BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049J16

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234196.1|  FtsH-like protein precursor                        290   2e-89   
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    279   3e-85   Solanum tuberosum [potatoes]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    265   4e-80   Capsicum annuum
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    259   8e-78   Nicotiana sylvestris
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         258   3e-77   Jatropha curcas
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    257   6e-77   Sesamum indicum [beniseed]
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    255   4e-76   Nicotiana tomentosiformis
ref|XP_002510649.1|  Cell division protease ftsH, putative              253   2e-75   
gb|KJB14313.1|  hypothetical protein B456_002G118800                    249   1e-74   Gossypium raimondii
gb|KJB14312.1|  hypothetical protein B456_002G118800                    248   1e-74   Gossypium raimondii
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    250   2e-74   Nicotiana tomentosiformis
gb|KJB14314.1|  hypothetical protein B456_002G118800                    249   2e-74   Gossypium raimondii
gb|KJB14315.1|  hypothetical protein B456_002G118800                    249   3e-74   Gossypium raimondii
emb|CDP03477.1|  unnamed protein product                                238   3e-74   Coffea canephora [robusta coffee]
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    249   3e-74   Gossypium arboreum [tree cotton]
emb|CDP07308.1|  unnamed protein product                                249   5e-74   Coffea canephora [robusta coffee]
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    248   1e-73   Nicotiana sylvestris
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    248   1e-73   Nicotiana tabacum [American tobacco]
ref|XP_007017988.1|  FTSH protease 1 isoform 2                          245   2e-73   
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       246   8e-73   
emb|CDP18582.1|  unnamed protein product                                233   1e-72   Coffea canephora [robusta coffee]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    244   4e-72   Genlisea aurea
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    244   4e-72   Nelumbo nucifera [Indian lotus]
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    241   7e-71   Gossypium arboreum [tree cotton]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    239   3e-70   Sesamum indicum [beniseed]
gb|KDO85047.1|  hypothetical protein CISIN_1g004921mg                   237   3e-70   Citrus sinensis [apfelsine]
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    238   9e-70   Citrus sinensis [apfelsine]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             238   9e-70   Citrus clementina [clementine]
gb|KJB57986.1|  hypothetical protein B456_009G188700                    234   1e-69   Gossypium raimondii
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    237   2e-69   Cucumis sativus [cucumbers]
gb|EYU17514.1|  hypothetical protein MIMGU_mgv1a004291mg                232   6e-69   Erythranthe guttata [common monkey flower]
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    236   6e-69   Cucumis melo [Oriental melon]
gb|KJB57987.1|  hypothetical protein B456_009G188700                    234   1e-68   Gossypium raimondii
emb|CAN74077.1|  hypothetical protein VITISV_000978                     234   1e-68   Vitis vinifera
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    234   4e-68   
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    234   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    233   7e-68   Vitis vinifera
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    231   2e-67   
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    231   4e-67   Fragaria vesca subsp. vesca
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    231   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    230   7e-67   Eucalyptus grandis [rose gum]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             230   1e-66   Prunus persica
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    229   2e-66   Prunus mume [ume]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    227   7e-66   Populus euphratica
ref|XP_002301927.1|  Cell division protein ftsH                         226   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            221   1e-63   Morus notabilis
dbj|BAH56755.1|  AT5G42270                                              218   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             219   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             218   2e-62   
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         213   5e-62   Medicago truncatula
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                215   3e-61   Erythranthe guttata [common monkey flower]
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                214   3e-61   Erythranthe guttata [common monkey flower]
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         213   2e-60   Medicago truncatula
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    211   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    210   1e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             210   1e-59   Capsella rubella
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    208   6e-59   Populus euphratica
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    208   1e-58   Medicago sativa [alfalfa]
ref|XP_002306970.2|  Cell division protein ftsH                         207   1e-58   Populus trichocarpa [western balsam poplar]
emb|CDY01840.1|  BnaC06g28800D                                          203   4e-57   
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    199   2e-55   Glycine max [soybeans]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             197   6e-55   Eutrema salsugineum [saltwater cress]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    197   6e-55   
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    197   9e-55   Brassica rapa
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    196   1e-54   Cicer arietinum [garbanzo]
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    196   2e-54   Arabis alpina [alpine rockcress]
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             195   3e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    195   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    195   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             194   9e-54   Phaseolus vulgaris [French bean]
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    194   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    194   1e-53   Phoenix dactylifera
emb|CDX96068.1|  BnaA07g26630D                                          191   9e-53   
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    191   2e-52   Elaeis guineensis
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             190   3e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    187   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             186   1e-50   Capsella rubella
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    184   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     182   1e-49   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    179   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW75732.1|  hypothetical protein ZEAMMB73_601488                    172   2e-47   
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          174   9e-47   Amborella trichopoda
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    174   1e-46   
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    172   5e-46   Setaria italica
ref|NP_001058625.1|  Os06g0725900                                       172   6e-46   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          172   6e-46   Oryza sativa Japonica Group [Japonica rice]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             172   7e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAA68141.1|  chloroplast FtsH protease                              172   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             163   6e-43   
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    162   3e-42   Brachypodium distachyon [annual false brome]
ref|XP_001760664.1|  predicted protein                                  148   2e-37   
ref|XP_001753657.1|  predicted protein                                  145   1e-36   
gb|KIZ07525.1|  cell division protease FtsH                             136   2e-36   Monoraphidium neglectum
emb|CEF99105.1|  P-loop containing nucleoside triphosphate hydrolase    142   1e-35   Ostreococcus tauri
ref|XP_001690889.1|  membrane AAA-metalloprotease                       142   3e-35   Chlamydomonas reinhardtii
ref|XP_005843263.1|  hypothetical protein CHLNCDRAFT_141387             137   3e-35   Chlorella variabilis
gb|KIZ03250.1|  cell division protease FtsH                             142   4e-35   Monoraphidium neglectum
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              142   4e-35   Volvox carteri f. nagariensis
ref|XP_003081278.1|  FTSH_MEDSA Cell division protein ftsH homolo...    141   7e-35   
ref|XP_003057154.1|  predicted protein                                  141   8e-35   Micromonas pusilla CCMP1545
ref|XP_007510744.1|  cell division protein FtsH2                        137   2e-33   Bathycoccus prasinos
ref|XP_005650371.1|  membrane AAA-metalloprotease                       134   3e-32   Coccomyxa subellipsoidea C-169
ref|XP_001419590.1|  predicted protein                                  134   3e-32   Ostreococcus lucimarinus CCE9901
emb|CAA73318.1|  ATPase                                                 132   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 129   2e-30   Micromonas commoda
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    118   1e-26   Auxenochlorella protothecoides
gb|EEC81336.1|  hypothetical protein OsI_24516                          115   1e-25   Oryza sativa Indica Group [Indian rice]
gb|AFW63099.1|  hypothetical protein ZEAMMB73_047704                  97.1    3e-20   
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit         77.8    7e-13   Cyanobacterium aponinum
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH               74.3    7e-12   Dactylococcopsis salina
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit         73.9    1e-11   Halothece sp. PCC 7418
ref|WP_015955558.1|  cell division protein FtsH                       73.2    2e-11   Cyanothece sp. PCC 7424
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH               71.2    7e-11   Synechocystis sp. PCC 7509
ref|WP_013320241.1|  cell division protein FtsH                       71.2    9e-11   Cyanothece sp. PCC 7822
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit         70.1    2e-10   Crinalium epipsammum
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit         69.7    2e-10   Cyanobacteria [blue-green bacteria]
ref|WP_036001623.1|  cell division protein FtsH                       68.9    4e-10   [Leptolyngbya] sp. JSC-1
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit         68.6    6e-10   
ref|WP_044492620.1|  cell division protein FtsH                       68.2    8e-10   Moorea producens
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit              68.2    8e-10   Moorea producens 3L
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH         67.8    1e-09   Planktothrix
ref|WP_027255466.1|  cell division protein FtsH                       67.8    1e-09   Planktothrix agardhii
ref|WP_042152619.1|  cell division protein FtsH                       67.8    1e-09   Planktothrix agardhii
ref|WP_027249137.1|  cell division protein FtsH                       67.8    1e-09   Planktothrix agardhii
ref|WP_026786321.1|  cell division protein FtsH                       67.4    1e-09   Planktothrix rubescens
ref|NP_001173800.1|  Os04g0220500                                     67.4    2e-09   
ref|WP_017293936.1|  cell division protein FtsH                       67.0    2e-09   Geminocystis herdmanii
gb|EEE60537.1|  hypothetical protein OsJ_13877                        66.6    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit         66.2    3e-09   Calothrix sp. PCC 7507
ref|WP_012627305.1|  cell division protein FtsH                       65.9    4e-09   Cyanothece sp. PCC 7425
ref|XP_005713345.1|  cell division protein FtsH                       65.5    5e-09   Chondrus crispus [carageen]
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435            65.5    6e-09   Guillardia theta CCMP2712
ref|WP_002742170.1|  cell division protein FtsH                       65.5    6e-09   Microcystis
ref|WP_002793446.1|  cell division protein FtsH                       65.5    6e-09   Microcystis aeruginosa
ref|WP_002797753.1|  cell division protein FtsH                       65.5    6e-09   Microcystis aeruginosa
ref|WP_002801795.1|  cell division protein FtsH                       65.5    6e-09   Microcystis aeruginosa
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...  65.5    6e-09   Microcystis aeruginosa
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3        65.1    7e-09   Microcystis aeruginosa
dbj|GAL91410.1|  cell division protein FtsH                           65.1    7e-09   Microcystis aeruginosa NIES-44
ref|WP_017303138.1|  cell division protein FtsH                       65.1    7e-09   Spirulina subsalsa
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH         65.1    7e-09   Microcystis
ref|WP_012264056.1|  cell division protein FtsH                       65.1    8e-09   Microcystis aeruginosa
ref|WP_006623490.1|  cell division protein FtsH                       64.3    1e-08   
ref|WP_006618677.1|  FtsH peptidase                                   64.3    1e-08   Arthrospira platensis
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH         64.3    1e-08   Arthrospira
ref|WP_002771354.1|  cell division protein FtsH                       63.9    2e-08   Microcystis aeruginosa
ref|WP_035174132.1|  cell division protein FtsH                       58.9    3e-08   
ref|XP_005708438.1|  AAA-type ATPase                                  63.2    4e-08   Galdieria sulphuraria
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH         62.8    4e-08   Kamptonema
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit         62.4    6e-08   Geitlerinema sp. PCC 7407
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit         62.4    7e-08   Oscillatoria acuminata
ref|WP_017653544.1|  cell division protein FtsH                       62.4    7e-08   Fortiea contorta
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit         62.4    7e-08   Oscillatoria nigro-viridis
ref|WP_006633639.1|  cell division protein FtsH                       62.0    7e-08   Microcoleus vaginatus
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH               62.0    7e-08   Leptolyngbya sp. PCC 6406
ref|WP_009782358.1|  cell division protein FtsH                       62.0    9e-08   Lyngbya sp. PCC 8106
ref|WP_006198086.1|  cell division protein FtsH                       61.6    9e-08   Nodularia spumigena
ref|WP_041036156.1|  cell division protein FtsH                       61.6    1e-07   Tolypothrix campylonemoides
ref|WP_009341877.1|  cell division protein FtsH                       61.6    1e-07   Aphanizomenonaceae
ref|WP_028090468.1|  cell division protein FtsH                       61.6    1e-07   Dolichospermum circinale
ref|WP_039716361.1|  cell division protein FtsH                       61.6    1e-07   
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit         61.6    1e-07   Cyanobacteria [blue-green bacteria]
ref|WP_006102026.1|  cell division protein FtsH                       61.6    1e-07   Coleofasciculus chthonoplastes
ref|WP_006278775.1|  cell division protein FtsH                       61.6    1e-07   Cylindrospermopsis
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3        61.2    1e-07   Lyngbya aestuarii
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit         61.2    2e-07   Anabaena cylindrica
ref|WP_028082599.1|  cell division protein FtsH                       60.8    2e-07   Dolichospermum circinale
ref|WP_038331075.1|  cell division protein FtsH                       60.8    2e-07   filamentous cyanobacterium ESFC-1
ref|WP_019497657.1|  hypothetical protein                             57.0    2e-07   Calothrix sp. PCC 7103
gb|KIJ85386.1|  cell division protein FtsH                            60.1    3e-07   Scytonema tolypothrichoides VB-61278
ref|WP_017291153.1|  cell division protein FtsH                       60.1    4e-07   Leptolyngbya boryana
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH               60.1    4e-07   Stanieria cyanosphaera
ref|WP_011613138.1|  cell division protein FtsH                       59.7    4e-07   Trichodesmium erythraeum
gb|EWM30233.1|  atp-dependent metalloprotease                         60.1    4e-07   Nannochloropsis gaditana
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit         59.7    4e-07   Cylindrospermum stagnale
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH         59.3    6e-07   Lyngbya confervoides
emb|CBN76650.1|  FtsH protease                                        59.3    6e-07   Ectocarpus siliculosus
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH               59.3    6e-07   Pleurocapsa minor
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)        58.9    8e-07   Anabaena sp. 90
ref|WP_027401619.1|  cell division protein FtsH                       58.9    8e-07   Nostocales
ref|XP_002177215.1|  predicted protein                                58.9    9e-07   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_016949229.1|  cell division protein FtsH                       58.9    1e-06   Anabaena sp. PCC 7108
ref|WP_016876546.1|  cell division protein FtsH                       58.5    1e-06   Chlorogloeopsis fritschii
ref|WP_026099187.1|  cell division protein FtsH                       58.5    1e-06   Prochlorothrix hollandica
ref|XP_005708136.1|  AAA-type ATPase                                  58.2    1e-06   Galdieria sulphuraria
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH               58.2    2e-06   Rubidibacter lacunae
ref|WP_013189950.1|  cell division protein FtsH                       58.2    2e-06   Trichormus azollae
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit         58.2    2e-06   Rivularia sp. PCC 7116
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH               57.8    2e-06   Gloeocapsa sp. PCC 73106
ref|WP_036531425.1|  cell division protein FtsH                       57.8    2e-06   Neosynechococcus sphagnicola
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH               57.4    2e-06   Nostoc sp. PCC 7524
gb|ACN35033.1|  unknown                                               57.4    3e-06   Zea mays [maize]
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH               57.4    3e-06   Microcoleus sp. PCC 7113
ref|WP_010995433.1|  cell division protein FtsH                       57.4    3e-06   Nostocaceae
ref|WP_011317448.1|  cell division protein FtsH                       57.0    3e-06   Trichormus variabilis
ref|WP_019506377.1|  cell division protein FtsH                       57.0    4e-06   Pleurocapsa sp. PCC 7319
ref|WP_017291152.1|  hypothetical protein                             53.9    4e-06   Leptolyngbya boryana
ref|WP_026730933.1|  cell division protein FtsH                       56.6    5e-06   Fischerella sp. PCC 9605
gb|KIE06858.1|  cell division protein FtsH                            56.6    5e-06   Tolypothrix bouteillei VB521301
ref|WP_011055986.1|  cell division protein FtsH                       56.6    6e-06   Thermosynechococcus
ref|WP_017320405.1|  cell division protein FtsH                       56.2    7e-06   cyanobacterium PCC 7702
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH         56.2    8e-06   Synechococcus
ref|WP_027841867.1|  cell division protein FtsH                       55.8    8e-06   Mastigocoleus testarum
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit         55.8    9e-06   Nostoc sp. PCC 7107
ref|WP_012411183.1|  cell division protein FtsH                       55.8    9e-06   Nostoc
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3              55.8    9e-06   Thermosynechococcus sp. NK55a
ref|WP_035992112.1|  cell division protein FtsH                       55.8    9e-06   Leptolyngbya sp. KIOST-1
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH               55.8    1e-05   Xenococcus sp. PCC 7305
ref|WP_017715041.1|  cell division protein FtsH                       55.8    1e-05   Oscillatoria sp. PCC 10802
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit         55.5    1e-05   Synechococcus sp. PCC 6312
ref|WP_024546675.1|  cell division protein FtsH                       55.1    2e-05   Synechococcus
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit         55.1    2e-05   Leptolyngbya sp. PCC 7376
ref|WP_017297226.1|  cell division protein FtsH                       54.7    2e-05   Nodosilinea nodulosa
ref|WP_029633975.1|  cell division protein FtsH [                     54.7    2e-05   [Scytonema hofmanni] UTEX B 1581
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit         54.7    3e-05   Leptolyngbya sp. PCC 7375
ref|WP_006453661.1|  cell division protein FtsH                       54.3    3e-05   Synechococcus sp. PCC 7335
ref|WP_017315070.1|  cell division protein FtsH                       54.3    4e-05   Mastigocladopsis repens
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH         53.9    4e-05   Synechococcus
gb|EJK55379.1|  hypothetical protein THAOC_24887                      53.9    4e-05   Thalassiosira oceanica
ref|WP_036486108.1|  cell division protein FtsH                       53.9    4e-05   Myxosarcina sp. GI1
ref|WP_032525350.1|  hypothetical protein                             50.1    7e-05   
ref|XP_002287516.1|  metalloprotease                                  53.1    7e-05   Thalassiosira pseudonana CCMP1335
ref|WP_025913223.1|  hypothetical protein                             50.8    7e-05   
ref|WP_017743955.1|  cell division protein FtsH                       53.1    8e-05   Scytonema hofmannii
ref|WP_036972775.1|  cell division protein FtsH                       52.4    8e-05   
ref|WP_035262561.1|  cell division protein FtsH                       53.1    9e-05   Actibacterium mucosum
ref|WP_013506914.1|  ATP-dependent metalloprotease                    52.4    1e-04   Desulfurispirillum indicum
ref|WP_023072541.1|  membrane protease catalytic subunit              52.0    2e-04   Leptolyngbya sp. Heron Island J
ref|WP_035155002.1|  cell division protein FtsH                       52.0    2e-04   Calothrix sp. 336/3
ref|WP_011363329.1|  cell division protein FtsH                       52.0    2e-04   Synechococcus sp. CC9605
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                    52.0    2e-04   Synechococcus sp. WH 8109
emb|CCQ73321.1|  Cell division protein FtsH; ATP-dependent zinc-m...  51.6    2e-04   Magnetospira sp. QH-2
ref|WP_029981286.1|  cell division protein FtsH                       50.1    2e-04   
ref|WP_019494535.1|  cell division protein FtsH                       51.6    2e-04   Calothrix sp. PCC 7103
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH         51.6    3e-04   Prochlorococcus
ref|WP_011131165.1|  cell division protein FtsH                       51.6    3e-04   Prochlorococcus marinus
ref|WP_011826974.1|  cell division protein FtsH                       51.6    3e-04   Prochlorococcus sp. MIT 1306
ref|WP_016867387.1|  cell division protein FtsH                       51.2    3e-04   Fischerella muscicola
ref|WP_026723275.1|  cell division protein FtsH                       51.2    3e-04   Hapalosiphonaceae
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH         51.2    3e-04   Fischerella thermalis
ref|XP_005538209.1|  cell division protein FtsH                       51.2    4e-04   Cyanidioschyzon merolae strain 10D
ref|WP_017312914.1|  cell division protein FtsH                       50.8    5e-04   Fischerella sp. PCC 9339
ref|WP_016862523.1|  cell division protein FtsH                       50.8    5e-04   Fischerella muscicola
ref|WP_025970577.1|  hypothetical protein                             49.7    5e-04   
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH         50.4    6e-04   Cyanothece
gb|ADD94882.1|  FtsH peptidase                                        50.4    6e-04   uncultured marine bacterium MedDCM-OCT-S09-C166
ref|WP_010468934.1|  cell division protein FtsH                       50.4    7e-04   Acaryochloris sp. CCMEE 5410
ref|WP_015173052.1|  FtsH peptidase                                   47.8    7e-04   Geitlerinema sp. PCC 7407
ref|WP_036922150.1|  cell division protein FtsH                       50.1    7e-04   
ref|WP_040935720.1|  cell division protein FtsH                       50.1    8e-04   
gb|AII47735.1|  cell division protein FtsH                            50.1    8e-04   Synechococcus sp. KORDI-52
ref|WP_038551333.1|  cell division protein FtsH                       50.1    0.001   Synechococcus sp. KORDI-52
ref|WP_012162910.1|  cell division protein FtsH                       50.1    0.001   Acaryochloris marina
ref|WP_006853632.1|  cell division protein FtsH                       49.7    0.001   Synechococcus



