL---AWSGNLGG  363
            M AS  ASPLCTWLVAAC S + E + +      FQ  R L  R KR +     S    G
Sbjct  1    MAASMAASPLCTWLVAACTSVSWEDELKANP---FQGSRRLSKRLKRKVLSKCCSDTSNG  57

Query  364  --------GFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVN  519
                    G +SS  GS I GLMSSC AFEPC ++Y   GL        SLFG +   +N
Sbjct  58   QSTISPVSGLISSFCGSSIQGLMSSCLAFEPCSDHYRCNGLS-------SLFGSRNVGIN  110

Query  520  RRQRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            RRQ+R N+A + G+TMAVA+QP +E  + KKP+T
Sbjct  111  RRQKRTNRARYPGETMAVALQPVQEVSTMKKPVT  144



>gb|KHG11339.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Gossypium 
arboreum]
Length=575

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 89/162 (55%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKS---PSIFQSP-----RWLRRKRTLAWSG-  351
            M +SS+ SPLCTWLVAACMS  C KD    S    S F S      RW R +R    S  
Sbjct  1    MASSSMVSPLCTWLVAACMSVTCGKDQSQSSFLRSSAFASSSKRHGRWARTRRRALLSQC  60

Query  352  ---------NLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDN-ALS-LFG  498
                     N  G  +S+ YG GI GLM+S   FEPC++YY+SK    FG N + S  FG
Sbjct  61   SGRGNGSAKNQDGSMISAFYGFGIQGLMASWLTFEPCKDYYSSKNCSLFGQNRSFSYFFG  120

Query  499  FKLAPVNRRQRRMNKAAH-SGKTMAVAVQPEKEALSKKKPIT  621
             K+ P NR+QR +N     SG  MAVA QP +E  +KKKP T
Sbjct  121  SKILP-NRKQRGLNGGPICSGAAMAVAPQPTREITTKKKPPT  161



>ref|XP_008782961.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=557

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 86/148 (58%), Gaps = 18/148 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG---F  369
            M  ++VASPLCTWLV ACMS AC ++      S F       R+R L   G + G     
Sbjct  1    MAGAAVASPLCTWLVTACMSVACNEERSLGRRSAFPG-----RRRALLSGGEVQGSPRRL  55

Query  370  VSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNKA  546
            +S+  G GI GLMSS  A EPC E+++S+ G  FFG+N   LFG   A  NRRQRR   A
Sbjct  56   ISAFRGLGIRGLMSSFLALEPCAEFHSSRNGSAFFGENGFFLFGPWNAESNRRQRR---A  112

Query  547  AHS------GKTMAVAVQPEKEALSKKK  612
            AHS      GK M++AVQPEKE   KK+
Sbjct  113  AHSSTSFVAGKVMSIAVQPEKEVAEKKR  140



>ref|XP_008782980.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Phoenix dactylifera]
Length=555

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 86/148 (58%), Gaps = 18/148 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG---F  369
            M  ++VASPLCTWLV ACMS AC ++      S F       R+R L   G + G     
Sbjct  1    MAGAAVASPLCTWLVTACMSVACNEERSLGRRSAFPG-----RRRALLSGGEVQGSPRRL  55

Query  370  VSSLYGSGIHGLMSSCFAFEPCQEYYNSK-GLPFFGDNALSLFGFKLAPVNRRQRRMNKA  546
            +S+  G GI GLMSS  A EPC E+++S+ G  FFG+N   LFG   A  NRRQRR   A
Sbjct  56   ISAFRGLGIRGLMSSFLALEPCAEFHSSRNGSAFFGENGFFLFGPWNAESNRRQRR---A  112

Query  547  AHS------GKTMAVAVQPEKEALSKKK  612
            AHS      GK M++AVQPEKE   KK+
Sbjct  113  AHSSTSFVAGKVMSIAVQPEKEVAEKKR  140



>gb|KJB65356.1| hypothetical protein B456_010G091400 [Gossypium raimondii]
Length=575

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 92/162 (57%), Gaps = 22/162 (14%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKS---PSIFQSP-----RWLR-RKRTL----  339
            M +SS+ SP+CT LVA CMS  C KD    S    S F S      RW R R+R L    
Sbjct  1    MASSSMVSPVCTCLVAGCMSVTCGKDQSQSSFLRSSAFASSSKRHGRWARTRRRALLSQC  60

Query  340  -----AWSGNLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDN-ALS-LFG  498
                   + N  G  +S+ YG GI GLM+S   FEPC +YY+SK    FG N + S  FG
Sbjct  61   SGRGNGSTKNQDGSMISAFYGFGIQGLMASWLTFEPCNDYYSSKNCSLFGQNRSFSYFFG  120

Query  499  FKLAPVNRRQRRMN-KAAHSGKTMAVAVQPEKEALSKKKPIT  621
             K+ P NR+QRR+N  AA SG+ MAVA QP +E  +KKKP T
Sbjct  121  PKILP-NRKQRRLNGGAACSGEAMAVAPQPTREITTKKKPPT  161



>ref|XP_008228351.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Prunus mume]
Length=555

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 93/150 (62%), Gaps = 18/150 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPR----WLRRKRTLAWSGNLGGG  366
            M +SS ASP CTWL+AAC+S+  EKDH  +S SIFQSP+    W RRK+ ++    +GG 
Sbjct  1    MASSSTASPFCTWLLAACISSPYEKDHPMRS-SIFQSPKRLSQWARRKKLISKCSYVGGA  59

Query  367  FVS-----SLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQR  531
              +     S   SG+H LMSS  A EPC   Y+SK L      +L+ FG K +   RRQR
Sbjct  60   DFASNLSSSFSVSGVHNLMSSFLAAEPC---YDSKVLY----ESLAFFGSKRSRT-RRQR  111

Query  532  RMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            +MN A HSG TMAV VQ  ++  +KKKP+T
Sbjct  112  QMNGAVHSGITMAVPVQRAEQGTTKKKPLT  141



>ref|XP_008784350.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Phoenix dactylifera]
Length=563

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 85/146 (58%), Gaps = 8/146 (5%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGG-----  363
            M   SVA+PLCTWLVAAC++    K+    +P+  ++    R  R    +          
Sbjct  1    MAGYSVAAPLCTWLVAACVTVPRGKEGTLAAPAAGEARLRSRSARRRRAAALRLDARDSS  60

Query  364  -GFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFGFKLAPVNRRQRRM  537
             G +S+L GSGI GLMSSC AFEPC E+Y SKG   FFG+   SLFG   A   RRQRR 
Sbjct  61   RGLMSALCGSGIQGLMSSCLAFEPCPEFYGSKGASSFFGEGGFSLFGPWKAETTRRQRRA  120

Query  538  NKAA-HSGKTMAVAVQPEKEALSKKK  612
             +A+  SGK MAVAVQP KE   KK+
Sbjct  121  GRASCVSGKAMAVAVQPAKEIAEKKR  146



>gb|AAB37271.1| beta-ketoacyl-ACP synthase II [Cuphea wrightii]
Length=540

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 79/133 (59%), Gaps = 20/133 (15%)
 Frame = +1

Query  223  PLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLYGSGIHG  402
            P CTWLVA+CMS + + D R  SPS+    R+ RRKR L            S  GS    
Sbjct  11   PFCTWLVASCMSTSFDNDPR--SPSV---KRFPRRKRVL------------SQRGSTFQC  53

Query  403  LMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVNRRQRRMNKAAHSGKTMAVAV  579
            L++SC   +PC +Y +S  L F GDN   SLFG K    NR  RR+ +A+HSG+ MAVA+
Sbjct  54   LVASCI--DPCDQYRSSASLSFLGDNGFASLFGSKPFMSNRGHRRLRRASHSGEAMAVAL  111

Query  580  QPEKEALSKKKPI  618
            QP +EA +KKKP+
Sbjct  112  QPAQEAGTKKKPV  124



>ref|XP_010932371.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=577

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 92/151 (61%), Gaps = 10/151 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD--------HRGKSPSIFQSPRWLRRKRTLAWSGN  354
            M   SVA+PLCTWLVAAC++A+  K+          G++  + +S R  R       + +
Sbjct  1    MAGYSVAAPLCTWLVAACVTASGGKEGPLAAPAPAVGEARRLSRSARRRRAAALRLDARD  60

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFGFKLAPVNRRQR  531
              GG +S+L GSGI GLMSSC AFEPC E+Y SKG   FFG++  SLFG   A   RRQR
Sbjct  61   SSGGLMSALRGSGIQGLMSSCLAFEPCAEFYGSKGASAFFGESGFSLFGTSKAETTRRQR  120

Query  532  RMNKAA-HSGKTMAVAVQPEKEALSKKKPIT  621
            R  +A+  SGK MAVAVQP KE   KK+  T
Sbjct  121  RAARASCVSGKAMAVAVQPAKEIAEKKRTHT  151



>emb|CBI27767.3| unnamed protein product [Vitis vinifera]
Length=517

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 74/140 (53%), Gaps = 44/140 (31%)
 Frame = +1

Query  217  ASPLCTWLVAACMSAACEKDHRGKSPSIFQSP----RWLRRKRTLAWSGNLGGGFVSSLY  384
            ASPLCTWLVAACMS   + +   K PS+ Q      RW +R+R L +S            
Sbjct  3    ASPLCTWLVAACMSVTADNEFAPK-PSMVQCSKRLSRWGKRRRGLPYSA-----------  50

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALS-LFGFKLAPVNRRQRRMNKAAHSGK  561
                                       FFGDNALS +FG K  P+NRRQRR N+ +HSG+
Sbjct  51   ---------------------------FFGDNALSSVFGSKSLPLNRRQRRTNRGSHSGE  83

Query  562  TMAVAVQPEKEALSKKKPIT  621
            TMAVAVQP KE  +KKKP+T
Sbjct  84   TMAVAVQPAKEVTTKKKPLT  103



>gb|AAF26738.2|AF220453_1 beta-ketoacyl-ACP synthase II [Elaeis guineensis]
Length=573