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 158/186 (85%), Gaps = 1/186 (1%)
 Frame = +1

Query  139  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  315
            SRR+++ PQS L+K SN D+FK + SKA +AALLFSSI PQA ALDN TPAAPP  I+AE
Sbjct  32   SRRKYIVPQSILSKKSNSDNFKNVPSKAAIAALLFSSITPQAFALDNTTPAAPPQVIEAE  91

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            AP+P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   APKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVKKGKVERVRFSKDG  151

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IG   FP   F 
Sbjct  152  STLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGNLLFPIIAFA  211

Query  676  RAFLSF  693
              F  F
Sbjct  212  GLFFLF  217



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  139  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  315
            S+R+ + PQS L K  N D+FK + SKA LAALLFSSI P A ALDN TPAAPP  I+AE
Sbjct  32   SKRKCIVPQSILNKKPNSDNFKNVPSKAALAALLFSSITPHAFALDNTTPAAPPQVIEAE  91

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            A +P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   ALKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVKKGKVERVRFSKDG  151

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IG   FP   F 
Sbjct  152  STLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGNLLFPIIAFA  211

Query  676  RAFLSF  693
              F  F
Sbjct  212  GLFFLF  217



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = +1

Query  139  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP-AAPPTEIQA  312
            S+R+ +  QS L K  N D+FK   SKA LAALLFSSI P AIALD+A P A+PP  ++ 
Sbjct  7    SKRKCIITQSTLNKKPNSDNFKNAQSKAALAALLFSSITPHAIALDDAAPIASPPQVMEV  66

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            EAP P  SN  PFSQN+VLNAPK QA P SDLPE +QWRYSEFLNAVKKGKVERVRFSKD
Sbjct  67   EAPNPNTSNPLPFSQNLVLNAPKTQASPVSDLPESTQWRYSEFLNAVKKGKVERVRFSKD  126

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IG   FPF  F
Sbjct  127  GSALQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGNLLFPFIAF  186

Query  673  RRAFLSF  693
               F  F
Sbjct  187  AGLFFLF  193



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = +1

Query  142  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP-TEIQAE  315
            R+ F  PQS L K  N D  K   S+A LAALLFSSI PQA ALDN TP APP + +QAE
Sbjct  34   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALLFSSITPQAFALDNTTPTAPPPSVVQAE  93

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
             P+P   N S FSQN++LNAPKPQAQ  SD+P+GSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  94   TPKPNPLNPSSFSQNLILNAPKPQAQSTSDIPDGSQWRYSEFLNAVKKGKVERVRFSKDG  153

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IG   FP   F 
Sbjct  154  SVLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGNLLFPLLAFA  213

Query  676  RAFLSF  693
              F  F
Sbjct  214  GLFFLF  219



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +1

Query  190  DSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVL  369
            DS K + S+ATLAALLFSS+ PQA+ALDN+T   PP  I+A+  +P+ASN+SPFSQN++L
Sbjct  57   DSLKSIPSQATLAALLFSSLTPQALALDNSTVPTPPPVIEAQPTKPSASNSSPFSQNLLL  116

Query  370  NAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  549
             APKPQ+Q  +DLPEG+QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP
Sbjct  117  TAPKPQSQSTTDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  176

Query  550  NDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            NDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F   FL F
Sbjct  177  NDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAFAGLFLLF  224



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = +1

Query  145  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQAEAP  321
            R+F+ PQS+  N N +  K +SS   LAALLFSSIAPQA+ALDN  P AP P  I+ EA 
Sbjct  31   RKFIVPQSILNNKNSNKSKVVSSHGALAALLFSSIAPQALALDNTPPPAPAPQVIEIEAQ  90

Query  322  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  501
            +   S +SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSA
Sbjct  91   K--TSQSSPFAQNLILNAPKPQAQSTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSA  148

Query  502  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRA  681
            LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FP   F   
Sbjct  149  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPVLAFAGL  208

Query  682  FLSF  693
            F  F
Sbjct  209  FFLF  212



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +1

Query  142  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP-TEIQAE  315
            R+ F  PQS L K  N D  K   S+A LAAL FSSI PQA ALDN TP APP + +QAE
Sbjct  38   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALFFSSITPQAFALDNTTPTAPPPSVVQAE  97

Query  316  APQPTASNASPFSQNVVLNAPKPQA-QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
             P+P   N SPFSQN++LNAPKPQA Q +SD+P+GSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  98   TPKPNPLNPSPFSQNLILNAPKPQAAQSSSDIPDGSQWRYSEFLNAVKKGKVERVRFSKD  157

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            G+ LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IG   FP   F
Sbjct  158  GTVLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGNLLFPILAF  217

Query  673  RRAFLSF  693
               F  F
Sbjct  218  AGLFFLF  224



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +1

Query  175  KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFS  354
            K  + DS K + ++ATLA LLFSS++PQA ALDN TP+ PP  ++A+  +P  SN+SPFS
Sbjct  57   KQPSSDSLKSIQTQATLATLLFSSLSPQAFALDNPTPSPPPV-LEAQPTKPNPSNSSPFS  115