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 92/151 (61%), Gaps = 10/151 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD--------HRGKSPSIFQSPRWLRRKRTLAWSGN  354
            M   SVA+PLCTWLVAAC++A+  K+          G++  + +S R  R       + +
Sbjct  1    MAGYSVAAPLCTWLVAACVTASGGKEGPLAAPAPAVGEARRLSRSARRRRAAALRLDARD  60

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFGFKLAPVNRRQR  531
              GG +S+L GSGI GLMSSC AFEPC E+Y SKG   FFG++  SLFG   A   RRQR
Sbjct  61   SSGGLMSALRGSGIQGLMSSCLAFEPCAEFYGSKGASAFFGESGFSLFGTSKAETTRRQR  120

Query  532  RMNKAA-HSGKTMAVAVQPEKEALSKKKPIT  621
            R  +A+  SGK MAVAVQP KE   KK+  T
Sbjct  121  RAARASCVSGKAMAVAVQPAKEIAEKKRTHT  151



>ref|XP_010932373.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X4 [Elaeis guineensis]
Length=565

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 92/151 (61%), Gaps = 10/151 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD--------HRGKSPSIFQSPRWLRRKRTLAWSGN  354
            M   SVA+PLCTWLVAAC++A+  K+          G++  + +S R  R       + +
Sbjct  1    MAGYSVAAPLCTWLVAACVTASGGKEGPLAAPAPAVGEARRLSRSARRRRAAALRLDARD  60

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFGFKLAPVNRRQR  531
              GG +S+L GSGI GLMSSC AFEPC E+Y SKG   FFG++  SLFG   A   RRQR
Sbjct  61   SSGGLMSALRGSGIQGLMSSCLAFEPCAEFYGSKGASAFFGESGFSLFGTSKAETTRRQR  120

Query  532  RMNKAA-HSGKTMAVAVQPEKEALSKKKPIT  621
            R  +A+  SGK MAVAVQP KE   KK+  T
Sbjct  121  RAARASCVSGKAMAVAVQPAKEIAEKKRTHT  151



>ref|XP_010533238.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Tarenaya hassleriana]
Length=549

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 85/149 (57%), Gaps = 22/149 (15%)
 Frame = +1

Query  199  MVASS---VASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTL----AWSGNL  357
            MV SS    ASPLCTWLVAACMS         +      S RW RRK+ L    A S ++
Sbjct  1    MVGSSSLCYASPLCTWLVAACMSVTTYGGGD-RYAECRSSRRWARRKKLLSKYTAASVSV  59

Query  358  GGGFVSSLYGS-GIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRR  534
            GG      +GS GI  LMSSC AF PC ++ N   L       LSLFG     +NR++ R
Sbjct  60   GG------HGSAGIQALMSSCLAFGPCNQHSNDNAL-------LSLFGSYNISLNRKRTR  106

Query  535  MNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            +N+A+ SGK MA  VQ EKE++++KKP T
Sbjct  107  LNQASRSGKVMAGMVQLEKESMAEKKPPT  135



>ref|XP_010539937.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Tarenaya hassleriana]
Length=627

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 86/152 (57%), Gaps = 27/152 (18%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHR------GKSPSIFQSPR-WLRRKRTL----AWSG  351
            +S  ASPLCTWL+A CMS  C    R      G + S  QS R W RRKR L    A S 
Sbjct  76   SSCYASPLCTWLMAGCMSVTCGGGDRYAAIACGSAHSDSQSSRRWARRKRLLSKCSAASV  135

Query  352  NLGGGFVSSLYGS-GIHGLMSSCFAFEPCQEYYNSKGLP-FFGDNALSLFGFKLAPVNRR  525
              GG      +GS GI  L+ SC AF PC +++N+  L  FFG N +SL        NR+
Sbjct  136  AAGG------HGSTGIPALVDSCSAFGPCNQHWNNNALSSFFGSNNISL--------NRK  181

Query  526  QRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            QRR+N+ + SG+ MAVAVQ  KE+++  KP T
Sbjct  182  QRRLNRGSRSGEVMAVAVQLGKESMTNMKPPT  213



>gb|ACQ41833.1| beta-ketoacyl-ACP synthase II [Elaeis oleifera]
Length=562

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 10/151 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD--------HRGKSPSIFQSPRWLRRKRTLAWSGN  354
            M   SVA+PLCTWLVAAC++A+  K+          G++  + +S R  R       + +
Sbjct  1    MAGYSVAAPLCTWLVAACVTASGGKEGPLAAPGPAVGEARRLSRSARRRRAAALRLDARD  60

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFG-FKLAPVNRRQ  528
              GG +S+L G GI GLMSSC AFEPC E+Y SKG   FFG++  SLFG +K     R++
Sbjct  61   SSGGLMSALRGPGIQGLMSSCLAFEPCAEFYGSKGASAFFGESGFSLFGTWKAETTRRQR  120

Query  529  RRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            R    +  SGK MAVAVQP KE   KK+  T
Sbjct  121  RAARASCVSGKAMAVAVQPAKEIAEKKRTHT  151



>ref|XP_010932374.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X5 [Elaeis guineensis]
Length=551

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 92/160 (58%), Gaps = 19/160 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD--------HRGKSPSIFQSPRWLRRKRTLAWSGN  354
            M   SVA+PLCTWLVAAC++A+  K+          G++  + +S R  R       + +
Sbjct  1    MAGYSVAAPLCTWLVAACVTASGGKEGPLAAPAPAVGEARRLSRSARRRRAAALRLDARD  60

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFGFKLAPVNRRQR  531
              GG +S+L GSGI GLMSSC AFEPC E+Y SKG   FFG++  SLFG   A   RRQR
Sbjct  61   SSGGLMSALRGSGIQGLMSSCLAFEPCAEFYGSKGASAFFGESGFSLFGTSKAETTRRQR  120

Query  532  RMNKAA----------HSGKTMAVAVQPEKEALSKKKPIT  621
            R  +A+           SGK MAVAVQP KE   KK+  T
Sbjct  121  RAARASCVSGFNSVYMVSGKAMAVAVQPAKEIAEKKRTHT  160



>ref|XP_010932370.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=586

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 92/160 (58%), Gaps = 19/160 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD--------HRGKSPSIFQSPRWLRRKRTLAWSGN  354
            M   SVA+PLCTWLVAAC++A+  K+          G++  + +S R  R       + +
Sbjct  1    MAGYSVAAPLCTWLVAACVTASGGKEGPLAAPAPAVGEARRLSRSARRRRAAALRLDARD  60

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFGFKLAPVNRRQR  531
              GG +S+L GSGI GLMSSC AFEPC E+Y SKG   FFG++  SLFG   A   RRQR
Sbjct  61   SSGGLMSALRGSGIQGLMSSCLAFEPCAEFYGSKGASAFFGESGFSLFGTSKAETTRRQR  120

Query  532  RMNKAA----------HSGKTMAVAVQPEKEALSKKKPIT  621
            R  +A+           SGK MAVAVQP KE   KK+  T
Sbjct  121  RAARASCVSGFNSVYMVSGKAMAVAVQPAKEIAEKKRTHT  160



>ref|XP_010932372.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=574

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 92/160 (58%), Gaps = 19/160 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKD--------HRGKSPSIFQSPRWLRRKRTLAWSGN  354
            M   SVA+PLCTWLVAAC++A+  K+          G++  + +S R  R       + +
Sbjct  1    MAGYSVAAPLCTWLVAACVTASGGKEGPLAAPAPAVGEARRLSRSARRRRAAALRLDARD  60

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGL-PFFGDNALSLFGFKLAPVNRRQR  531
              GG +S+L GSGI GLMSSC AFEPC E+Y SKG   FFG++  SLFG   A   RRQR
Sbjct  61   SSGGLMSALRGSGIQGLMSSCLAFEPCAEFYGSKGASAFFGESGFSLFGTSKAETTRRQR  120

Query  532  RMNKAA----------HSGKTMAVAVQPEKEALSKKKPIT  621
            R  +A+           SGK MAVAVQP KE   KK+  T
Sbjct  121  RAARASCVSGFNSVYMVSGKAMAVAVQPAKEIAEKKRTHT  160



>ref|XP_010049368.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW81915.1| hypothetical protein EUGRSUZ_C03291 [Eucalyptus grandis]
Length=553

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 10/145 (7%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSS  378
            M AS+VASPLCTWLVAACMS +CE+D   K P+     R  RR+  +             
Sbjct  1    MAASTVASPLCTWLVAACMSVSCERDGAAKRPASCGFSRRRRRRLPVPEC------SRGG  54

Query  379  LYGSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNAL-SLFGFKLAPVNRRQRRMNKA  546
               +   GL+SSC AFEPC E+Y+S+    L FFG++   SLFG +   +NRRQRR+N+A
Sbjct  55   GGSASSFGLVSSCLAFEPCSEFYSSRAASSLGFFGESGFASLFGSRNRQMNRRQRRLNRA  114

Query  547  AHSGKTMAVAVQPEKEALSKKKPIT  621
              SG+ MAVAVQ   E ++KKKP+T
Sbjct  115  PGSGEVMAVAVQAAPEFVTKKKPVT  139



>ref|XP_006843870.1| hypothetical protein AMTR_s00007p00265100 [Amborella trichopoda]
 gb|ERN05545.1| hypothetical protein AMTR_s00007p00265100 [Amborella trichopoda]
Length=606

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 70/113 (62%), Gaps = 10/113 (9%)
 Frame = +1

Query  301  FQSPRWLR----RKRTLAWSGNLGGGFVSSLY---GSGIHGLMSSCFAFEPCQEYYNSKG  459
             +S RW R    R + +  S ++  G+ SSL    GS + GL SSC AFEPCQEYY+ K 
Sbjct  13   LRSGRWARKRMARAKAMCESLSVMPGYGSSLVSFCGSSLQGL-SSCLAFEPCQEYYSCKD  71

Query  460  LPFFGDNALSLFGFKLAPVNRRQRRMNKAAHSGKTMAVAVQPEKEALSKKKPI  618
             P FG+N  SLFG K   V RRQRR+N A  SGK MAVAVQP K+   KKK +
Sbjct  72   PPLFGENCFSLFGSKGLKVGRRQRRVNHA--SGKAMAVAVQPAKDVGLKKKTL  122