Query  355  QNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA  534
            QN++L APKPQ+Q  SDLPEG+QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA
Sbjct  116  QNLLLTAPKPQSQSTSDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA  175

Query  535  TVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            TVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F   FL F
Sbjct  176  TVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAFAGLFLLF  228



>gb|KJB14313.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=600

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = +1

Query  139  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  312
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAF  201

Query  673  RRAFLSF  693
               F  F
Sbjct  202  AGLFFLF  208



>gb|KJB14312.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=588

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = +1

Query  139  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  312
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAF  201

Query  673  RRAFLSF  693
               F  F
Sbjct  202  AGLFFLF  208



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 147/188 (78%), Gaps = 6/188 (3%)
 Frame = +1

Query  139  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  312
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNLKNIPSKAALAALLFSSITPHAFALDNTTPTVPTPQVIQA  91

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            EA  P+ SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPSTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAFPFPC  669
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+  GNGLF+ IG + FPF  
Sbjct  150  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSAGNGLFNLIG-NLFPFIA  208

Query  670  FRRAFLSF  693
            F   F  F
Sbjct  209  FAGLFYLF  216



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = +1

Query  139  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  312
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAF  201

Query  673  RRAFLSF  693
               F  F
Sbjct  202  AGLFFLF  208



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = +1

Query  139  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  312
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAF  201

Query  673  RRAFLSF  693
               F  F
Sbjct  202  AGLFFLF  208



>emb|CDP03477.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +1

Query  151  FLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQP  327
            FL+P +  T  S P  F  + SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP
Sbjct  15   FLSPPTPKTTKSLPRKFLDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQP  74

Query  328  TASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQ  507
            + SN SPFSQN++LNAP+PQAQP++DLPEGSQWRYSEFLNAVKKGKVERVRF KDGSALQ
Sbjct  75   SPSNPSPFSQNLILNAPQPQAQPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKDGSALQ  134

Query  508  LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFL  687
            LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F   F 
Sbjct  135  LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAFAGLFF  194

Query  688  SF  693
             F
Sbjct  195  LF  196



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 150/188 (80%), Gaps = 6/188 (3%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQ  309
            + R+    QS+  N  P+S    K L S ATLAALLFS++APQA+A+DNA P  PP  I+
Sbjct  24   TTRKLQVTQSIL-NKKPNSSHTVKTLQSHATLAALLFSAVAPQALAVDNAPPTPPPV-IE  81

Query  310  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  489
            A+  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSK
Sbjct  82   AQPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSK  140

Query  490  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPC  669
            DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  
Sbjct  141  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLA  200

Query  670  FRRAFLSF  693
            F   F  F
Sbjct  201  FAGLFFLF  208



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 152/187 (81%), Gaps = 4/187 (2%)
 Frame = +1

Query  145  RRFLAPQSL----TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  312
            R+FL PQS+      NS   S K + SKATLAALLFSSI P+A+A+DN  P   P  IQA
Sbjct  29   RKFLVPQSILGGKKSNSISQSLKDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQA  88

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            EAPQP+ SN SPFSQN++LNAPKPQAQP++DLPEGSQWRYSEFLNAVKKGKVERVRF KD
Sbjct  89   EAPQPSPSNPSPFSQNLILNAPKPQAQPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKD  148

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F
Sbjct  149  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAF  208

Query  673  RRAFLSF  693
               F  F
Sbjct  209  AGLFFLF  215



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 146/188 (78%), Gaps = 6/188 (3%)
 Frame = +1

Query  139  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  312
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPQVIQA  91

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAFPFPC  669
            G+ LQL AVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GGNGLF+ IG S FPF  
Sbjct  150  GTTLQLNAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGGNGLFNLIG-SLFPFIA  208

Query  670  FRRAFLSF  693
            F   F  F
Sbjct  209  FAGLFYLF  216



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 146/188 (78%), Gaps = 6/188 (3%)
 Frame = +1

Query  139  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  312
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPRVIQA  91

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAFPFPC  669
            GSALQLTAVDGRRATV VPNDPDLIDILAMNGVDISVSEG+  GNGLF+ IG + FPF  
Sbjct  150  GSALQLTAVDGRRATVTVPNDPDLIDILAMNGVDISVSEGDSAGNGLFNLIG-NLFPFIA  208

Query  670  FRRAFLSF  693
            F   F  F
Sbjct  209  FAGLFYLF  216



>ref|XP_007017988.1| FTSH protease 1 isoform 2 [Theobroma cacao]
 gb|EOY15213.1| FTSH protease 1 isoform 2 [Theobroma cacao]
Length=577

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 147/186 (79%), Gaps = 3/186 (2%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPD-SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  315
            +R+  +    L K  N   S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+
Sbjct  28   TRKSQITQSILNKKPNSQRSLKTLQSHATLAALLFSSVTPQALAVDNA-PPTPPAVIEAQ  86

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
              +P+ SN SPF+QN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  87   PTKPSPSNQSPFAQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  145

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIG   FPF  F 
Sbjct  146  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGNLLFPFLAFA  205

Query  676  RAFLSF  693
              F  F
Sbjct  206  GLFFLF  211



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 147/186 (79%), Gaps = 3/186 (2%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPD-SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  315
            +R+  +    L K  N   S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+
Sbjct  28   TRKSQITQSILNKKPNSQRSLKTLQSHATLAALLFSSVTPQALAVDNA-PPTPPAVIEAQ  86

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
              +P+ SN SPF+QN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  87   PTKPSPSNQSPFAQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  145

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIG   FPF  F 
Sbjct  146  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGNLLFPFLAFA  205

Query  676  RAFLSF  693
              F  F
Sbjct  206  GLFFLF  211



>emb|CDP18582.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  211  SKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  390
            SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP+ SN SPFSQN++LNAP+PQA
Sbjct  9    SKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQPSPSNPSPFSQNLILNAPQPQA  68

Query  391  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLID  570
            QP++DLPEGSQWRYSEFLNAVKKGKVERVRF KDGSALQLTAVDGRRATVIVPNDPDLID
Sbjct  69   QPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKDGSALQLTAVDGRRATVIVPNDPDLID  128

Query  571  ILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            ILAMNGVDISVSEG+ GNGLF+FIG   FPF  F   F  F
Sbjct  129  ILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAFAGLFFLF  169



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = +1

Query  145  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQ  324
            R+   PQS+      +  K + + A  AA LFSS+AP A+ALDN +P AP   I+ EA +
Sbjct  27   RKLFVPQSILDGKCSNRSKCIQNHAAFAAFLFSSVAPNALALDNVSPPAPQV-IEIEAQK  85

Query  325  PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSAL  504
             T+S  SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSAL
Sbjct  86   TTSS--SPFAQNLILNAPKPQAQSNSDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSAL  143

Query  505  QLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAF  684
            QLTA+DGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F   F
Sbjct  144  QLTAIDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAFAGLF  203

Query  685  LSF  693
              F
Sbjct  204  FLF  206



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 151/193 (78%), Gaps = 9/193 (5%)
 Frame = +1

Query  139  SRRRFLAPQSLTKN---SNPDSFKGLSSKATLAALLFSSIA---PQAIALDNA--TPAAP  294
            ++R+FL  +S  K    SN ++ + + S+ATLAAL+FSSIA   P A+A+DN   TP+ P
Sbjct  38   TKRKFLITKSTLKRNPISNSNTLRNIPSQATLAALIFSSIAQNPPAALAIDNNINTPSPP  97

Query  295  PTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVER  474
            P  I+AEA +   S +SPFSQN++L APKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVER
Sbjct  98   PA-IEAEATKANPSASSPFSQNLLLTAPKPQAQSTSDLPEGSQWRYSEFLNAVKKGKVER  156

Query  475  VRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSA  654
            VRFSKDGSALQLTAVDGRRATV VPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   
Sbjct  157  VRFSKDGSALQLTAVDGRRATVTVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLL  216

Query  655  FPFPCFRRAFLSF  693
            FPF  F   F  F
Sbjct  217  FPFLAFAGLFFLF  229



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 146/187 (78%), Gaps = 4/187 (2%)
 Frame = +1

Query  139  SRRRFLAPQSLTKN--SNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  312
            + R+    QS+  N  ++  +F+ L S ATLAAL FSS+ PQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNNKPNSNHTFRALQSHATLAALYFSSVTPQALAVDNAPPTPPPV-IEA  82

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +   P+  N SPFSQ+++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTNPSPLNQSPFSQDLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GS LQL+AVDGRRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+FIG   FPF  F
Sbjct  142  GSFLQLSAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGNLLFPFLAF  201

Query  673  RRAFLSF  693
               F  F
Sbjct  202  AGLFFLF  208



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 144/186 (77%), Gaps = 7/186 (4%)
 Frame = +1

Query  145  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNA---TPAAPPTEIQAE  315
            R FL PQ++    N    K +++ A LAALLFSS+ PQA+ALD+     PAA   EI+A+
Sbjct  31   RSFLVPQAILNRKNSSKSKNVANHAALAALLFSSVTPQALALDSTPPPAPAAQVIEIEAQ  90

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
             P P+    SPF+QN++LNAPKPQ+QP SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  91   RPGPS----SPFAQNLILNAPKPQSQPTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  146

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
              LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLFSFIG   FPF  F 
Sbjct  147  GVLQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDTGNGLFSFIGNLLFPFLAFA  206

Query  676  RAFLSF  693
              F  F
Sbjct  207  GLFFLF  212



>gb|KDO85047.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=606

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +1

Query  199  KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  378
            + ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L AP
Sbjct  69   RTVTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAP  128

Query  379  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  558
            KPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP
Sbjct  129  KPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  187

Query  559  DLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            DLIDILAMNGVDISVSEG+ GNGLFSF+G   FPF  F   F  F
Sbjct  188  DLIDILAMNGVDISVSEGDSGNGLFSFVGNLLFPFLAFAGLFFLF  232



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 146/183 (80%), Gaps = 2/183 (1%)
 Frame = +1

Query  145  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQ  324
            R+ L P S +  +     + ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +
Sbjct  52   RKELEPNSASSEAASKR-RTVTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSK  110

Query  325  PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSAL  504
            P  SN+SPF QN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSAL
Sbjct  111  PNPSNSSPFGQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSAL  169

Query  505  QLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAF  684
            QLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLFSF+G   FPF  F   F
Sbjct  170  QLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFSFVGNLLFPFLAFAGLF  229

Query  685  LSF  693
              F
Sbjct  230  FLF  232



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +1

Query  199  KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  378
            + ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L AP
Sbjct  69   RTVTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAP  128

Query  379  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  558
            KPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP
Sbjct  129  KPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  187

Query  559  DLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            DLIDILAMNGVDISVSEG+ GNGLFSF+G   FPF  F   F  F
Sbjct  188  DLIDILAMNGVDISVSEGDSGNGLFSFVGNLLFPFLAFAGLFFLF  232



>gb|KJB57986.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=531

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = +1

Query  178  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  357
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  358  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRAT  537
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVKKGKVERVRFSKDGS LQL+AVDGRRA+
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVKKGKVERVRFSKDGSVLQLSAVDGRRAS  175

Query  538  VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+FIG   FPF  F   F  F
Sbjct  176  VIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGNLLFPFLAFAGLFFLF  227



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  142  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  321
            R+ FL    L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+A 
Sbjct  41   RKSFLTRSVLSEKPNFEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQAV  100

Query  322  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  501
             P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA
Sbjct  101  SPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  160

Query  502  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRA  681
            LQLTA+DGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F   
Sbjct  161  LQLTAIDGRRATVIVPNDPDLIDILAMNGVDISVSEGDAGNGLFNFIGNLLFPFLAFAGL  220

Query  682  FLSF  693
            F  F
Sbjct  221  FFLF  224



>gb|EYU17514.1| hypothetical protein MIMGU_mgv1a004291mg [Erythranthe guttata]
Length=534

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 140/190 (74%), Gaps = 11/190 (6%)
 Frame = +1

Query  145  RRFLAPQSL------TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-E  303
            RRFL PQS+      +  S   +   +++ A LAALLFSSI PQA ALDN+ P AP   E
Sbjct  35   RRFLLPQSILNRRIISDKSTKSNNNNITNHAALAALLFSSITPQAFALDNSPPPAPQVIE  94

Query  304  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  483
            I+A+     A  +SP +QN+VLNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRF
Sbjct  95   IEAQ----KAVQSSPVAQNLVLNAPKPQAQSNSDLPEGSQWRYSEFLNAVKKGKVERVRF  150

Query  484  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPF  663
            SK+GS LQLTAVDGRRA V+VPNDPDLIDILAMNGVDISVSEGE  NGLFS IG   FP 
Sbjct  151  SKEGSTLQLTAVDGRRAAVVVPNDPDLIDILAMNGVDISVSEGESENGLFSIIGNLFFPI  210