>gb|KDO73819.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=324

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLR---------RKRTLAWSGNLGG  363
            S  SPLCTWLVAACMS  C      + PS+ +  R+           R+R L+    +GG
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  364  GFVS-------SLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
              V+       S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   +  
Sbjct  64   EVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTA  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>gb|KDO73818.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=392

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLR---------RKRTLAWSGNLGG  363
            S  SPLCTWLVAACMS  C      + PS+ +  R+           R+R L+    +GG
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  364  GFVS-------SLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
              V+       S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   +  
Sbjct  64   EVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTA  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>gb|KDO73817.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=470

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLR---------RKRTLAWSGNLGG  363
            S  SPLCTWLVAACMS  C      + PS+ +  R+           R+R L+    +GG
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  364  GFVS-------SLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
              V+       S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   +  
Sbjct  64   EVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTA  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>gb|KDO73816.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=454

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLR---------RKRTLAWSGNLGG  363
            S  SPLCTWLVAACMS  C      + PS+ +  R+           R+R L+    +GG
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  364  GFVS-------SLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
              V+       S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   +  
Sbjct  64   EVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTA  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>gb|KDO73815.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=557

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLR---------RKRTLAWSGNLGG  363
            S  SPLCTWLVAACMS  C      + PS+ +  R+           R+R L+    +GG
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  364  GFVS-------SLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
              V+       S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   +  
Sbjct  64   EVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTA  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>gb|KDO73811.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
 gb|KDO73812.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
 gb|KDO73813.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=576

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLR---------RKRTLAWSGNLGG  363
            S  SPLCTWLVAACMS  C      + PS+ +  R+           R+R L+    +GG
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  364  GFVS-------SLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
              V+       S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   +  
Sbjct  64   EVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTA  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>ref|XP_006452865.1| hypothetical protein CICLE_v10007846mg [Citrus clementina]
 gb|ESR66105.1| hypothetical protein CICLE_v10007846mg [Citrus clementina]
Length=576

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLR---------RKRTLAWSGNLGG  363
            S  SPLCTWLVAACMS  C      + PS+ +  R+           R+R L+    +GG
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  364  GFVS-------SLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
              V+       S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   +  
Sbjct  64   EVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTA  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>ref|XP_010687531.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=545

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 76/150 (51%), Gaps = 28/150 (19%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRR-------KRTLAWSGNL  357
            M A +V +PLCTWLVAACMS  C    + K+ S   S +  RR       KR L +  N 
Sbjct  1    MAAYTVGTPLCTWLVAACMSVGCNGG-KEKTCSFSLSSKNSRRSGCSSRKKRGLEFKCN-  58

Query  358  GGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL--SLFGFKLAPVNRRQR  531
                           L++      PC EYY+S        N +  S+FG K   +NRRQR
Sbjct  59   ------------AQILLNQM----PCDEYYSSS-FDHNDKNGVFSSVFGSKFGHINRRQR  101

Query  532  RMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            R N+A HSG+ MAVAV+P  E  + KKP+T
Sbjct  102  RSNRAIHSGRAMAVAVEPSMEVTTNKKPVT  131



>emb|CAC59946.1| beta-ketoacyl-ACP synthase IV [Cuphea lanceolata]
Length=538

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 74/131 (56%), Gaps = 19/131 (15%)
 Frame = +1

Query  223  PLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLYGSGIHG  402
            P CTWLVAACMS + E + R  SPSI + PR   R+R L+           SL GS    
Sbjct  11   PFCTWLVAACMSTSFENNPR--SPSIKRLPR---RRRVLSHC---------SLRGSTFQC  56

Query  403  LMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHSGKTMAVAVQ  582
            L++S    +PC +  +S  L F G N    FG K    NR  RR+ +A+HSG+ MAVA+Q
Sbjct  57   LVTS--HIDPCNQNCSSDSLSFIGVNG---FGSKPFRSNRGHRRLGRASHSGEAMAVALQ  111

Query  583  PEKEALSKKKP  615
            P +E  +KKKP
Sbjct  112  PAQEVATKKKP  122



>ref|XP_011039936.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
Length=548

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 72/144 (50%), Gaps = 22/144 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAAC--EKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGF-----  369
            S++SPLCTW+VAACMS  C  E  H    PS     R  RRK   A   N    +     
Sbjct  6    SLSSPLCTWIVAACMSVTCANESKHALSPPSSTTGNRSRRRKAAAALKCNSNNKYNNYGS  65

Query  370  VSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAA  549
                 G  + GL+SSC AFEPC  YY S GL                  NR+ RR++  A
Sbjct  66   GMGGGGPSLQGLVSSCLAFEPCSHYYASNGL---------------LRSNRKLRRLHPPA  110

Query  550  HSGKTMAVAVQPEKEALSKKKPIT  621
             SG+ MAVAVQP KE  +KKKP T
Sbjct  111  LSGQAMAVAVQPTKEVETKKKPHT  134



>ref|XP_002516228.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|EEF46230.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
Length=554

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 77/150 (51%), Gaps = 22/150 (15%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHR------GKSPSIFQSPRWLRRKR--TLAWSGN  354
            M ++S++SPLCTWLVAACMS  C K++R          +     R  RR +  +++   +
Sbjct  2    MGSASLSSPLCTWLVAACMSVTCSKENRHAFFSSSTPGTTSSHSRTRRRPKYNSISTPAS  61

Query  355  LGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPV--NRRQ  528
                   S  GS    LMSSC AFEPC  YY+S GL            F   P+   R  
Sbjct  62   QSFFNSLSSSGSSFQQLMSSCLAFEPCSHYYSSNGL------------FPNTPLLPKRHP  109

Query  529  RRMNKAAHSGKTMAVAVQPEKEALSKKKPI  618
            R  ++   SG+ MAVAVQPEKE  + KKP+
Sbjct  110  RLHHRLPRSGEAMAVAVQPEKEVATNKKPL  139



>ref|XP_011093876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Sesamum indicum]
Length=547

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 77/146 (53%), Gaps = 18/146 (12%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSS  378
            M ASSV   +C+WL+AACMS ACEKD    S S+  +P      R   W+       ++ 
Sbjct  1    MAASSV---VCSWLMAACMSVACEKD---SSISMLSTPSS-NSSRISKWAARRRKRALAK  53

Query  379  LYG--SGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNK-  543
                 SG   LM+SC AFEPC  +Y S      FFG      FG + A ++RR+R+  + 
Sbjct  54   CAPQLSGTRNLMTSCLAFEPCDRFYESSDASEFFFG------FGSRNALLHRRRRKFQRP  107

Query  544  AAHSGKTMAVAVQPEKEALSKKKPIT  621
             A SG+ MA+AV P  E   KKKP T
Sbjct  108  TARSGEAMAIAVHPAMEVTPKKKPST  133



>ref|XP_002889002.1| hypothetical protein ARALYDRAFT_476635 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65261.1| hypothetical protein ARALYDRAFT_476635 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 74/142 (52%), Gaps = 20/142 (14%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRG---KSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            +SS ASPLCTW VAACMS +    H G   +     QS    RR+R L+   +  G    
Sbjct  5    SSSYASPLCTWFVAACMSVS----HGGGDTRQAVALQSAGRSRRRRQLSKCSSASGS---  57

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
                + I  L++SC  F PC  Y N+           SLFG     +NR QRR+N+AA S
Sbjct  58   ----ASIQALVTSCLDFGPCTHYNNNNNNALS-----SLFGSNSVSLNRNQRRLNRAASS  108

Query  556  GKTMAVAVQPEKEALSKKKPIT  621
            G  MAV ++ EKEA+  KKP T
Sbjct  109  GGAMAV-MEMEKEAMVNKKPPT  129



>ref|XP_006474686.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474687.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Citrus sinensis]
 ref|XP_006474688.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=576

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 74/157 (47%), Gaps = 24/157 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKR----------------TLA  342
            S  SPLCTWLVAACMS  C      + PS+ +  R+   KR                   
Sbjct  6    SFTSPLCTWLVAACMSFTCGSRDPHQPPSVLR--RYTNNKREGLSAARRRKLSAKCGVGG  63

Query  343  WSGNLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYYNS-KGLPFFGDNALS-LFGFKLAPV  516
               N G     S     I  LM+SC  FEPC EYY+S   L FFGDN  S  FG   + V
Sbjct  64   EVVNGGLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTV  123

Query  517  NRRQRRMNK----AAHSGKTMAVAVQPEKEALSKKKP  615
               +R+          SG+ MAVAVQP++E  +KKKP
Sbjct  124  TLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKP  160



>gb|EYU28306.1| hypothetical protein MIMGU_mgv1a004039mg [Erythranthe guttata]
Length=548

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 81/146 (55%), Gaps = 22/146 (15%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDH------RGKSPSIFQSPRWL--RRKRTLAWSGNLGGG  366
            + +S +C+WL+AACMS A EK+          S + ++  RW   RRKR LA        
Sbjct  2    AASSAVCSWLMAACMSVAYEKESSISMLSTTTSSNPYRLSRWAARRRKRVLAQC------  55

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNK-  543
               + + SGI  LM+SC AFEPC  +Y S        ++ S FG + AP++R +R++++ 
Sbjct  56   ---APHFSGIRNLMNSCLAFEPCDNFYKSSN----ASDSFSGFGSRDAPLHRSRRKLHRP  108

Query  544  AAHSGKTMAVAVQPEKEALSKKKPIT  621
            +A SG+ +A+++    E   K KP+T
Sbjct  109  SARSGEALAISLTSVDEVTPKNKPLT  134



>emb|CDP03046.1| unnamed protein product [Coffea canephora]
Length=549

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 77/152 (51%), Gaps = 29/152 (19%)
 Frame = +1

Query  202  VASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSL  381
            +ASSV   +C+WL+AACMS ACE D +     +   P      R   W+      F    
Sbjct  1    MASSV---VCSWLMAACMSVACENDSKTTISMLSSDPSL--SSRFTKWAAPGPPQF----  51

Query  382  YGSGIHGLMSSCFAFEPCQEY-------YNSKGL---PFF--GDNALSLFGFKLAPVNRR  525
              S I  LMSSC AFEPC ++       + S  L   PFF  GDN        LA  + R
Sbjct  52   --SRIRNLMSSCLAFEPCPDFCRNSSSSFPSLALSSSPFFSGGDNG------ALALGHGR  103

Query  526  QRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            + ++N+  HSGK +A+AVQP  EA  KKKP T
Sbjct  104  RNKLNQPVHSGKAVAIAVQPTMEAAPKKKPPT  135



>gb|AAC68860.1| 3-ketoacyl-ACP synthase [Cuphea avigera var. pulcherrima]
Length=546

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 79/138 (57%), Gaps = 13/138 (9%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S +ASPLCTWL+AACMS +         PSI    R L R+R L+    L     S+L 
Sbjct  5    SSLLASPLCTWLLAACMSTSFHPSDP-LPPSISSPRRRLSRRRILSQCAPLPSA-SSALR  62

Query  385  GSGIHGLMSSCFA-FEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHSGK  561
            GS  H L++S  A FEPC +YY S           SLFG +     RR RR+N+A+ S +
Sbjct  63   GSSFHTLVTSYLACFEPCHDYYTSA----------SLFGSRPIRTTRRHRRLNRASPSRE  112

Query  562  TMAVAVQPEKEALSKKKP  615
             MAVA+QPE+E  +KKKP
Sbjct  113  AMAVALQPEQEVTTKKKP  130



>gb|AAL91174.1| putative 3-ketoacyl-ACP synthase [Arabidopsis thaliana]
Length=541

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 72/140 (51%), Gaps = 18/140 (13%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS ASPLCTW VAACMS +    H G      +    L+          L    V+S  
Sbjct  5    SSSYASPLCTWFVAACMSVS----HGGGDS---RQAVALQSGGRSRRRRQLSKCSVASGS  57

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLP-FFGDNALSLFGFKLAPVNRRQRRMNKAAHSGK  561
             S I  L++SC  F PC  Y N+  L   FG N++SL        NR QRR+N+AA SG 
Sbjct  58   AS-IQALVTSCLDFGPCTHYNNNNALSSLFGSNSVSL--------NRNQRRLNRAASSGG  108

Query  562  TMAVAVQPEKEALSKKKPIT  621
             MAV ++ EKEA   KKP T
Sbjct  109  AMAV-MEMEKEAAVNKKPPT  127



>gb|EYU25822.1| hypothetical protein MIMGU_mgv1a004003mg [Erythranthe guttata]
Length=549

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 77/141 (55%), Gaps = 17/141 (12%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            A++ +S +C+WL+AACMS ACEKD      S   SPR  +      W+       ++   
Sbjct  4    AATASSLMCSWLMAACMSVACEKDSSVSMLSSSNSPRLSK------WAARRRKRALAKCA  57

Query  385  G--SGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNK-AA  549
               S    L++SC AFEPC ++Y S      FFG      FG + APV+R +R++ + AA
Sbjct  58   PELSAAPNLVASCLAFEPCDQFYKSSHACEFFFG------FGSRNAPVHRSRRKILRPAA  111

Query  550  HSGKTMAVAVQPEKEALSKKK  612
            HSG+ MAV+V P  E  +KK 
Sbjct  112  HSGEAMAVSVHPGLEVTTKKN  132



>ref|NP_565097.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 ref|NP_849888.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 ref|NP_001185400.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 sp|Q9C9P4.1|KASC2_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic; 
AltName: Full=Beta-ketoacyl-acyl-carrier-protein 
synthase II; Short=AtKAS2; Short=Beta-ketoacyl-ACP synthetase 
2; AltName: Full=Protein FATTY ACID BIOSYNTHESIS 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51920.1|AC013258_14 putative 3-ketoacyl-ACP synthase; 47419-50803 [Arabidopsis thaliana]
 gb|AAK69603.1|AF318307_1 beta-ketoacyl-ACP synthetase 2 [Arabidopsis thaliana]
 gb|AAL31930.1|AF419598_1 At1g74960/F9E10_19 [Arabidopsis thaliana]
 gb|AAL06857.1| At1g74960/F9E10_19 [Arabidopsis thaliana]
 gb|AAM19860.1| At1g74960/F9E10_19 [Arabidopsis thaliana]
 gb|AEE35655.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 gb|AEE35656.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 gb|AEE35657.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
Length=541

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 72/140 (51%), Gaps = 18/140 (13%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS ASPLCTW VAACMS +    H G      +    L+          L    V+S  
Sbjct  5    SSSYASPLCTWFVAACMSVS----HGGGDS---RQAVALQSGGRSRRRRQLSKCSVASGS  57

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLP-FFGDNALSLFGFKLAPVNRRQRRMNKAAHSGK  561
             S I  L++SC  F PC  Y N+  L   FG N++SL        NR QRR+N+AA SG 
Sbjct  58   AS-IQALVTSCLDFGPCTHYNNNNALSSLFGSNSVSL--------NRNQRRLNRAASSGG  108

Query  562  TMAVAVQPEKEALSKKKPIT  621
             MAV ++ EKEA   KKP T
Sbjct  109  AMAV-MEMEKEAAVNKKPPT  127



>gb|AAD55280.1|AC008263_11 Similar to gb|AF060519 3-ketoacyl-ACP synthase (Kas4) from Cuphea 
hookeriana [Arabidopsis thaliana]
Length=562

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 72/140 (51%), Gaps = 18/140 (13%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS ASPLCTW VAACMS +    H G      +    L+          L    V+S  
Sbjct  5    SSSYASPLCTWFVAACMSVS----HGGGDS---RQAVALQSGGRSRRRRQLSKCSVASGS  57

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLP-FFGDNALSLFGFKLAPVNRRQRRMNKAAHSGK  561
             S I  L++SC  F PC  Y N+  L   FG N++SL        NR QRR+N+AA SG 
Sbjct  58   AS-IQALVTSCLDFGPCTHYNNNNALSSLFGSNSVSL--------NRNQRRLNRAASSGG  108

Query  562  TMAVAVQPEKEALSKKKPIT  621
             MAV ++ EKEA   KKP T
Sbjct  109  AMAV-MEMEKEAAVNKKPPT  127



>ref|XP_002324139.2| hypothetical protein POPTR_0018s07450g [Populus trichocarpa]
 gb|EEF02704.2| hypothetical protein POPTR_0018s07450g [Populus trichocarpa]
Length=554

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 72/158 (46%), Gaps = 40/158 (25%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKD--HRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSS  378
            ++S++SPLCTWL AACMS  C K+  H    PS   S R   +   L           S 
Sbjct  4    SASLSSPLCTWLFAACMSVTCAKESAHPLSPPSYNSSRRRKAKSAALPMKCCCSSSSSSG  63

Query  379  LYGSGIH-----------------GLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKL  507
            + G  +H                 GLMSSC A EPC  YY S GL               
Sbjct  64   IRGI-VHSSPSNDNTNNKSTLSFKGLMSSCLADEPCSSYYASGGL---------------  107

Query  508  APVNRRQRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
                  +RR++  A SG+ MAVAVQP +E  +KKKP+T
Sbjct  108  -----LRRRLSPPATSGQAMAVAVQPTREVETKKKPLT  140



>ref|XP_009104733.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Brassica rapa]
Length=546

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 76/147 (52%), Gaps = 27/147 (18%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +S  ASPLCT+ VAACMS +    H G      Q     RR+R       LG     
Sbjct  4    AAASSCYASPLCTFFVAACMSLS----HGGGGGDTRQPLGRSRRRRQ-----QLG---KC  51

Query  376  SLYGSGIHGLMSSCFAFEPCQEYY-NSKGLPF----FGDNALSLFGFKLAPVNRRQRRMN  540
            S  GS    L+SSC  F+PC  Y  N+KG  F    FG N+LSL        NR+QR++N
Sbjct  52   SGSGSVQEALVSSCLEFKPCSHYNKNNKGNAFTPLLFGSNSLSL--------NRKQRKLN  103

Query  541  KA--AHSGKTMAVAVQPEKEALSKKKP  615
            +A  + SG  MAVA+  EKEA   KKP
Sbjct  104  RATTSSSGGAMAVAMGMEKEATVDKKP  130



>ref|XP_010554926.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like, 
partial [Tarenaya hassleriana]
Length=497

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 52/79 (66%), Gaps = 9/79 (11%)
 Frame = +1

Query  388  SGIHGLMSSCFAFEPCQEYYNSKGLP-FFGDNALSLFGFKLAPVNRRQRRMNKAAHSGKT  564
            +GI  L+SSC  F PC +Y N+  L   FG N +SL        NR+QRR+N+A+ SG+ 
Sbjct  34   AGIQALVSSCLVFGPCDQYCNNNALSSLFGSNNISL--------NRKQRRLNRASRSGEA  85

Query  565  MAVAVQPEKEALSKKKPIT  621
            +AV +Q EKE+++KKKP T
Sbjct  86   VAVTMQLEKESMAKKKPGT  104



>ref|XP_006300437.1| hypothetical protein CARUB_v10020101mg [Capsella rubella]
 gb|EOA33335.1| hypothetical protein CARUB_v10020101mg [Capsella rubella]
Length=543

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 69/140 (49%), Gaps = 16/140 (11%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLCTW VAACMS A         P   +    L+          L     +S  
Sbjct  5    SSCYASPLCTWFVAACMSVA-------HGPGDSRQAVALQSGGRSRRRRQLSKCSPASGS  57

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALS-LFGFKLAPVNRRQRRMNKAAHSGK  561
               I  L++SC  F PC  +YNS        NALS LFG      NR QRR+N+AA SG+
Sbjct  58   APTIQALVTSCLDFGPCT-HYNSN------YNALSSLFGSNTVSSNRNQRRLNRAATSGR  110