Query  664  PCFRRAFLSF  693
              F   F  F
Sbjct  211  LAFAGLFFLF  220



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  139  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  315
            S+R+ +  QS L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+
Sbjct  39   SKRKSVLTQSVLSEKPNSEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQ  98

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            A  P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  99   AVSPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  158

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            SALQLTA+DGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F 
Sbjct  159  SALQLTAIDGRRATVIVPNDPDLIDILAMNGVDISVSEGDTGNGLFNFIGNLLFPFLAFA  218

Query  676  RAFLSF  693
              F  F
Sbjct  219  GLFFLF  224



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = +1

Query  178  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  357
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  358  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRAT  537
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVKKGKVERVRFSKDGS LQL+AVDGRRA+
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVKKGKVERVRFSKDGSVLQLSAVDGRRAS  175

Query  538  VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+FIG   FPF  F   F  F
Sbjct  176  VIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGNLLFPFLAFAGLFFLF  227



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 149/185 (81%), Gaps = 5/185 (3%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  318
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFEVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  319  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  498
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  150

Query  499  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRR  678
            ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F  
Sbjct  151  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPFLAFAG  210

Query  679  AFLSF  693
             F  F
Sbjct  211  LFFLF  215



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 148/189 (78%), Gaps = 6/189 (3%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  309
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  310  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  486
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVKKGKVERVRF 
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVKKGKVERVRFV  161

Query  487  KDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFP  666
            KDGSALQLTAVDGRRA+V+VPNDPDLIDILAMNGVDISVSEG+ G GLF+FIG   FP  
Sbjct  162  KDGSALQLTAVDGRRASVVVPNDPDLIDILAMNGVDISVSEGDSGGGLFNFIGNLLFPIL  221

Query  667  CFRRAFLSF  693
             F   FL F
Sbjct  222  AFAGLFLLF  230



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 148/189 (78%), Gaps = 6/189 (3%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  309
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  310  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  486
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVKKGKVERVRF 
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVKKGKVERVRFV  161

Query  487  KDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFP  666
            KDGSALQLTAVDGRRA+V+VPNDPDLIDILAMNGVDISVSEG+ G GLF+FIG   FP  
Sbjct  162  KDGSALQLTAVDGRRASVVVPNDPDLIDILAMNGVDISVSEGDSGGGLFNFIGNLLFPIL  221

Query  667  CFRRAFLSF  693
             F   FL F
Sbjct  222  AFAGLFLLF  230



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 5/185 (3%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  318
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFDVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  319  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  498
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  150

Query  499  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRR  678
            ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDI+VSEG+ GNGLF+FIG   FPF  F  
Sbjct  151  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDITVSEGDSGNGLFNFIGNLLFPFLAFAG  210

Query  679  AFLSF  693
             F  F
Sbjct  211  LFFLF  215



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 146/187 (78%), Gaps = 5/187 (3%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  312
            S+R+  A +++  NS PDS   K  +S+ATLAALLFSS+ PQA+A+DN     PP  +Q 
Sbjct  44   SKRKLFATKNIF-NSQPDSEPLKSAASQATLAALLFSSLTPQALAIDNTPTPTPPPVLQP  102

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +  A  ASPFSQN++LNAPKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRF KD
Sbjct  103  QPSKSNA--ASPFSQNLLLNAPKPQSQVATDLPEGSQWRYSEFLNAVKKGKVERVRFMKD  160

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRA+V+VPNDPDLIDILAMNGVDISVSEG+ G GLF+ IG   FP   F
Sbjct  161  GSALQLTAVDGRRASVVVPNDPDLIDILAMNGVDISVSEGDSGGGLFNXIGNLLFPILAF  220

Query  673  RRAFLSF  693
               FL F
Sbjct  221  AGLFLLF  227



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 138/171 (81%), Gaps = 3/171 (2%)
 Frame = +1

Query  184  NPDSFKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQAEAPQPTASNASPFSQN  360
            N DS K ++S+ATLAALLFSS+  Q A+A+DN TP + P  +  EA QPT  N+SPFSQ 
Sbjct  52   NSDSIKSITSQATLAALLFSSLTTQPALAVDNVTPPSQPAPV-LEA-QPTKPNSSPFSQA  109

Query  361  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV  540
            + L APKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSALQLTAVDGRRA+V
Sbjct  110  LNLTAPKPQSQAATDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSALQLTAVDGRRASV  169

Query  541  IVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            +VPNDPDLIDILAMNGVDISVSEG+ G G+F+FIG   FP   F   F  F
Sbjct  170  VVPNDPDLIDILAMNGVDISVSEGDSGGGIFNFIGNLLFPIIAFAGLFFLF  220



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 145/190 (76%), Gaps = 8/190 (4%)
 Frame = +1

Query  139  SRRRFLAPQSLT----KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTE  303
            SRRR+   +S       +S+    K LSS+A LAALLFSS++P+A ALD  AT + PP  
Sbjct  38   SRRRYQITRSALGRKPNSSDAKPMKSLSSQAALAALLFSSVSPRASALDEPATVSPPPMV  97

Query  304  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  483
            ++A+A +P+ + AS F QN+V+ APKPQAQ  SDLP+GSQWRYSEFLNAVKKGKVERVRF
Sbjct  98   VEAQAAKPSPT-ASSFGQNLVMTAPKPQAQ--SDLPDGSQWRYSEFLNAVKKGKVERVRF  154

Query  484  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPF  663
            SKDGSALQLTAVDGRRA V VPNDPDLIDILAMNGVDISVSEGE GNGLF+FIG   FP 
Sbjct  155  SKDGSALQLTAVDGRRANVTVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGNLLFPI  214

Query  664  PCFRRAFLSF  693
              F   F  F
Sbjct  215  LAFAGLFFLF  224



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 143/187 (76%), Gaps = 5/187 (3%)
 Frame = +1

Query  142  RRRFLAPQSLTKNSNP--DSFKGLSSKATLAALLF-SSIAPQAIALDNATPAAPPTEIQA  312
            RR+  A +S+  N  P  +  K   SKA+LAALLF SSI PQA A D      PP  IQA
Sbjct  38   RRKLRATRSVLNNDVPNFERLKSAQSKASLAALLFASSIVPQAQAADAPNLPTPPPVIQA  97

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +P+ S++SPF+QN++L APKP A  +SDLPEGSQWRYSEFL+AVKKGKVERVRFSKD
Sbjct  98   QPTKPSPSDSSPFAQNLLLTAPKPSA--SSDLPEGSQWRYSEFLSAVKKGKVERVRFSKD  155

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GSALQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F
Sbjct  156  GSALQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFAFIGNLLFPFLAF  215

Query  673  RRAFLSF  693
               F  F
Sbjct  216  AGLFFLF  222



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 140/187 (75%), Gaps = 5/187 (3%)
 Frame = +1

Query  142  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  312
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPVKSAASQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQVATDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  161

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GS LQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FP   F
Sbjct  162  GSGLQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPILAF  221

Query  673  RRAFLSF  693
               FL F
Sbjct  222  AGLFLLF  228



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 140/187 (75%), Gaps = 5/187 (3%)
 Frame = +1

Query  142  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  312
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPLKSATSQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  313  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  492
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYS+FLNAVKKGKVERVRFSKD
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQAATDLPEGSQWRYSDFLNAVKKGKVERVRFSKD  161

Query  493  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCF  672
            GS LQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FP   F
Sbjct  162  GSGLQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFPILAF  221

Query  673  RRAFLSF  693
               FL F
Sbjct  222  AGLFLLF  228



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 142/186 (76%), Gaps = 9/186 (5%)
 Frame = +1

Query  151  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  315
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKNFQKIVNEKNHESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
              +P+    S  +QN++L APKPQ+Q  SDLPEGS WRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   PTRPS----STLAQNLLLTAPKPQSQSTSDLPEGSXWRYSEFLNAVKKGKVERVRFSKDG  147

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIG   FPF  F 
Sbjct  148  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGNLLFPFLAFA  207

Query  676  RAFLSF  693
              FL F
Sbjct  208  GLFLLF  213



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 142/186 (76%), Gaps = 9/186 (5%)
 Frame = +1

Query  151  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  315
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKKFQKIVNEKNYESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
              +P+    S  +QN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   PTRPS----STVAQNLLLTAPKPQSQSTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  147

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            SALQLTAVDGRRA VIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIG   FPF  F 
Sbjct  148  SALQLTAVDGRRAAVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGNLLFPFLAFA  207

Query  676  RAFLSF  693
              FL F
Sbjct  208  GLFLLF  213



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 144/191 (75%), Gaps = 8/191 (4%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSF---KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTE--  303
            S R+FL  +++  +  PDS      + +KATLA LLFSS+APQA+ALD   P    T   
Sbjct  31   STRKFLIARNVL-DKKPDSKPSKNSIQTKATLATLLFSSLAPQALALDAPNPPPQTTTPP  89

Query  304  -IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  480
             +QA  P  + S++SPF QN++L APKP+++  SDLPEGSQWRYSEFL+AVKKGKVERVR
Sbjct  90   VLQAR-PSQSESSSSPFGQNLLLTAPKPESRNVSDLPEGSQWRYSEFLSAVKKGKVERVR  148

Query  481  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFP  660
            FSKDGS LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FP
Sbjct  149  FSKDGSGLQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGNLLFP  208

Query  661  FPCFRRAFLSF  693
            F  F   F  F
Sbjct  209  FLAFAGLFFLF  219



>dbj|BAH56755.1| AT5G42270 [Arabidopsis thaliana]
Length=574

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 135/186 (73%), Gaps = 13/186 (7%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  315
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  147

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVD RRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLF FIG   FP   F 
Sbjct  148  SVLQLTAVDNRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFDFIGNLLFPLLAFG  207

Query  676  RAFLSF  693
              F  F
Sbjct  208  GLFYLF  213



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 135/186 (73%), Gaps = 13/186 (7%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  315
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  147

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVD RRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLF FIG   FP   F 
Sbjct  148  SVLQLTAVDNRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFDFIGNLLFPLLAFG  207

Query  676  RAFLSF  693
              F  F
Sbjct  208  GLFYLF  213



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 136/186 (73%), Gaps = 16/186 (9%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  315
            SRRR+ + + +         K L S+A LAALLFSS +PQA+A++    P AP   ++A+
Sbjct  40   SRRRYQSEKLM---------KSLPSQAALAALLFSSTSPQALAVNEPVQPPAPTVTVEAQ  90

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            +P     N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  91   SP-----NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  144

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVD RRATVIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIG   FP   F 
Sbjct  145  SVLQLTAVDNRRATVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGNLLFPLLAFG  204

Query  676  RAFLSF  693
              F  F
Sbjct  205  GLFYLF  210



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = +1

Query  217  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQ  393
            A ++AL+ SS+  P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKPQ+Q
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKPQSQ  115

Query  394  PASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDI  573
             ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVDGRRA VIVPNDPDLIDI
Sbjct  116  SSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDGRRANVIVPNDPDLIDI  175

Query  574  LAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            LAMNGVDISVSEGE GNGLFSF+G    PF  F   FL F
Sbjct  176  LAMNGVDISVSEGEQGNGLFSFVGSLLLPFLAFAGLFLIF  215



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  145  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  321
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P   P     E  
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  322  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  501
               +   SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVKKGKVERVRF+K+G  
Sbjct  91   AQKSPLQSPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVKKGKVERVRFNKEGGI  150

Query  502  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRA  681
            LQLTAVDGR+A V+VPNDPDLIDILAMNGVDI+VSEG+ GNGLF F+G   FP   F   
Sbjct  151  LQLTAVDGRKAAVVVPNDPDLIDILAMNGVDITVSEGDSGNGLFGFLGNLVFPLLAFGGL  210

Query  682  FLSF  693
            +  F
Sbjct  211  YFLF  214



>gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=656

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  145  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  321
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P   P     E  
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  322  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  501
               +   SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVKKGKVERVRF+K+G  
Sbjct  91   AQKSPLQSPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVKKGKVERVRFNKEGGI  150

Query  502  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRA  681
            LQLTAVDGR+A V+VPNDPDLIDILAMNGVDI+VSEG+ GNGLF F+G   FP   F   
Sbjct  151  LQLTAVDGRKAAVVVPNDPDLIDILAMNGVDITVSEGDSGNGLFGFLGNLVFPLLAFGGL  210

Query  682  FLSF  693
            +  F
Sbjct  211  YFLF  214



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = +1

Query  217  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQ  393
            A ++AL+ SS+  P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKPQ+Q
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKPQSQ  115

Query  394  PASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDI  573
             ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVDGRRA VIVPNDPDLIDI
Sbjct  116  SSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDGRRANVIVPNDPDLIDI  175

Query  574  LAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            LAMNGVDISVSEGE GNGLFSF+G    PF  F   FL F
Sbjct  176  LAMNGVDISVSEGEQGNGLFSFVGSLLLPFLAFAGLFLIF  215



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 131/186 (70%), Gaps = 9/186 (5%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  315
            SRRR    QS          K L S+A LAALLFSS +PQA+A++    P AP   I  E
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNEPVQPLAPAPTITVE  93

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            A Q T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  94   A-QATNPNLS-FGQNVMMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  151

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIG   FP   F 
Sbjct  152  SVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGNLLFPLLAFG  211

Query  676  RAFLSF  693
              F  F
Sbjct  212  GLFYLF  217



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 136/189 (72%), Gaps = 10/189 (5%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSI--APQAIALDNATPAAPPTE--I  306
            SR++F+  QS   + N    K  S+ A   AL+ SS   + QA+A+DN  P        I
Sbjct  32   SRKKFVITQSFPNSQN---LKFPSNSALTTALILSSTLGSQQALAVDNLPPPQSQPPQVI  88

Query  307  QAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  486
            +A+   P   N+SPFSQN++LNAPKP + P  DLPEG+QWRYSEFL AVKKGKVERVRFS
Sbjct  89   EAQPNNPNLPNSSPFSQNLILNAPKP-SNP--DLPEGAQWRYSEFLTAVKKGKVERVRFS  145

Query  487  KDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFP  666
            KDGS LQLTA+DGRRA+V+VPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIG   FPF 
Sbjct  146  KDGSVLQLTAIDGRRASVVVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGNLLFPFI  205

Query  667  CFRRAFLSF  693
             F   F  F
Sbjct  206  AFAGLFFLF  214



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 133/190 (70%), Gaps = 16/190 (8%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-----ATPAAPPTE  303
            SRRR    QS          K L S+A LAALLFSS +PQA+A++      A   AP   
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSASPQALAVNEPVQPQAPVPAPTMT  93

Query  304  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  483
            ++A+A  P  S    F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+F
Sbjct  94   VEAQATSPNLS----FGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKF  148

Query  484  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPF  663
            SKDGS LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIG   FP 
Sbjct  149  SKDGSVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGNLLFPL  208

Query  664  PCFRRAFLSF  693
              F   F  F
Sbjct  209  LAFGGLFYLF  218



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPD---SFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-  303
            ++  FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+ALDN      P   
Sbjct  29   TKSSFLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALALDNPALPPTPPPV  88

Query  304  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  483
            I+A   +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVKKGKVERVRF
Sbjct  89   IEALPTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRF  144

Query  484  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPF  663
            SKDGS LQL+AVDGRRA+V+V NDPDLIDILA +GVDISVSEG+ GNG F+ IG   FP 
Sbjct  145  SKDGSTLQLSAVDGRRASVVVLNDPDLIDILARSGVDISVSEGDSGNGFFNVIGSLFFPI  204

Query  664  PCFRRAFLSF  693
                  FL F
Sbjct  205  LTVAGLFLLF  214



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = +1

Query  217  ATLAALLFSSI-APQAIALDNATPAAPPT-EIQAEAPQPTASNASPFSQNVVLNAPKPQA  390
            A ++AL+ SS+  P A+A DN  P  PP  E Q     P A++ SPFSQN+ L APKPQA
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKPQA  115

Query  391  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLID  570
            Q ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVDGRRA VIVPNDPDLID
Sbjct  116  QSSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDGRRANVIVPNDPDLID  175

Query  571  ILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            ILAMNGVDISVSEGE GNGLFSF+G    PF  F   FL F
Sbjct  176  ILAMNGVDISVSEGEQGNGLFSFVGSLLLPFLAFAGLFLIF  216



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 139/190 (73%), Gaps = 9/190 (5%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPD---SFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-  303
            ++  FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+A+DN  P   P   
Sbjct  29   TKSSFLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALAIDNPAPPPTPPPV  88

Query  304  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  483
            I+A   +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVKKGKVERVRF
Sbjct  89   IEALPTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRF  144

Query  484  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPF  663
            SKDGS LQL+AVDGRRA+V+V NDPDLIDILA +GVDISVSEG+ GNG F+ IG   FP 
Sbjct  145  SKDGSTLQLSAVDGRRASVVVLNDPDLIDILARSGVDISVSEGDSGNGFFNVIGSLFFPI  204

Query  664  PCFRRAFLSF  693
                  FL F
Sbjct  205  LAVAGLFLLF  214



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 134/181 (74%), Gaps = 5/181 (3%)
 Frame = +1

Query  166  SLTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPT  330
             +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+
Sbjct  31   HITRSSLDDKPIKSLPSRAALAAILFSSSISSQSPKALALDEPLTPTQPIVIEAQSLSPS  90

Query  331  ASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQL  510
             S+ SPF+QN V+ AP P+AQ +SDLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQL
Sbjct  91   PSSLSPFAQNQVITAPNPKAQSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQL  150

Query  511  TAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLS  690
            TAVD RRA+V+VPNDPDLIDILAMNGVDISVSEGE GN LF+ IG   FP   F   FL 
Sbjct  151  TAVDNRRASVVVPNDPDLIDILAMNGVDISVSEGESGNDLFTIIGNLIFPILAFGGLFLL  210

Query  691  F  693
            F
Sbjct  211  F  211



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 130/186 (70%), Gaps = 10/186 (5%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  315
            SRRR+   QS          K L S+A LAA+LFSS + QA+A++    P AP   I  E
Sbjct  40   SRRRYQISQS------EKLMKSLPSQAALAAVLFSSSSLQALAVNEPVQPPAPAPTIAVE  93

Query  316  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
            A Q T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  94   A-QATNPNLS-FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  151

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            S LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVS GE GNGLF FIG   FP   F 
Sbjct  152  SVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVS-GESGNGLFDFIGNLLFPLLAFG  210

Query  676  RAFLSF  693
              F  F
Sbjct  211  GLFYLF  216



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 13/185 (7%)
 Frame = +1

Query  151  FLAPQSLTKNSNPDSFKGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEA  318
            FL  +S+ K  N +  K  SS+A LAAL+ SS    + P+A+A DN TP  PP  I+A+ 
Sbjct  30   FLFKRSILKAQNSEQVKSASSRAALAALIVSSASLSVTPEALAADNLTP--PPV-IEAQQ  86

Query  319  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  498
             QP+    SPFSQN++L APKPQ+  +SDLPEG+ WRYS+FLNAVKKGKVERVRFSKDGS
Sbjct  87   SQPS----SPFSQNLLLTAPKPQS--SSDLPEGTNWRYSDFLNAVKKGKVERVRFSKDGS  140

Query  499  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRR  678
            ALQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISV+EGE  N LF+ +G   FP   F  
Sbjct  141  ALQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVAEGESPNSLFNIVGNLLFPLLAFAG  200

Query  679  AFLSF  693
             F  F
Sbjct  201  LFFLF  205



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 127/178 (71%), Gaps = 6/178 (3%)
 Frame = +1

Query  175  KNSNPDSFKGLSSKATLAALLFSSIAPQ---AIALDNATPAAPPTEIQAEAPQPTASNAS  345
            +  N    K L S+  LAA+LFSSI+     A+ALD    A     ++A+A +P+ S  S
Sbjct  55   EEDNGKPIKSLPSRVALAAILFSSISSSPRGALALDEPIAATQTVVVEAQAVKPSTS-PS  113

Query  346  PFSQNVVLNAPKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVD  522
            PFS+   + AP P+AQ +S DLPEG+QWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD
Sbjct  114  PFSETQTITAPNPKAQSSSSDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVD  173

Query  523  GRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAFPFPCFRRAFLSF  693
             RRA+V+VPNDPDLIDILAMNGVDISVSEGE  GN LF+ IG   FP   F   FL F
Sbjct  174  NRRASVVVPNDPDLIDILAMNGVDISVSEGESSGNDLFTIIGNLIFPILAFGGLFLLF  231



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 137/186 (74%), Gaps = 17/186 (9%)
 Frame = +1

Query  172  TKNSNPDSF-------KGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEA  318
            TK+S P  F          +S+A LAAL+FSS    + PQA+A DN TP  PP  I+A+ 
Sbjct  23   TKSSTPLQFLFKRSILNAHNSQAALAALIFSSASLSVTPQALAADNVTP--PPV-IEAQQ  79

Query  319  PQ-PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  495
             Q   ++++SPFSQN++L APKPQA  +SDLPEG+ WRYSEFLNAVKKGKVERVRFSKDG
Sbjct  80   SQLNPSNSSSPFSQNLLLTAPKPQA--SSDLPEGTNWRYSEFLNAVKKGKVERVRFSKDG  137

Query  496  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFR  675
            SALQLTA+DGRRA+VIVPNDPDLIDILAMNGVDISV+EGE  N LF+ IG   FP   F 
Sbjct  138  SALQLTAIDGRRASVIVPNDPDLIDILAMNGVDISVAEGESPNSLFNIIGNLLFPLLAFA  197

Query  676  RAFLSF  693
              F  F
Sbjct  198  GLFFLF  203



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   197 bits (501),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 134/182 (74%), Gaps = 6/182 (3%)
 Frame = +1

Query  166  SLTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPT  330
             +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+
Sbjct  31   HITRSSVDDKPLKSLPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPS  90

Query  331  ASNASPFSQNVVLNAPKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQ  507
             S+ SPF+Q+ V+ AP P+AQ +S DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQ
Sbjct  91   PSSLSPFAQSQVITAPNPKAQSSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQ  150

Query  508  LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFL  687
            LTAVD RRA+V+VPNDPDLIDILAMNGVDISVSEGE GN LF+ IG   FP   F   FL
Sbjct  151  LTAVDNRRASVVVPNDPDLIDILAMNGVDISVSEGESGNDLFTIIGNLIFPILAFGGLFL  210

Query  688  SF  693
             F
Sbjct  211  LF  212



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 130/184 (71%), Gaps = 2/184 (1%)
 Frame = +1

Query  142  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  321
            + RF   Q    ++N +  K  +  A + + +  +I P A+A DN TP  PP        
Sbjct  41   KTRFSNSQKSINDNNSEPLKSAAVSALILSSMTLNITPVALAADNITPPPPPVLEAQPNK  100

Query  322  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  501
               ++++SPFSQN+ L APKPQ+  +SDLP+G+QWRYSEFLNAVKKGKVERVRFSKDGS 
Sbjct  101  LNPSNSSSPFSQNISLTAPKPQS--SSDLPDGNQWRYSEFLNAVKKGKVERVRFSKDGSV  158

Query  502  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRA  681
            LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+F+G    PF  F   
Sbjct  159  LQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFVGSLLLPFLAFAGL  218

Query  682  FLSF  693
            FL F
Sbjct  219  FLIF  222



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 113/147 (77%), Gaps = 8/147 (5%)
 Frame = +1

Query  253  PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRY  432
            PQA+A+D   P AP   ++A+A  P+A     F Q V++ AP PQ Q +SDLP+G+QWRY
Sbjct  76   PQALAIDE--PPAPVITVEAQAVNPSA-----FGQKVLMTAPNPQGQ-SSDLPDGTQWRY  127

Query  433  SEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG  612
            SEFLNAVKKGKVERV+FSKDGS LQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG
Sbjct  128  SEFLNAVKKGKVERVKFSKDGSVLQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEG  187

Query  613  EGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            E GNGLF FIG   FP   F   F  F
Sbjct  188  ESGNGLFDFIGNLLFPLLAFGGLFYLF  214



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 120/165 (73%), Gaps = 5/165 (3%)
 Frame = +1

Query  205  LSSKATLAALLFSSIAPQAIA--LDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  378
            L S+A LA LLFSS    AIA     A P AP   I  EA Q    +A+ F QNV+  AP
Sbjct  54   LPSQAALATLLFSS-PSLAIAEPYTVAQPPAPTDTITVEA-QAITPSATAFGQNVLQTAP  111

Query  379  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  558
             PQAQ + D+P+G+QWRYSEFLN+VKKGKVERV+FSKDGS LQLTAVDGRRATVIVPNDP
Sbjct  112  NPQAQ-SPDIPDGTQWRYSEFLNSVKKGKVERVKFSKDGSVLQLTAVDGRRATVIVPNDP  170

Query  559  DLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            DLIDILAMNGVDISVSEGE GNGLF FIG   FP   F   F  F
Sbjct  171  DLIDILAMNGVDISVSEGESGNGLFDFIGNLIFPLLAFGGLFYLF  215



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 125/167 (75%), Gaps = 8/167 (5%)
 Frame = +1

Query  205  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  375
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  376  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPND  555
            P P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+VIVPND
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVIVPND  184

Query  556  PDLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAFPFPCFRRAFLSF  693
            PDL+DILAMNGVDISVSEGE  GN LF+ IG   FP   F   FL F
Sbjct  185  PDLVDILAMNGVDISVSEGESSGNDLFTVIGNLIFPILAFGGLFLLF  231



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 125/167 (75%), Gaps = 8/167 (5%)
 Frame = +1

Query  205  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  375
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  376  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPND  555
            P P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+VIVPND
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVIVPND  184

Query  556  PDLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAFPFPCFRRAFLSF  693
            PDL+DILAMNGVDISVSEGE  GN LF+ IG   FP   F   FL F
Sbjct  185  PDLVDILAMNGVDISVSEGESSGNDLFTVIGNLIFPILAFGGLFLLF  231



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 118/161 (73%), Gaps = 10/161 (6%)
 Frame = +1

Query  211  SKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  390
            S ATL+A       P A+A DN TP  P  E Q     P+ S +SPFS N+ L APKPQA
Sbjct  68   SSATLSA------TPHALAADNVTPP-PVIEAQQSQLNPSNSTSSPFSTNL-LTAPKPQA  119

Query  391  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLID  570
              +SDLPEG+ WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA+V+VPNDPDLID
Sbjct  120  --SSDLPEGTNWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRASVVVPNDPDLID  177

Query  571  ILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            ILAMNGVDISV+E E  NGLF+ IG   FPF  F   F  F
Sbjct  178  ILAMNGVDISVAEAESPNGLFNIIGNLLFPFLAFAGLFFLF  218



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 124/166 (75%), Gaps = 7/166 (4%)
 Frame = +1

Query  205  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  378
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+A     S +  F QN +L AP
Sbjct  69   LSSKVALAAILFSSISSSPRALALVD-EPPSPSLVVEAQAQAVKPSTSPLFIQNEILKAP  127

Query  379  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  558
             P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+VIVPNDP
Sbjct  128  SPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVIVPNDP  184

Query  559  DLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAFPFPCFRRAFLSF  693
            DLIDILAMNGVDISVSEGE  GN LF+ IG   FP   F   FL F
Sbjct  185  DLIDILAMNGVDISVSEGESSGNDLFTVIGNLIFPILAFGGLFLLF  230



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 124/167 (74%), Gaps = 9/167 (5%)
 Frame = +1

Query  208  SSKATLAALLFSSIAPQ-----AIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  372
            S  A +A+ L S++A Q     A+A  + +P      +Q E+    ++ +SPFSQ++ L 
Sbjct  70   SVNAAVASFLLSTLAQQQPLSPALAD-DLSPPPDSPPVQLESATKPSAPSSPFSQSL-LT  127

Query  373  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  552
            APKPQ  P  DLPEGSQWRYSEFLNAVKKGKVERVRFSKDG ALQLTAVDGRRATV+VPN
Sbjct  128  APKPQTSP--DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGGALQLTAVDGRRATVVVPN  185

Query  553  DPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            DPDLIDILAMNGVDISVSEG+GGNGLF+FIG   FPF  F   F  F
Sbjct  186  DPDLIDILAMNGVDISVSEGDGGNGLFAFIGNLLFPFLAFAGLFFLF  232



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 126/168 (75%), Gaps = 5/168 (3%)
 Frame = +1

Query  205  LSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  372
            L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ S+ SPF+Q+  + 
Sbjct  17   LPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPSPSSLSPFAQSQSIT  76

Query  373  APKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  549
            AP P+AQ +S DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+V+VP
Sbjct  77   APNPKAQSSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVVVP  136

Query  550  NDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            NDPDLIDILAMNGVDISVSEGE GN LF+ IG   FP   F   FL F
Sbjct  137  NDPDLIDILAMNGVDISVSEGESGNDLFTIIGNLIFPILAFGGLFLLF  184



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 122/168 (73%), Gaps = 11/168 (7%)
 Frame = +1

Query  208  SSKATLAALLFSSIAPQ-----AIALD-NATPAAPPTEIQAEAPQPTASNASPFSQNVVL  369
            S  A +A+ L S++A Q     A+A D +  PA+PP ++++       S+        +L
Sbjct  69   SVNAAVASFLLSTLAHQQPLAPALAEDLSPPPASPPIQMESATKPSPPSSPF---SQSLL  125

Query  370  NAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  549
             APKPQ+ P  DLPEGSQWRYSEFLNAVKKGKVERVRFSKDG ALQLTAVDGRRATV+VP
Sbjct  126  TAPKPQSSP--DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGGALQLTAVDGRRATVVVP  183

Query  550  NDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            NDPDLIDILAMNGVDISVSEG+GGNGLF+FIG   FPF  F   F  F
Sbjct  184  NDPDLIDILAMNGVDISVSEGDGGNGLFAFIGNLLFPFLAFAGLFFLF  231



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 133/181 (73%), Gaps = 11/181 (6%)
 Frame = +1

Query  139  SRRRFLAPQSLTKNSNPDSFKG--LSSKATLAALLFSSIA---PQAIALDNATPAAPPTE  303
            SR ++   +S   N++P+       SS+  LAA+LFSSI+   P+A+A+ +  PA+P   
Sbjct  41   SRAKYQITRSSLDNNSPNGKPNSPFSSQVALAAILFSSISSSPPRALAVVD-EPASPSVV  99

Query  304  IQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  480
            ++A+A     S +SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKKGKVERVR
Sbjct  100  VEAQAQAVKPSTSSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVR  156

Query  481  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGKSAF  657
            FSKDGS LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+ IG   F
Sbjct  157  FSKDGSVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFTVIGNLIF  216

Query  658  P  660
            P
Sbjct  217  P  217



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +1

Query  319  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  498
            PQ T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDGS
Sbjct  96   PQATNPNLS-FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDGS  154

Query  499  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRR  678
             LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIG   FP   F  
Sbjct  155  VLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGNLLFPLLAFGG  214

Query  679  AFLSF  693
             F  F
Sbjct  215  LFYLF  219



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 130/177 (73%), Gaps = 13/177 (7%)
 Frame = +1

Query  178  NSNPDSFKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNAS  345
            N+ P+S    SSK  LAA+LFSS++    P+A+A+ +  P +P   ++A+A +P+ S   
Sbjct  58   NAKPNS--PFSSKVALAAILFSSMSSSSPPRALAVVD-EPPSPSVVVEAQAVKPSTSPL-  113

Query  346  PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG  525
             F QN +L AP P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD 
Sbjct  114  -FIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDN  169

Query  526  RRATVIVPNDPDLIDILAMNGVDISVSEGEG-GNGLFSFIGKSAFPFPCFRRAFLSF  693
            RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+ IG   FP   F   FL F
Sbjct  170  RRASVIVPNDPDLIDILAMNGVDISVSEGESTGNDLFTVIGNLIFPILAFGGLFLLF  226



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +1

Query  175  KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFS  354
            KNSN +      S A  AA L SS+ P AIA D A    P +    +    +  + +PF+
Sbjct  46   KNSNDNRLTLSPSVAAAAAFLLSSLPPVAIAEDVAPVPPPTSPPAVQFDAASKPD-NPFA  104

Query  355  QNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA  534
            Q++ L AP+PQ   +SDLPEGSQWRYSEFL+AVKKGKVERVRFSKDG  LQLTAVDGRRA
Sbjct  105  QSL-LTAPRPQT--SSDLPEGSQWRYSEFLDAVKKGKVERVRFSKDGGVLQLTAVDGRRA  161

Query  535  TVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
             VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIG   FPF  F   F  F
Sbjct  162  AVIVPNDPDLIDILAMNGVDISVSEGDAGNGLFNFIGNLIFPFLAFAGLFFLF  214



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +1

Query  349  FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR  528
             +QN VL APKPQA P  D+PEGSQWRYSEFLNAVKKGKVERVRFSKDG  LQLTAVDGR
Sbjct  95   LTQNNVLTAPKPQANP--DIPEGSQWRYSEFLNAVKKGKVERVRFSKDGGVLQLTAVDGR  152

Query  529  RATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            RA+V+VPNDPDLIDILAMNGVDISVSEGE  NGLF FIG   FP   F   F  F
Sbjct  153  RASVVVPNDPDLIDILAMNGVDISVSEGEASNGLFGFIGNLLFPLLAFGGLFFLF  207



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 4/128 (3%)
 Frame = +1

Query  310  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  489
            A  P P AS ++PFSQ++ L AP+PQA P  DL +GSQWRYSEFLNAVK+GKVERVRFSK
Sbjct  100  ASKPAPPAS-SNPFSQSL-LTAPRPQASP--DLLDGSQWRYSEFLNAVKRGKVERVRFSK  155

Query  490  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPC  669
            DG  LQLTA+DGRRA V+VPNDPDLIDILAMNGVDISVSEG+GGNGLF+ IG   FPF  
Sbjct  156  DGGLLQLTAIDGRRAAVVVPNDPDLIDILAMNGVDISVSEGDGGNGLFNLIGNLIFPFLA  215

Query  670  FRRAFLSF  693
            F   F  F
Sbjct  216  FAGLFFLF  223



>gb|AFW75732.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=378

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 103/133 (77%), Gaps = 7/133 (5%)
 Frame = +1

Query  301  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  480
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSAA-ASDLPEGAQWRYSEFLSAVKRGKVERVR  123

Query  481  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGKSA  654
            FSKDG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+G   
Sbjct  124  FSKDGGLLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVSEGESAGPGGFVAFVGNLL  183

Query  655  FPFPCFRRAFLSF  693
            FPF  F   F  F
Sbjct  184  FPFIAFAGLFFLF  196



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 98/118 (83%), Gaps = 2/118 (2%)
 Frame = +1

Query  340  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  519
            ASPF+ N +L+APKPQ+  + D+P+GSQWRYSEFLNAVKKGKVERVRFSKDG  LQLTAV
Sbjct  107  ASPFA-NSLLSAPKPQSS-SPDIPDGSQWRYSEFLNAVKKGKVERVRFSKDGGVLQLTAV  164

Query  520  DGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
             GRRATVIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIG   FP   F   F  F
Sbjct  165  GGRRATVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGNLFFPLLAFGGLFFLF  222



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 103/133 (77%), Gaps = 7/133 (5%)
 Frame = +1

Query  301  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  480
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSA-AASDLPEGAQWRYSEFLSAVKRGKVERVR  123

Query  481  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGKSA  654
            FSKDG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+G   
Sbjct  124  FSKDGGLLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVSEGESAGPGGFVAFVGNLL  183

Query  655  FPFPCFRRAFLSF  693
            FPF  F   F  F
Sbjct  184  FPFIAFAGLFFLF  196



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 103/133 (77%), Gaps = 8/133 (6%)
 Frame = +1

Query  301  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  480
            E+QAEA  PTA+   PF+ N +L APKP A  A+DLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  67   ELQAEATTPTAN---PFA-NSLLTAPKPSA--AADLPEGAQWRYSEFLSAVKRGKVERVR  120

Query  481  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGKSA  654
            FSKDG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+G   
Sbjct  121  FSKDGGLLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVSEGEAAGPGGFIAFVGNLL  180

Query  655  FPFPCFRRAFLSF  693
            FPF  F   F  F
Sbjct  181  FPFLAFAGLFFLF  193



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 106/142 (75%), Gaps = 7/142 (5%)
 Frame = +1

Query  277  ATPAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAV  453
            A P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AV
Sbjct  57   APPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAV  112

Query  454  KKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNG  627
            KKGKVERVRFSKDG  LQLTA+DGRRATV+VPNDPDLIDILA NGVDISV+EG+  G  G
Sbjct  113  KKGKVERVRFSKDGGLLQLTAIDGRRATVVVPNDPDLIDILATNGVDISVAEGDAAGPGG  172

Query  628  LFSFIGKSAFPFPCFRRAFLSF  693
              +F+G   FPF  F   F  F
Sbjct  173  FLAFVGNLLFPFLAFAGLFFLF  194



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 106/142 (75%), Gaps = 7/142 (5%)
 Frame = +1

Query  277  ATPAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAV  453
            A P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AV
Sbjct  57   APPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAV  112

Query  454  KKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNG  627
            KKGKVERVRFSKDG  LQLTA+DGRRATV+VPNDPDLIDILA NGVDISV+EG+  G  G
Sbjct  113  KKGKVERVRFSKDGGLLQLTAIDGRRATVVVPNDPDLIDILATNGVDISVAEGDPAGPGG  172

Query  628  LFSFIGKSAFPFPCFRRAFLSF  693
              +F+G   FPF  F   F  F
Sbjct  173  FLAFVGNLLFPFLAFAGLFFLF  194



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +1

Query  283  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  459
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  145

Query  460  GKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFS  636
            GKVERVRFSKDGS +QLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+
Sbjct  146  GKVERVRFSKDGSVVQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFT  205