Query  562  TMAVAVQPEKEALSKKKPIT  621
             MAV ++ EKEA   KKP T
Sbjct  111  AMAV-MEMEKEAAVNKKPPT  129



>gb|AAC68861.1| 3-ketoacyl-ACP synthase [Cuphea hookeriana]
Length=534

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 65/143 (45%), Gaps = 25/143 (17%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +  VASP CTWLVAACM  + + D           PR L  KR              
Sbjct  2    ATASCMVASPFCTWLVAACMPTSSDND-----------PRSLSHKRLRLSRRRRTLSSHC  50

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVNRRQRRMNKAAH  552
            SL GS    L       +PC +        F GDN   SLFG K    NR   R+ + +H
Sbjct  51   SLRGSTFQCL-------DPCNQQR------FLGDNGFASLFGSKPLRSNRGHLRLGRTSH  97

Query  553  SGKTMAVAVQPEKEALSKKKPIT  621
            SG+ MAVA+QP +E  + KKP T
Sbjct  98   SGEVMAVAMQPAQEVSTNKKPAT  120



>ref|XP_011460975.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=543

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 82/141 (58%), Gaps = 12/141 (9%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSS  378
            M A+SVASPLCTWLVAACMS  C+    G+            R+R LA   +      SS
Sbjct  1    MAATSVASPLCTWLVAACMSVTCD----GEPSRAKLRGGGGGRRRRLAKCSSRRCLSSSS  56

Query  379  LYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHSG  558
              GS I GLMS    FEPC EYY+S+GL   G N   LFG K   +NR +RR   +A SG
Sbjct  57   RGGSSIQGLMS----FEPCDEYYSSQGLSSLGSNV--LFGSKTGSMNRSRRR--FSARSG  108

Query  559  KTMAVAVQPEKEALSKKKPIT  621
            +TMAVAVQP +E   + KP+T
Sbjct  109  ETMAVAVQPTEELTKQMKPVT  129



>ref|NP_001289900.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Camelina sativa]
 ref|XP_010471596.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Camelina sativa]
 gb|AFU61918.1| beta-ketoacyl-ACP synthase II [Camelina sativa]
Length=554

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 70/146 (48%), Gaps = 18/146 (12%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNL-----GGGF  369
            +S  ASPLCTW VAACMS +    H G      Q+   L+          L         
Sbjct  6    SSCYASPLCTWFVAACMSVS----HDGGGGDSRQAAVALQSGGRSRRRRQLTKCSSASSP  61

Query  370  VSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALS-LFGFKLAPVNRRQRRMNKA  546
              S     I  L+SSC  F PC  Y N+       +NALS LFG     VNR QRR+N+A
Sbjct  62   PRSPSPPTIQALVSSCLDFGPCTHYSNTN------NNALSSLFGSNTLSVNRNQRRLNRA  115

Query  547  A-HSGKTMAVAVQPEKEALSKKKPIT  621
               SG  MAV ++ EKEA+  KKP T
Sbjct  116  TPSSGGAMAV-MEMEKEAMVNKKPPT  140



>ref|XP_006390366.1| hypothetical protein EUTSA_v10018368mg [Eutrema salsugineum]
 gb|ESQ27652.1| hypothetical protein EUTSA_v10018368mg [Eutrema salsugineum]
Length=545

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 71/140 (51%), Gaps = 14/140 (10%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLCTW VAACMS +    H G       S + +  +           G  S++ 
Sbjct  5    SSCYASPLCTWFVAACMSVS----HGGG-----DSRQAVALQSGRRSRRRRQLGQCSAVS  55

Query  385  GSG-IHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHSGK  561
            GSG I  L++SC  F PC  YY +           SLFG     +NR QRR+N+A+ SG 
Sbjct  56   GSGSIQALVTSCLDFGPCNHYYYNNNSNALS----SLFGSNSVSLNRHQRRLNRASTSGG  111

Query  562  TMAVAVQPEKEALSKKKPIT  621
             MAVA+  EKEA   KKP T
Sbjct  112  AMAVAMDMEKEATVNKKPPT  131



>emb|CDX68154.1| BnaA07g21940D [Brassica napus]
Length=546

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 72/147 (49%), Gaps = 27/147 (18%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +S  ASPLCT+ VAACMS +    H G      Q     RR+R       LG     
Sbjct  4    AAASSCYASPLCTFFVAACMSLS----HGGGGGDTRQPLGRSRRRRQ-----QLG---KC  51

Query  376  SLYGSGIHGLMSSCFAFEPCQEYY-NSKG----LPFFGDNALSLFGFKLAPVNRRQRRMN  540
            S  GS    L+SSC  F+PC  Y  N+KG     P FG N+LSL        NR+QR++N
Sbjct  52   SGSGSVQEALVSSCLEFKPCSHYNKNNKGNAFTSPLFGSNSLSL--------NRKQRKLN  103

Query  541  KAAHSGKT--MAVAVQPEKEALSKKKP  615
            +A  S     M VA+  EKE    KKP
Sbjct  104  RATSSSSDGAMGVAMGMEKEGTVDKKP  130



>emb|CDX85866.1| BnaC06g22680D [Brassica napus]
Length=539

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 30/145 (21%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +S  ASPLCT+ VAACMS +      G +   F   R  RR++ L      G G + 
Sbjct  4    AAASSCYASPLCTFFVAACMSLS---HGGGDTRQAFGRSR--RRRQQLGKCS--GSGSI-  55

Query  376  SLYGSGIHGLMSSCFAFEPCQEYY-NSKG--LPFFGDNALSLFGFKLAPVNRRQRRMNKA  546
                     L+SSC  F+PC  Y  N+KG   P  G N+LSL        NR+QR++N+A
Sbjct  56   ---------LVSSCLEFKPCSHYNKNNKGNAFPLLGSNSLSL--------NRKQRKLNRA  98

Query  547  --AHSGKTMAVAVQPEKEALSKKKP  615
              + SG  MAVA+  EKE    KKP
Sbjct  99   TSSSSGGAMAVAMGMEKEGTVDKKP  123



>gb|AGC65509.1| keto acyl-acyl carrier protein synthase II [Carthamus tinctorius]
Length=546

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 75/142 (53%), Gaps = 12/142 (8%)
 Frame = +1

Query  202  VASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSL  381
            +A++ +S +CTWLVAACMS +C+     K  +   + R  R++R L+          ++ 
Sbjct  1    MAAASSSLVCTWLVAACMSVSCQHQMDSKQAAPRTNIRCARKRRLLSKCNASFRPSNTNT  60

Query  382  YGSGIHGLMSSCFAFEPCQEYY--NSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
              + I   MSSC +  PC  YY  +     FFG  +L    F+   V RR+R     A S
Sbjct  61   NTNTIDNFMSSCLS--PCDRYYPLSLSSSDFFGAASL----FRSTNVPRRRR----PAPS  110

Query  556  GKTMAVAVQPEKEALSKKKPIT  621
            G+ MAVA+QP  E ++KKKP T
Sbjct  111  GEAMAVAIQPSMETVTKKKPPT  132



>gb|KCW81914.1| hypothetical protein EUGRSUZ_C03291 [Eucalyptus grandis]
Length=526

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 76/133 (57%), Gaps = 10/133 (8%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSS  378
            M AS+VASPLCTWLVAACMS +CE+D   K P+     R  RR+  +             
Sbjct  1    MAASTVASPLCTWLVAACMSVSCERDGAAKRPASCGFSRRRRRRLPVPEC------SRGG  54

Query  379  LYGSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNAL-SLFGFKLAPVNRRQRRMNKA  546
               +   GL+SSC AFEPC E+Y+S+    L FFG++   SLFG +   +NRRQRR+N+A
Sbjct  55   GGSASSFGLVSSCLAFEPCSEFYSSRAASSLGFFGESGFASLFGSRNRQMNRRQRRLNRA  114

Query  547  AHSGKTMAVAVQP  585
              S  T    V P
Sbjct  115  PGSVVTGMGVVTP  127



>gb|AGG36014.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
Length=92

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 49/103 (48%), Gaps = 33/103 (32%)
 Frame = +1

Query  310  PRWLRRKRTLAWSGN---------------------LGGGFVSSLYGSGIHGLMSSCFAF  426
             RW RR++TL    N                     L    VS+L GS   GLMSSCFAF
Sbjct  2    SRWARRRKTLLAQYNSDSSNSIAAAGGGGGGSSTEFLSNSLVSTLCGSSFQGLMSSCFAF  61

Query  427  EPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
            EPC +YY+S GL            F+   +NR+QRR+N+ A S
Sbjct  62   EPCSQYYSSNGL------------FRSRNLNRKQRRLNRLALS  92



>gb|AGG36015.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
Length=92

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 49/103 (48%), Gaps = 33/103 (32%)
 Frame = +1

Query  310  PRWLRRKRTLAWSGN---------------------LGGGFVSSLYGSGIHGLMSSCFAF  426
             RW RR++TL    N                     L    VS+L GS   GLMSSCFAF
Sbjct  2    SRWARRRKTLLAQYNSDSSNSIAAAGGGGGGSGTEFLSNSLVSTLCGSSFQGLMSSCFAF  61

Query  427  EPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
            EPC +YY+S GL            F+   +NR+QRR+N+ A S
Sbjct  62   EPCSQYYSSNGL------------FRSRNLNRKQRRLNRLALS  92



>ref|XP_009380020.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=556

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 73/139 (53%), Gaps = 13/139 (9%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGG----  366
            M  ++VASPLCTW+VAA   ++     +   P      +  RR  T+A     G      
Sbjct  1    MAGAAVASPLCTWIVAAACMSSSAASDQAPPP------KSGRRWTTMAAPTRGGRAHPRR  54

Query  367  -FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVN-RRQRRM  537
              +S+   SGI G++S+C AFEPC ++  +   P FGD  L SLFG   A  +  R+R  
Sbjct  55   RLISANSNSGIQGIVSACLAFEPCADFRGAVASPLFGDGGLSSLFGLWNAEAHRWRRRTA  114

Query  538  NKAAHSGKTMAVAVQPEKE  594
               A SGK MAVA++P KE
Sbjct  115  RSRAVSGKVMAVALEPTKE  133



>ref|XP_011467455.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
 ref|XP_011467456.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=549