Query  637  FIGKSAFP  660
             IG   FP
Sbjct  206  VIGNLIFP  213



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +1

Query  283  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  459
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  145

Query  460  GKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFS  636
            GKVERVRFSKDGS +QLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+
Sbjct  146  GKVERVRFSKDGSVVQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFT  205

Query  637  FIGKSAFP  660
             IG   FP
Sbjct  206  VIGNLIFP  213



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = +1

Query  322  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  501
            + T +  SPFS   ++ AP  +A+   DLPEG+QWRYSEFLNAVK GKVERVRFS+DGS 
Sbjct  17   EQTPAAGSPFS---LMEAPPVEARKKLDLPEGNQWRYSEFLNAVKGGKVERVRFSRDGSV  73

Query  502  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFP  660
            LQLTAVDGRRA VIVPNDPDL+DILAMNGVDISVSEGE GN LF+ +G   FP
Sbjct  74   LQLTAVDGRRAAVIVPNDPDLVDILAMNGVDISVSEGESGNNLFNILGNLLFP  126



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 10/130 (8%)
 Frame = +1

Query  310  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  489
            AEAP P A+   PF+ + +L AP    QP+SD+P+G QWRYSEFL AVKKGKVERVRFSK
Sbjct  68   AEAPTPAAN---PFA-DTLLTAP----QPSSDIPDGGQWRYSEFLGAVKKGKVERVRFSK  119

Query  490  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGKSAFPF  663
            DG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISV+EG+  G  G  +F+G   FPF
Sbjct  120  DGGVLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVAEGDAAGPGGFLAFVGNLLFPF  179

Query  664  PCFRRAFLSF  693
              F   F  F
Sbjct  180  IAFAGLFFLF  189



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  400  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILA  579
            SDLPEG+ WRYSEFLNAVK GKVERVRF+KDG+ LQLTAVDGRRA V +PNDPDL+DILA
Sbjct  46   SDLPEGANWRYSEFLNAVKAGKVERVRFAKDGTTLQLTAVDGRRANVTLPNDPDLVDILA  105

Query  580  MNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            MNGVDISVSEGE  N   + +G   FP   F   F  F
Sbjct  106  MNGVDISVSEGEAANNYINVLGNLLFPLLAFGGLFFLF  143



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  400  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILA  579
            SDLPEG+ WRYSEFLNAVK GKVERVRF+KDG+ LQLTA+DG+RA V +PNDPDL+DILA
Sbjct  59   SDLPEGTNWRYSEFLNAVKGGKVERVRFAKDGTTLQLTAIDGKRANVTLPNDPDLVDILA  118

Query  580  MNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            MNGVDISVSEGE  N   + +G   FP   F   F  F
Sbjct  119  MNGVDISVSEGEATNSYINVLGNLLFPLLAFGGLFFLF  156



>gb|KIZ07525.1| cell division protease FtsH [Monoraphidium neglectum]
Length=129

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  373  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  552
            AP  +   AS LPEG+QWRYSEF+NAV+ GKVERVRFSKDGS LQLTA+DGRRATV++PN
Sbjct  44   APALRDDAASGLPEGNQWRYSEFINAVQGGKVERVRFSKDGSMLQLTAIDGRRATVVLPN  103

Query  553  DPDLIDILAMNGVDISVSEGE  615
            DPDL+DILA NGVDISVSEGE
Sbjct  104  DPDLVDILARNGVDISVSEGE  124



>emb|CEF99105.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=572

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 100/161 (62%), Gaps = 8/161 (5%)
 Frame = +1

Query  217  ATLAALLFS--SIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  390
            +T+AA L +  ++A    A  +  PA  PT  QA A Q   SN+   SQ+       P  
Sbjct  34   STVAATLMAVATLASAGAAKADFAPAPEPT--QAVAEQRGESNSIFASQS----QEAPAV  87

Query  391  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLID  570
              A  LPEG  WRYSEF+ AV  GKVERVRFSKDGSALQLTAV+G RATVI+PNDPDL+D
Sbjct  88   TNADGLPEGINWRYSEFIRAVTSGKVERVRFSKDGSALQLTAVNGARATVILPNDPDLVD  147

Query  571  ILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            ILA NGVDISVSEGE    + S IG   FP   F   F  F
Sbjct  148  ILAKNGVDISVSEGEQQGNVASLIGNLLFPLVAFGGLFFLF  188



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = +1

Query  352  SQNVVLNAP--KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG  525
            S N   +AP   P+ +    LPEG+QWRYSEF+NAV+ GKVERVRFSKDGS LQLTAVDG
Sbjct  105  SMNFASSAPLAAPEVRSEYTLPEGNQWRYSEFVNAVEAGKVERVRFSKDGSQLQLTAVDG  164

Query  526  RRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            RRATV++PNDPDL+DILA NGVDISVSEG+      + +G   FP   F   F  F
Sbjct  165  RRATVVLPNDPDLVDILAKNGVDISVSEGDQQGNYVALLGNILFPLIAFGGLFFLF  220



>ref|XP_005843263.1| hypothetical protein CHLNCDRAFT_141387 [Chlorella variabilis]
 gb|EFN51161.1| hypothetical protein CHLNCDRAFT_141387 [Chlorella variabilis]
Length=259

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  406  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  585
            LPEG+QWRYSEF+NAV+ GKVERVRFSKDG+ LQLTAVDGRRA V++PNDP+L+DILA N
Sbjct  82   LPEGTQWRYSEFINAVQSGKVERVRFSKDGTQLQLTAVDGRRALVVLPNDPELVDILARN  141

Query  586  GVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            GVDISVSEG+      + +G   FP   F   FL F
Sbjct  142  GVDISVSEGDQQGNYVALLGNLLFPLIAFAGLFLLF  177



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 103/166 (62%), Gaps = 8/166 (5%)
 Frame = +1

Query  208  SSKATLAALLFSSIAPQAIALDNATP--AAPPTEIQAE--APQPTASNASPFSQNVVLNA  375
            ++ A L A L ++    A+A D   P   A  T   AE  APQ  A   +   Q     A
Sbjct  63   TAMAGLVAFLMAATPNAAVAADTFAPPEGATTTTTFAERPAPQSLALGGASAGQQ----A  118

Query  376  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPND  555
            P  + +  + LPEG+QWRYSEF+NAV+ GKVERVRFSKDG+ LQLTA+DGRRATV++PND
Sbjct  119  PALRDEATAGLPEGNQWRYSEFINAVQSGKVERVRFSKDGTMLQLTAIDGRRATVVLPND  178

Query  556  PDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            P+L+DILA NGVDISVSEGE      + +G   FP   F   F  F
Sbjct  179  PELVDILARNGVDISVSEGEQQGNFAALLGNILFPLLAFGGLFFLF  224



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 90/137 (66%), Gaps = 7/137 (5%)
 Frame = +1

Query  289  APPTEIQAEAPQPTASNASPFSQNVVLNAP--KPQAQPASDLPEGSQWRYSEFLNAVKKG  462
            APP E        T  N +P S     +AP   P+ +    LPEG+QWRYS+F+NAV+ G
Sbjct  85   APPPETNT-----TTINQAPQSVQFGASAPLTAPEVRSEYQLPEGNQWRYSDFVNAVEAG  139

Query  463  KVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFI  642
            KVERVRFSKDGS LQLTAVDGRRATV++PNDPDL+DILA NGVDISVSEG+      + +
Sbjct  140  KVERVRFSKDGSQLQLTAVDGRRATVVLPNDPDLVDILAKNGVDISVSEGDQQGNYVALL  199

Query  643  GKSAFPFPCFRRAFLSF  693
            G   FP   F   F  F
Sbjct  200  GNILFPLIAFGGLFFLF  216



>ref|XP_003081278.1| FTSH_MEDSA Cell division protein ftsH homolog, chloroplast precursor 
(ISS) [Ostreococcus tauri]
Length=662

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 88/132 (67%), Gaps = 4/132 (3%)
 Frame = +1

Query  310  AEAPQPTASNASPFSQNVVLNAPKPQAQPA----SDLPEGSQWRYSEFLNAVKKGKVERV  477
            A AP+PT + A    ++  + A + Q  PA      LPEG  WRYSEF+ AV  GKVERV
Sbjct  17   APAPEPTQAVAEQRGESNSIFASQSQEAPAVTNADGLPEGINWRYSEFIRAVTSGKVERV  76

Query  478  RFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAF  657
            RFSKDGSALQLTAV+G RATVI+PNDPDL+DILA NGVDISVSEGE    + S IG   F
Sbjct  77   RFSKDGSALQLTAVNGARATVILPNDPDLVDILAKNGVDISVSEGEQQGNVASLIGNLLF  136

Query  658  PFPCFRRAFLSF  693
            P   F   F  F
Sbjct  137  PLVAFGGLFFLF  148



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = +1

Query  208  SSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP-----QPTASNASPFSQNVVLN  372
            ++ A+  A L +S A   +A+  A   APP    AEAP     Q   S  S FS      
Sbjct  57   TTAASFMAFLAASGATSLVAM--ADDFAPPA--TAEAPTSALAQFQQSAKSAFSDADSQT  112

Query  373  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  552
            AP       + LPEG+ WRYSEF+NAV+KGKVERVRF+KDGS+LQLTAVDGRRA V +PN
Sbjct  113  APSTAVADPNALPEGNTWRYSEFINAVQKGKVERVRFAKDGSSLQLTAVDGRRAAVTLPN  172

Query  553  DPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            DP+L+DILA NGVDISVSEGE      S  G   FP   F   F  F
Sbjct  173  DPELVDILAKNGVDISVSEGEQQGNFASLAGNLLFPLLAFGGLFFLF  219



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 97/162 (60%), Gaps = 12/162 (7%)
 Frame = +1

Query  217  ATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQP  396
            ATL A      A  A A+D   PA P  E Q  A Q T +  S       L+AP      
Sbjct  55   ATLTAFATLQNAQMASAID--FPAMPAVEQQQSAEQTTEAFPS-------LSAPSTTVAS  105

Query  397  ASD---LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLI  567
             +D   LPEG+ WRYSEF+ AV  GKVERVRF+KDGS+LQLTAV+G RATV++PNDP+L+
Sbjct  106  TTDASGLPEGATWRYSEFIKAVLGGKVERVRFAKDGSSLQLTAVNGNRATVVLPNDPELV  165

Query  568  DILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            DILA NGVDISVSEGE      S +G   FP   F   F  F
Sbjct  166  DILAKNGVDISVSEGEQQGNAASLLGNVLFPVIAFAGLFFLF  207



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  406  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  585
            LPEG+QWRYSEF+NAV+ GKVERVRFSK+G  LQLTAVDGRRA V++PNDP+L+DILA N
Sbjct  131  LPEGNQWRYSEFINAVQNGKVERVRFSKEGGQLQLTAVDGRRAFVVLPNDPELVDILAKN  190

Query  586  GVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            GVDISVSEG+      S +G   FP   F   F  F
Sbjct  191  GVDISVSEGDQQGNYVSLLGNLLFPLIAFGGLFFLF  226



>ref|XP_001419590.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=651

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +1

Query  397  ASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDIL  576
            A  LPEG+ WRYSEF+ AV  GKVERVRFSKDGSALQLTAV+G RATVI+PNDP+L+DIL
Sbjct  46   ADGLPEGNNWRYSEFIKAVMSGKVERVRFSKDGSALQLTAVNGARATVILPNDPELVDIL  105

Query  577  AMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            A NGVDISVSEGE      S +G   FP   F   F  F
Sbjct  106  AKNGVDISVSEGEQQGNAASLVGNLLFPLVAFGGLFFLF  144



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 90/131 (69%), Gaps = 14/131 (11%)
 Frame = +1

Query  283  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  459
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  22   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  76

Query  460  GKVERVRFSKDGSALQLTAVDGRRATVIVPN----DPDLIDILAMNGVDISVSEGE-GGN  624
            GKVERVRFSKDGS         RR +    +    DPDLIDILAMNGVDISVSEGE  GN
Sbjct  77   GKVERVRFSKDGSVCSAYC---RRQSPCFSHRPLTDPDLIDILAMNGVDISVSEGESSGN  133

Query  625  GLFSFIGKSAF  657
             LF+ IG   F
Sbjct  134  DLFTVIGNLIF  144



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +1

Query  367  LNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV  546
            L AP  +    + LPEG+ WRYSEF+ AV  GKVERVRF+KDG++LQLTAVDGRRA V +
Sbjct  102  LTAPDTKVVDPNALPEGNTWRYSEFIRAVMGGKVERVRFAKDGTSLQLTAVDGRRAQVTL  161

Query  547  PNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
            PNDP+L+DILA NGVDISVSEG+      S  G   FP   F   F  F
Sbjct  162  PNDPELVDILAKNGVDISVSEGDQQGNYASLFGNLLFPLLAFGGLFFLF  210