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +1

Query  373  SSLYGSGIHGLMSSCFAFEPCQEYYNSK----GLPFFGDNALSLFGFKLAPVN-RRQRRM  537
            SSL  S      SS  AFE C+ YYNSK     L  F +  +S FG + A  N RRQR+ 
Sbjct  49   SSLSVSATRNFSSSKLAFEHCEGYYNSKFLSEYLALFAEKNISFFGSRSAVSNTRRQRQK  108

Query  538  NKAAHSGKTMAVAVQPEKEALSKKKPI  618
            +  AHSGKT AVAVQ  +E  +KK+P+
Sbjct  109  DHIAHSGKTRAVAVQVAEEVTTKKRPL  135



>ref|XP_004305765.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=575

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +1

Query  373  SSLYGSGIHGLMSSCFAFEPCQEYYNSK----GLPFFGDNALSLFGFKLAPVN-RRQRRM  537
            SSL  S      SS  AFE C+ YYNSK     L  F +  +S FG + A  N RRQR+ 
Sbjct  75   SSLSVSATRNFSSSKLAFEHCEGYYNSKFLSEYLALFAEKNISFFGSRSAVSNTRRQRQK  134

Query  538  NKAAHSGKTMAVAVQPEKEALSKKKPI  618
            +  AHSGKT AVAVQ  +E  +KK+P+
Sbjct  135  DHIAHSGKTRAVAVQVAEEVTTKKRPL  161



>ref|XP_011467454.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=555

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +1

Query  373  SSLYGSGIHGLMSSCFAFEPCQEYYNSK----GLPFFGDNALSLFGFKLAPVN-RRQRRM  537
            SSL  S      SS  AFE C+ YYNSK     L  F +  +S FG + A  N RRQR+ 
Sbjct  55   SSLSVSATRNFSSSKLAFEHCEGYYNSKFLSEYLALFAEKNISFFGSRSAVSNTRRQRQK  114

Query  538  NKAAHSGKTMAVAVQPEKEALSKKKPI  618
            +  AHSGKT AVAVQ  +E  +KK+P+
Sbjct  115  DHIAHSGKTRAVAVQVAEEVTTKKRPL  141



>gb|AGG36013.1| beta-ketoacyl-ACP synthase II, partial [Jatropha platyphylla]
Length=92

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 48/103 (47%), Gaps = 33/103 (32%)
 Frame = +1

Query  310  PRWLRRKRTLAWSGN---------------------LGGGFVSSLYGSGIHGLMSSCFAF  426
             RW RR++TL    N                     L    VS+L GS   GLMSSC AF
Sbjct  2    SRWARRRKTLLAQYNSDSSNSIAAAGGGGGGSSTEFLSNSLVSTLCGSSFQGLMSSCLAF  61

Query  427  EPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
            EPC +YY+S GL            F+   +NR+QRR+N+ A S
Sbjct  62   EPCSQYYSSNGL------------FRSRNLNRKQRRLNRLAFS  92



>ref|NP_001290396.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Camelina 
sativa]
 ref|XP_010416356.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Camelina sativa]
 gb|AFU61919.1| beta-ketoacyl-ACP synthase II [Camelina sativa]
Length=556

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 72/146 (49%), Gaps = 16/146 (11%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLCTW VAACMS + E     ++    QS    RR+R L    +      S   
Sbjct  6    SSCYASPLCTWFVAACMSVSHEGGDSRQAAVALQSGGRSRRRRQLTKCSSASSPPRSPSP  65

Query  385  GSGIHGLMSSCFAFEPCQEY-----YNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAA  549
               I  L+SSC  F PC  Y      N+     FG N LSL        NR QRR+N+AA
Sbjct  66   PPTIQALVSSCLDFGPCTHYSNSNSNNNALSSLFGSNPLSL--------NRHQRRLNRAA  117

Query  550  --HSGKTMAVAVQPEKEALSKKKPIT  621
               SG  MAV ++ EKEA+  KKP T
Sbjct  118  SPSSGGAMAV-MEMEKEAMVNKKPPT  142



>gb|AGG35992.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
Length=94

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 48/105 (46%), Gaps = 35/105 (33%)
 Frame = +1

Query  310  PRWLRRKRTLAWSGN-----------------------LGGGFVSSLYGSGIHGLMSSCF  420
             RW RR++TL    N                       L    VS+L GS   GLMSSC 
Sbjct  2    SRWARRRKTLHAQYNSDSSNSIAAGGGGGGGGGYSTEFLSNSLVSTLCGSSFQGLMSSCL  61

Query  421  AFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
            AFEPC +YY+S GL            F+   +NR+QRR+N+ A S
Sbjct  62   AFEPCNQYYSSNGL------------FRSRNLNRKQRRLNRLALS  94



>gb|AGG35991.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
Length=94

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 48/105 (46%), Gaps = 35/105 (33%)
 Frame = +1

Query  310  PRWLRRKRTLAWSGN-----------------------LGGGFVSSLYGSGIHGLMSSCF  420
             RW RR++TL    N                       L    VS+L GS   GLMSSC 
Sbjct  2    SRWARRRKTLLAQYNSDSSNSIAAGGGGGGGGGSGTEFLSNSLVSTLCGSXFQGLMSSCL  61

Query  421  AFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
            AFEPC +YY+S GL            F+   +NR+QRR+N+ A S
Sbjct  62   AFEPCSQYYSSNGL------------FRSRNLNRKQRRLNRLALS  94



>gb|AGG35993.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG35994.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG35995.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG35996.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG35997.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG35998.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG35999.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36000.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36001.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36002.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36003.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36004.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36005.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36006.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36007.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36008.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36009.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36010.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36011.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
 gb|AGG36012.1| beta-ketoacyl-ACP synthase II, partial [Jatropha curcas]
Length=94

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 48/105 (46%), Gaps = 35/105 (33%)
 Frame = +1

Query  310  PRWLRRKRTLAWSGN-----------------------LGGGFVSSLYGSGIHGLMSSCF  420
             RW RR++TL    N                       L    VS+L GS   GLMSSC 
Sbjct  2    SRWARRRKTLHAQYNSDSSNSIAAGGGGGGGGGYSTEFLSNSLVSTLCGSSFQGLMSSCL  61

Query  421  AFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
            AFEPC +YY+S GL            F+   +NR+QRR+N+ A S
Sbjct  62   AFEPCSQYYSSNGL------------FRSRNLNRKQRRLNRLALS  94



>ref|XP_011006167.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
 ref|XP_011006168.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
Length=549

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 67/152 (44%), Gaps = 33/152 (22%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            ++S++SPLCTWL  ACMS  C ++          +    R+ +  A            ++
Sbjct  4    SASLSSPLCTWLFTACMSVTCAEERAHALSPPSSNSSRRRKAKAAALPMKCCCSIRGIVH  63

Query  385  GS------------GIHGLMSSCFAF-EPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRR  525
             S               G MSSC A  EPC  YY S GL                     
Sbjct  64   SSPSNDNSNNKSMLSFKGSMSSCLADNEPCSRYYASGGL--------------------L  103

Query  526  QRRMNKAAHSGKTMAVAVQPEKEALSKKKPIT  621
            +RR++  A SG+ MAVAVQP +E ++KKKP+T
Sbjct  104  RRRLSPPATSGQAMAVAVQPTEEVVTKKKPLT  135



>gb|AAA33872.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR01158.1| plastid 3-keto-acyl-ACP synthase II [Ricinus communis]
Length=535

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 41/74 (55%), Gaps = 14/74 (19%)
 Frame = +1

Query  403  LMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPV--NRRQRRMNKAAHSGKTMAVA  576
            LMSSC AFEPC  YY+S GL            F   P+   R  R  ++   SG+ MAVA
Sbjct  59   LMSSCLAFEPCSHYYSSNGL------------FPNTPLLPKRHPRLHHRLPRSGEAMAVA  106

Query  577  VQPEKEALSKKKPI  618
            VQPEKE  + KKP+
Sbjct  107  VQPEKEVATNKKPL  120



>gb|AAB37270.1| beta-ketoacyl-ACP synthase II [Cuphea wrightii]
Length=517

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 61/140 (44%), Gaps = 40/140 (29%)
 Frame = +1

Query  208  SSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLYG  387
            ++V+SP CTWLVAACMS + + D           PR L  KR              SL G
Sbjct  2    AAVSSPFCTWLVAACMSTSFDND-----------PRSLSNKRVRLSRRRRTLSSHCSLRG  50

Query  388  SGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNA--LSLFGFKLAPVNRRQRRMNKAAHSGK  561
            S    L                      GDN    SLFG      N   RR+ +A+ SG+
Sbjct  51   STFQCL----------------------GDNVGFDSLFG-----SNHGHRRLGRASRSGE  83

Query  562  TMAVAVQPEKEALSKKKPIT  621
             MAVA+QP  E  +KKKP+T
Sbjct  84   AMAVAMQPAPEVSTKKKPVT  103



>emb|CDX73128.1| BnaC06g35760D [Brassica napus]
Length=544

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 70/149 (47%), Gaps = 30/149 (20%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQS----PRWLRRKRTLAWSGNLGG  363
            A  +S  ASPLCTW VAACMS +       ++ S+  +        +  + LA SG+   
Sbjct  5    AASSSCYASPLCTWFVAACMSVSHGGGDSRQAVSLKSTGRSRRSRRQLTKCLALSGS---  61

Query  364  GFVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVNRRQRRMN  540
                   GS    L+++ F   PC  Y           NAL SLFG     +NR QRR+N
Sbjct  62   -------GSVQEALVTTSFG--PCNHY-----------NALSSLFGSNSVSLNRNQRRLN  101

Query  541  KAAHS--GKTMAVAVQPEKEALSKKKPIT  621
             AA S  G  MAVA+  +KEA    KP T
Sbjct  102  LAAASSGGGAMAVAMDMQKEAKVDNKPPT  130



>ref|XP_010459588.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=449

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 72/139 (52%), Gaps = 31/139 (22%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLC WLV ACMS+  ++        + QS     R+ TL  + +    F SS  
Sbjct  7    SSCYASPLCDWLVGACMSSGGDR--------LLQSDTKSSRRSTL-LTKSKCSSFSSSSS  57

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNKAAHSG  558
             +G  GL+S+C          NS  LP  FF  N  S F       NR+Q R+N+A+ SG
Sbjct  58   TNGSAGLVSNC----------NSNALPSLFFESNNNSYF-------NRKQGRLNQASSSG  100

Query  559  KTMAVAVQPEKEALSKKKP  615
            +   VA++ EKEA+ KKKP
Sbjct  101  Q---VALEMEKEAMVKKKP  116



>ref|XP_010459587.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=532

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 72/139 (52%), Gaps = 31/139 (22%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLC WLV ACMS+  ++        + QS     R+ TL  + +    F SS  
Sbjct  7    SSCYASPLCDWLVGACMSSGGDR--------LLQSDTKSSRRSTL-LTKSKCSSFSSSSS  57

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNKAAHSG  558
             +G  GL+S+C          NS  LP  FF  N  S F       NR+Q R+N+A+ SG
Sbjct  58   TNGSAGLVSNC----------NSNALPSLFFESNNNSYF-------NRKQGRLNQASSSG  100

Query  559  KTMAVAVQPEKEALSKKKP  615
            +   VA++ EKEA+ KKKP
Sbjct  101  Q---VALEMEKEAMVKKKP  116



>ref|XP_010498339.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=448

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 67/139 (48%), Gaps = 32/139 (23%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLC WLV ACMS+  ++        + QS     R+ TL           S+  
Sbjct  7    SSCYASPLCDWLVGACMSSGGDR--------LRQSDTKTSRRSTLLTKSKCSAFSSSTTN  58

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNKAAHSG  558
            GS   GL+S+C          N+  L   FF  N  + F       NR+QRR+N+A+ SG
Sbjct  59   GSA--GLVSNC----------NNNALSSLFFESNNNTYF-------NRKQRRLNQASSSG  99

Query  559  KTMAVAVQPEKEALSKKKP  615
            +   V ++ EKEA  KKKP
Sbjct  100  Q---VTLEMEKEATVKKKP  115



>ref|XP_010498338.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=531

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 67/139 (48%), Gaps = 32/139 (23%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLC WLV ACMS+  ++        + QS     R+ TL           S+  
Sbjct  7    SSCYASPLCDWLVGACMSSGGDR--------LRQSDTKTSRRSTLLTKSKCSAFSSSTTN  58

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNKAAHSG  558
            GS   GL+S+C          N+  L   FF  N  + F       NR+QRR+N+A+ SG
Sbjct  59   GSA--GLVSNC----------NNNALSSLFFESNNNTYF-------NRKQRRLNQASSSG  99

Query  559  KTMAVAVQPEKEALSKKKP  615
            +   V ++ EKEA  KKKP
Sbjct  100  Q---VTLEMEKEATVKKKP  115



>ref|XP_010477132.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=445

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 66/142 (46%), Gaps = 34/142 (24%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +S  ASPLC WLV ACMS   ++        + QS     R+ TL     L     S
Sbjct  3    AGASSCYASPLCDWLVGACMSTGGDR--------LLQSDTKTSRRSTL-----LTKSKCS  49

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNKAA  549
            S Y +G  GL+S+C          N+  L   FF  N  + F       NR+QRR+N+A+
Sbjct  50   SSYTNGSAGLVSNC----------NNNALSSLFFESNNNTHF-------NRKQRRLNQAS  92

Query  550  HSGKTMAVAVQPEKEALSKKKP  615
              G+        EKEA+ KKKP
Sbjct  93   SFGQV--TLEMEEKEAIVKKKP  112



>ref|XP_010477131.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=528

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 66/142 (46%), Gaps = 34/142 (24%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +S  ASPLC WLV ACMS   ++        + QS     R+ TL     L     S
Sbjct  3    AGASSCYASPLCDWLVGACMSTGGDR--------LLQSDTKTSRRSTL-----LTKSKCS  49

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGLP--FFGDNALSLFGFKLAPVNRRQRRMNKAA  549
            S Y +G  GL+S+C          N+  L   FF  N  + F       NR+QRR+N+A+
Sbjct  50   SSYTNGSAGLVSNC----------NNNALSSLFFESNNNTHF-------NRKQRRLNQAS  92

Query  550  HSGKTMAVAVQPEKEALSKKKP  615
              G+        EKEA+ KKKP
Sbjct  93   SFGQV--TLEMEEKEAIVKKKP  112



>gb|KHG27960.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic -like 
protein [Gossypium arboreum]
Length=525

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 67/143 (47%), Gaps = 39/143 (27%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS+ SPLC               ++ +SP +     W+  +R    S    GG  +S  
Sbjct  4    SSSLVSPLC---------------NQSQSPLL----HWVADRRKAFISSPCNGGSATSKD  44

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNALSLFGFKLAPVNRRQRRMNK-AAH  552
            G           AFEPC EYY+SK      FFG   +S        +N +  R+N+  A 
Sbjct  45   GG----------AFEPCNEYYSSKNGSFSSFFGSKNVSF------NINHKHPRLNRGVAR  88

Query  553  SGKTMAVAVQPEKEALSKKKPIT  621
            SG+ MAVAV+P +E ++K+KP T
Sbjct  89   SGQAMAVAVEPAREIMTKQKPPT  111



>emb|CDY45409.1| BnaA07g31890D [Brassica napus]
Length=536

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 67/146 (46%), Gaps = 31/146 (21%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +S  ASPLCTW VAACMS +       ++ ++  + R  R ++ L            
Sbjct  4    AAASSCYASPLCTWFVAACMSVSHGGGDSRQAVALKSTGRSRRSRQQL------------  51

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVNRRQRRMNKAAH  552
                +   G  SS  +F PC  Y           NAL SLFG     +NR QRR+ +AA 
Sbjct  52   ----TKCSGSGSSTTSFGPCNHY-----------NALSSLFGSNSVSLNRNQRRLTRAAT  96

Query  553  S---GKTMAVAVQPEKEALSKKKPIT  621
            +   G  MAVA+  EKEA    KP T
Sbjct  97   ASSGGGAMAVAMDMEKEAKVDNKPPT  122



>gb|AIL53812.1| beta-ketoacyl-[acyl carrier protein] synthase II [Gossypium hirsutum]
Length=525

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 67/143 (47%), Gaps = 39/143 (27%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS+ SPLC               ++ +SP +     W+  +R    S    GG  +S  
Sbjct  4    SSSLVSPLC---------------NQSQSPLL----HWIGDRRKAFISPPCNGGSATSKD  44

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNALSLFGFKLAPVNRRQRRMNK-AAH  552
            G           AFEPC EYY+SK      FFG   +S        +N +  R+N+  A 
Sbjct  45   GG----------AFEPCNEYYSSKNGSFSSFFGSKNVSF------NINHKHPRLNRGVAR  88

Query  553  SGKTMAVAVQPEKEALSKKKPIT  621
            SG+ MAVAV+P +E ++K+KP T
Sbjct  89   SGQAMAVAVEPAREIMTKQKPPT  111



>ref|XP_010428495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Camelina sativa]
 gb|AFU61917.1| beta-ketoacyl-ACP synthase II [Camelina sativa]
Length=553

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 67/145 (46%), Gaps = 17/145 (12%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +S  ASPLCTW VAACMS +   D  G S     + +   R R              S  
Sbjct  6    SSCYASPLCTWFVAACMSVS--HDGGGDSRQAAVALQSGGRSRRRRQLTKCSASASRSPS  63

Query  385  GSGIHGLMSSCFAFEPCQEY---YNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAA--  549
               I  L+SSC  F PC  Y    N+     FG + LSL        NR QRR+N+A   
Sbjct  64   PPTIQALVSSCLDFGPCTHYSNSNNNALSSLFGSSTLSL--------NRHQRRLNRATSS  115

Query  550  -HSGKTMAVAVQPEKEALSKKKPIT  621
              SG  MAV ++ EKEA+  KKP T
Sbjct  116  SSSGGAMAV-MEMEKEAMVNKKPPT  139



>gb|KJB27218.1| hypothetical protein B456_004G285300 [Gossypium raimondii]
 gb|KJB27219.1| hypothetical protein B456_004G285300 [Gossypium raimondii]
Length=444

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 66/143 (46%), Gaps = 39/143 (27%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS+ SPLC               ++ +SP +     W+  +R    S    GG  +S  
Sbjct  4    SSSLVSPLC---------------NQSQSPLL----HWIGDRRKAFISPPCNGGSATSKD  44

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNALSLFGFKLAPVNRRQRRMNKA-AH  552
            G           AFEPC EYY+SK      FFG   +S        +N +  R+N+  A 
Sbjct  45   GG----------AFEPCNEYYSSKNGSFSSFFGSKNVSF------NINHKHPRLNRGVAR  88

Query  553  SGKTMAVAVQPEKEALSKKKPIT  621
            SG+ MAVAV+P +E  +K+KP T
Sbjct  89   SGQAMAVAVEPAREIRTKQKPPT  111



>gb|KJB27220.1| hypothetical protein B456_004G285300 [Gossypium raimondii]
Length=494

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 66/143 (46%), Gaps = 39/143 (27%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS+ SPLC               ++ +SP +     W+  +R    S    GG  +S  
Sbjct  4    SSSLVSPLC---------------NQSQSPLL----HWIGDRRKAFISPPCNGGSATSKD  44

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNALSLFGFKLAPVNRRQRRMNK-AAH  552
            G           AFEPC EYY+SK      FFG   +S        +N +  R+N+  A 
Sbjct  45   GG----------AFEPCNEYYSSKNGSFSSFFGSKNVSF------NINHKHPRLNRGVAR  88

Query  553  SGKTMAVAVQPEKEALSKKKPIT  621
            SG+ MAVAV+P +E  +K+KP T
Sbjct  89   SGQAMAVAVEPAREIRTKQKPPT  111



>gb|KJB27217.1| hypothetical protein B456_004G285300 [Gossypium raimondii]
Length=423

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 66/143 (46%), Gaps = 39/143 (27%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS+ SPLC               ++ +SP +     W+  +R    S    GG  +S  
Sbjct  4    SSSLVSPLC---------------NQSQSPLL----HWIGDRRKAFISPPCNGGSATSKD  44

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNALSLFGFKLAPVNRRQRRMNK-AAH  552
            G           AFEPC EYY+SK      FFG   +S        +N +  R+N+  A 
Sbjct  45   GG----------AFEPCNEYYSSKNGSFSSFFGSKNVSF------NINHKHPRLNRGVAR  88

Query  553  SGKTMAVAVQPEKEALSKKKPIT  621
            SG+ MAVAV+P +E  +K+KP T
Sbjct  89   SGQAMAVAVEPAREIRTKQKPPT  111



>gb|KJB27216.1| hypothetical protein B456_004G285300 [Gossypium raimondii]
Length=525

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 66/143 (46%), Gaps = 39/143 (27%)
 Frame = +1

Query  205  ASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVSSLY  384
            +SS+ SPLC               ++ +SP +     W+  +R    S    GG  +S  
Sbjct  4    SSSLVSPLC---------------NQSQSPLL----HWIGDRRKAFISPPCNGGSATSKD  44

Query  385  GSGIHGLMSSCFAFEPCQEYYNSKG---LPFFGDNALSLFGFKLAPVNRRQRRMNKA-AH  552
            G           AFEPC EYY+SK      FFG   +S        +N +  R+N+  A 
Sbjct  45   GG----------AFEPCNEYYSSKNGSFSSFFGSKNVSF------NINHKHPRLNRGVAR  88

Query  553  SGKTMAVAVQPEKEALSKKKPIT  621
            SG+ MAVAV+P +E  +K+KP T
Sbjct  89   SGQAMAVAVEPAREIRTKQKPPT  111



>gb|EPS61225.1| hypothetical protein M569_13573, partial [Genlisea aurea]
Length=314

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 20/139 (14%)
 Frame = +1

Query  211  SVASPLCTWLVAACMSAACEKDHRGK---SPSIFQSPRWLRRKRTLAWSGNLGGGFVSSL  381
            S+A+ +C+W +AACMS ACEK+       S +   + R  RR++ +          VS  
Sbjct  5    SMAALVCSWWMAACMSVACEKESLVSAVPSSAFRLTERGTRRRKRIL------SNCVSDY  58

Query  382  YGSGIHGLMSSCFAFEPCQEY--YNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
              S +  L++SCF   PC E+  Y+      FG      FG   A V+RR RR  + + +
Sbjct  59   --SAVRNLVTSCFDLGPCDEFCKYSRSADFLFG------FGSSDAGVHRRNRRPLRTS-A  109

Query  556  GKTMAVAVQPEKEALSKKK  612
                A+ V P +E  SKK+
Sbjct  110  ILVAAIPVNPSREDSSKKQ  128



>ref|XP_004169836.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Cucumis sativus]
Length=564

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 75/155 (48%), Gaps = 25/155 (16%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDH-----------RGKSPSIFQSPRWLRRKRT---  336
            M +  V+SP CTWLVAACMSA C KDH              S S  +S    RRK +   
Sbjct  1    MASLPVSSPFCTWLVAACMSATCFKDHSLNASSIPHSSSSSSSSSKRSISTSRRKHSFSK  60

Query  337  -LAWSGNLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYY-NSKGLPFFGDNALSLFGFKLA  510
              + +     G VSS     IH L+          +YY NS   P   +    LF     
Sbjct  61   CFSITSQFNTGLVSSSPRFNIHDLL--------LDDYYSNSTTYPLQYNPFSLLFPPTSL  112

Query  511  PVN-RRQRRMNKAAHSGKTMAVAVQPEKEALSKKK  612
            P++ RR+RR N+A  SG+T+A+AV P +E  SKKK
Sbjct  113  PLHSRRRRRTNRALRSGETVAIAVHPAEEVGSKKK  147



>ref|XP_004144052.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66328.1| hypothetical protein Csa_1G597750 [Cucumis sativus]
Length=565

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 75/156 (48%), Gaps = 26/156 (17%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDH------------RGKSPSIFQSPRWLRRKRT--  336
            M +  V+SP CTWLVAACMSA C KDH               S S  +S    RRK +  
Sbjct  1    MASLPVSSPFCTWLVAACMSATCFKDHSLNASSIPHSSSSSSSSSSKRSISTSRRKHSFS  60

Query  337  --LAWSGNLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYY-NSKGLPFFGDNALSLFGFKL  507
               + +     G VSS     IH L+          +YY NS   P   +    LF    
Sbjct  61   KCFSITSQFNTGLVSSSPRFNIHDLL--------LDDYYSNSTTYPLQYNPFSLLFPPTS  112

Query  508  APVN-RRQRRMNKAAHSGKTMAVAVQPEKEALSKKK  612
             P++ RR+RR N+A  SG+T+A+AV P +E  SKKK
Sbjct  113  LPLHSRRRRRTNRALRSGETVAIAVHPAEEVGSKKK  148



>ref|XP_009106152.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Brassica rapa]
Length=542

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 67/146 (46%), Gaps = 25/146 (17%)
 Frame = +1

Query  196  AMVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            A  +S  ASPLCTW VAACMS +       ++ ++  S R  R ++ L      G     
Sbjct  4    AAASSCYASPLCTWFVAACMSVSHGGGDSRQAVALKSSGRSRRSRQQLTKCSGSGSSVQQ  63

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNAL-SLFGFKLAPVNRRQRRMNK---  543
            +L  +          +F PC  Y           NAL SLFG     +NR QRR+ +   
Sbjct  64   ALVTT----------SFGPCNHY-----------NALSSLFGSNSVSLNRNQRRLTRAAT  102

Query  544  AAHSGKTMAVAVQPEKEALSKKKPIT  621
            A+  G  MAVA+  EKEA+   KP T
Sbjct  103  ASSGGAAMAVAMDMEKEAMVDNKPPT  128



>ref|XP_008450963.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Cucumis melo]
Length=566

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 73/157 (46%), Gaps = 27/157 (17%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKS-------------PSIFQSPRWLRRKRT-  336
            M +  V+SP CTWLVAACMSA C KDH   +              S  +S    RRK + 
Sbjct  1    MASLPVSSPFCTWLVAACMSATCFKDHSPNASSIPHSSSSSSSSSSSKRSISTSRRKHSF  60

Query  337  ---LAWSGNLGGGFVSSLYGSGIHGLMSSCFAFEPCQEYY-NSKGLPF-FGDNALSLFGF  501
                + +     G VSS     IH L+          +YY NS   P  +   +L     
Sbjct  61   SKCFSITSQFNTGLVSSFPRFNIHDLL--------LDDYYSNSTTYPLQYNPFSLLFRPT  112

Query  502  KLAPVNRRQRRMNKAAHSGKTMAVAVQPEKEALSKKK  612
               P  RR+RR N+A  SG+T+A+A+ P ++  SKKK
Sbjct  113  SFPPNTRRRRRTNRALRSGETVAIAIHPAEDVGSKKK  149



>gb|AAC04692.1| beta-ketoacyl-ACP synthase II [Perilla frutescens]
Length=530

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 62/135 (46%), Gaps = 27/135 (20%)
 Frame = +1

Query  241  VAACMSAACEKDHRGKSPSIFQS-----PRWL--RRKRTLAWSGNLGGGFVSSLYGSGIH  399
            +AACMS  CE++    + S   S      +W   RRKR LA                 I 
Sbjct  1    MAACMSVTCERESGVSALSTTSSNSRRLTKWAAHRRKRVLAKCA------------PRIR  48

Query  400  GLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNR-RQRRMNKAAHSGKTMAVA  576
             L+ S  + EP    + S    FFG      F  + AP+ R RQ+ ++ +A+SG+ MAVA
Sbjct  49   NLVDSSLSLEPRHHLHKSHEC-FFG------FESRNAPMQRGRQKLLHPSAYSGEMMAVA  101

Query  577  VQPEKEALSKKKPIT  621
            V P  E   KKKP T
Sbjct  102  VNPAMEVSPKKKPPT  116



>ref|XP_010104609.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
 gb|EXC01340.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
Length=484

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 60/136 (44%), Gaps = 35/136 (26%)
 Frame = +1

Query  199  MVASSVASPLCTWLVAACMSAACEKDHRGKSPSIFQSPR----WLRRKRTLAWSGNLGGG  366
            M ASS+ SPL T LV +  SA  EKDH+  S S+FQS +    W R K+ +     L   
Sbjct  1    MAASSIVSPLHTLLVDSFTSARYEKDHQIMS-SLFQSSKRPSHWTRAKKLIPKHSKL---  56

Query  367  FVSSLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKA  546
                    G+ G ++                   FGDNALS FG K A   R  R MN  
Sbjct  57   -------QGVCGTLT------------------IFGDNALSPFGSKTA--TRPNRLMNCD  89

Query  547  AHSGKTMAVAVQPEKE  594
            A+ GK    +V   +E
Sbjct  90   ANCGKNADASVGSTEE  105



>ref|XP_009390876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=528

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 66/140 (47%), Gaps = 31/140 (22%)
 Frame = +1

Query  199  MVASSVASPLCTWLV-AACMSAACEKDHRGKSPSIFQSPRWLRRKRTLAWSGNLGGGFVS  375
            M  ++VASPLCT LV AACMS++ E D R  + S  +       +        +     S
Sbjct  1    MAGAAVASPLCTRLVAAACMSSSAECDRRRAAGSRRRRRTTATAE--------IRPPLDS  52

Query  376  SLYGSGIHGLMSSCFAFEPCQEYYNSKGLPFFGDNALSLFGFKLAPVNRRQRRMNKAAHS  555
             ++  GI G MSSC AFE                 A    G   A  NRR+RR       
Sbjct  53   DIFRFGIQGPMSSCPAFE-----------------AAPSLGLSKAEANRRRRR----TAC  91

Query  556  GKTMAVAVQPEKE-ALSKKK  612
            GK MAVA++P KE A++KK+
Sbjct  92   GKAMAVALEPAKELAVNKKR  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950