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  406  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  585
            LPEG+QWRYS+F+NAV+ GK+ERVRFSKDG+ LQLTA+DGRRA V   NDP+L+D LA N
Sbjct  120  LPEGTQWRYSDFINAVESGKIERVRFSKDGTQLQLTAIDGRRALVNAVNDPELVDRLAKN  179

Query  586  GVDISVSEGEGGNGLFS  636
            GVDISVSEGE   G  S
Sbjct  180  GVDISVSEGEQQGGFVS  196



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 5/90 (6%)
 Frame = +1

Query  277  ATPAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAV  453
            A P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AV
Sbjct  57   APPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAV  112

Query  454  KKGKVERVRFSKDGSALQLTAVDGRRATVI  543
            KKGKVERVRFSKDG  LQLTA+DGRRATV+
Sbjct  113  KKGKVERVRFSKDGGLLQLTAIDGRRATVV  142



>gb|AFW63099.1| hypothetical protein ZEAMMB73_047704 [Zea mays]
Length=321

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 76/114 (67%), Gaps = 11/114 (10%)
 Frame = +1

Query  259  AIALDNA--TPA---APPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQ  423
            A+A D +  TPA    P  ++Q EAP PTA+   PFS N +L A KP A  A DLPEG+ 
Sbjct  88   ALATDTSATTPAPLSVPAPKLQIEAPAPTAN---PFS-NSLLTALKPSAS-AYDLPEGAD  142

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  585
             R+  F + +K+GK E VRFSKDG  LQL AVDG   TV+VPNDPDLIDILAM 
Sbjct  143  NRHIVFPSVIKRGK-EPVRFSKDGGLLQLAAVDGCHTTVVVPNDPDLIDILAMR  195



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +1

Query  403  DLPEGSQ--WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDIL  576
            D P+ SQ  W+YS+F++ V+  KVERV  S D S    TA DG+R TV +PNDP+LIDIL
Sbjct  30   DRPQNSQLSWKYSQFIDEVQGDKVERVNLSADRSVAIATARDGQRYTVNLPNDPELIDIL  89

Query  577  AMNGVDISV  603
            + NGVDISV
Sbjct  90   SNNGVDISV  98



>ref|WP_015230925.1| ATP-dependent metalloprotease FtsH [Dactylococcopsis salina]
 gb|AFZ51951.1| ATP-dependent metalloprotease FtsH [Dactylococcopsis salina PCC 
8305]
Length=617

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYSEF+N V+ G VE VR + D S +  TA DG++  V +PNDP LIDIL  N VDISV
Sbjct  41   WRYSEFVNRVENGNVESVRLNSDRSKVIATAQDGQQVQVSLPNDPQLIDILTENNVDISV  100

Query  604  S-EGEGGNGLFSFIGKSAFPFPC  669
              E + G   F F   S+  FP 
Sbjct  101  QPENDDG---FLFRALSSLFFPI  120



>ref|WP_015227551.1| membrane protease FtsH catalytic subunit [Halothece sp. PCC 7418]
 gb|AFZ45679.1| membrane protease FtsH catalytic subunit [Halothece sp. PCC 7418]
Length=617

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYSEF+N V+ G VE VR + D S    TA DG++  V +PNDP LIDIL  N VDISV
Sbjct  41   WRYSEFVNRVENGNVESVRLNSDRSKAIATAQDGQQVQVTLPNDPQLIDILTENNVDISV  100

Query  604  S-EGEGGNGLFSFIGKSAFPFPC  669
              E + G   F F   S+  FP 
Sbjct  101  QPESDDG---FLFRALSSLFFPI  120



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  418  SQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDI  597
            + W+YSEFL+ V++GKVERV+ S D S  ++   DG+  TV +PNDP L++ILA NGVDI
Sbjct  38   TTWKYSEFLDQVRQGKVERVQLSADRSEARVPTQDGQYVTVNLPNDPQLVNILADNGVDI  97

Query  598  SV  603
             V
Sbjct  98   VV  99



>ref|WP_009630197.1| ATP-dependent metalloprotease FtsH [Synechocystis sp. PCC 7509]
Length=612

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V++GKVERV  S D +  Q+T  DG +  V + NDPDLIDIL+ N VDI V
Sbjct  36   WRYSQFIQEVQQGKVERVSLSADRTRAQVTPQDGEKKIVNLLNDPDLIDILSKNNVDIVV  95

Query  604  S  606
            S
Sbjct  96   S  96



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  418  SQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDI  597
            S W+YSEFL+ V++GKVERV+ S D +  ++   +G+  TV +PNDP L++ILA NGVDI
Sbjct  38   STWKYSEFLDQVRQGKVERVQLSADRAEARVPTQNGQYVTVNLPNDPQLVNILAENGVDI  97

Query  598  SV  603
             V
Sbjct  98   VV  99



>ref|WP_015204207.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 gb|AFZ14101.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=613

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEF+  V+ GKVERV  S D +   +TA DG +  V +PNDPDL++IL   GVDI+V
Sbjct  37   WKYSEFIQEVESGKVERVGLSSDRTKALVTAQDGNKVIVNLPNDPDLVNILTSKGVDIAV  96



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V++G+VERV  S D +   +T +DG +  V +PNDPDLI+IL  N VDISV
Sbjct  36   WRYSQFIQEVEQGRVERVSLSADRTRALVTPLDGEKRVVNLPNDPDLINILTRNQVDISV  95



>ref|WP_036001623.1| cell division protein FtsH [Leptolyngbya sp. JSC-1]
Length=612

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F++ V+ G+VE+V  S D S   +T  DG+R  V +P DP+L++IL  NGVDISV
Sbjct  36   WRYSQFIDRVETGQVEKVNISADRSRALVTTSDGQRVAVNLPADPELLNILQTNGVDISV  95

Query  604  S  606
            S
Sbjct  96   S  96



>ref|WP_015224048.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 gb|AFZ48735.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=615

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 7/75 (9%)
 Frame = +1

Query  379  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  558
            +PQ Q +S       W+YS+F++ V+  +VERV+ S D S    TA DG+R  V +PNDP
Sbjct  31   RPQEQQSS-------WKYSQFIDEVQTNRVERVQLSADRSQAIATARDGQRFLVNLPNDP  83

Query  559  DLIDILAMNGVDISV  603
             L+DIL+ N VDISV
Sbjct  84   QLVDILSDNQVDISV  98



>ref|WP_044492620.1| cell division protein FtsH [Moorea producens]
Length=613

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 50/89 (56%), Gaps = 6/89 (7%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    WRY + ++ V+ GKVE VR S D S     A DGR+  V +PNDP LI++L  NG
Sbjct  31   PSRDTWRYDQLISQVESGKVETVRISADRSKAIAIAQDGRQVEVNLPNDPQLINLLNNNG  90

Query  589  VDISV--SEGEGGNGLFSFIGKSAFPFPC  669
            VDISV     EG    F F   S+F FP 
Sbjct  91   VDISVLPQSDEG----FWFKTLSSFFFPI  115



>gb|EGJ33321.1| membrane protease FtsH catalytic subunit [Moorea producens 3L]
Length=597

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 50/89 (56%), Gaps = 6/89 (7%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    WRY + ++ V+ GKVE VR S D S     A DGR+  V +PNDP LI++L  NG
Sbjct  15   PSRDTWRYDQLISQVESGKVETVRISADRSKAIAIAQDGRQVEVNLPNDPQLINLLNNNG  74

Query  589  VDISV--SEGEGGNGLFSFIGKSAFPFPC  669
            VDISV     EG    F F   S+F FP 
Sbjct  75   VDISVLPQSDEG----FWFKTLSSFFFPI  99



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGSKVIVNLPNDPALIDILTENNVDISV  95



>ref|NP_001173800.1| Os04g0220500 [Oryza sativa Japonica Group]
 dbj|BAH92528.1| Os04g0220500 [Oryza sativa Japonica Group]
Length=1510

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = +1

Query  475  VRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLF-SFIGK  648
            VR   D     LTA+DGR   V++PN PDLIDILA N VDISV EG+  G G F +F+G 
Sbjct  244  VRTESDDLGNDLTAIDGRYTIVVIPNAPDLIDILATNDVDISVVEGDAAGLGEFLAFVGN  303

Query  649  SAFPFPCFRRAFLSF  693
              FPF  F   F  F
Sbjct  304  LLFPFLAFASLFFIF  318



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +1

Query  403  DLPEGSQ--WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDIL  576
            D P+ +Q  W+YS+F++ V+  KVERV+ S D +    TA DG+R  V +PNDP LIDIL
Sbjct  30   DRPQTNQLSWKYSQFIDEVQTDKVERVQLSADRTQAIATARDGQRFLVNLPNDPQLIDIL  89

Query  577  AMNGVDISV  603
            + N VDI+V
Sbjct  90   SDNKVDIAV  98



>gb|EEE60537.1| hypothetical protein OsJ_13877 [Oryza sativa Japonica Group]
Length=869

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = +1

Query  505  QLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLF-SFIGKSAFPFPCFRR  678
            +LTA+DGR   V++PN PDLIDILA N VDISV EG+  G G F +F+G   FPF  F  
Sbjct  141  KLTAIDGRYTIVVIPNAPDLIDILATNDVDISVVEGDAAGLGEFLAFVGNLLFPFLAFAS  200

Query  679  AFLSF  693
             F  F
Sbjct  201  LFFIF  205



>ref|WP_015129349.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
 gb|AFY33539.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
Length=612

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 6/83 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+KG+V++V  S D S   +T+ DG +  V + NDPDLI+ L   GVDISV
Sbjct  36   WRYSQFIQEVEKGRVDKVSLSADRSTALVTSRDGNKKVVTLVNDPDLINTLTAKGVDISV  95

Query  604  --SEGEGGNGLFSFIGKSAFPFP  666
                 EG    F F   S+  FP
Sbjct  96   LPQTDEG----FWFKALSSLFFP  114



>ref|WP_012627305.1| cell division protein FtsH [Cyanothece sp. PCC 7425]
 gb|ACL44219.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7425]
Length=612

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    WRYS+F+ AV+  +V +V  S D +  Q+T  DG R  V +PNDP+LIDIL  N 
Sbjct  31   PTRQVWRYSQFIQAVENRQVAKVSISPDRTQAQVTVQDGSRVMVNLPNDPELIDILTNNK  90

Query  589  VDISV  603
            VDISV
Sbjct  91   VDISV  95



>ref|XP_005713345.1| cell division protein FtsH [Chondrus crispus]
 emb|CDF33542.1| cell division protein FtsH [Chondrus crispus]
Length=711

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  600
            WRYSEF+NAV+K +VE+V FS DG  L     +G R  +  +PNDPDL+  L  + VD++
Sbjct  125  WRYSEFINAVEKDQVEKVTFSADGQRLLAVDTEGNRFKLDALPNDPDLLKTLTGHKVDVT  184

Query  601  VSEGEGGNGLFSFIGKSAFP  660
            V   +  +G   FI    FP
Sbjct  185  VLPSQPESGAGDFIRSLIFP  204



>ref|XP_005834056.1| hypothetical protein GUITHDRAFT_86435 [Guillardia theta CCMP2712]
 gb|EKX47076.1| hypothetical protein GUITHDRAFT_86435 [Guillardia theta CCMP2712]
Length=695

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  600
            WRYSEF+NAV+  KVE+V FS DG  +    VDG R  +  +PNDP L+D L  + VD++
Sbjct  106  WRYSEFMNAVEGDKVEKVTFSADGRRVLAVDVDGNRYKLDALPNDPTLLDTLTKHKVDVT  165

Query  601  V----SEGEGGNGLFSFI  642
            V      G GG+ + S I
Sbjct  166  VLPAQQPGGGGDLIRSLI  183



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS+ +  V+ G++E +R + D S   +T  DG +  V +PNDP+LIDIL  N VDISV
Sbjct  40   WKYSQLIQEVESGRIETIRLTADRSQASVTTQDGTQVLVNLPNDPELIDILTTNNVDISV  99



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_006623490.1| cell division protein FtsH [Arthrospira sp. PCC 8005]
 emb|CCE19163.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
 gb|EKD09489.1| ATP-dependent metalloprotease FtsH [Arthrospira platensis C1]
 emb|CDM97762.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
Length=600

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  V++ +VERV  S D +   +TA DG +  V +PNDPDLI+IL+ N VDI+V
Sbjct  24   WKYSTFVQEVQQNRVERVSISADRTKALVTAQDGSKILVNLPNDPDLINILSENNVDIAV  83



>ref|WP_006618677.1| FtsH peptidase [Arthrospira platensis]
 dbj|BAI92105.1| cell division protein FtsH [Arthrospira platensis NIES-39]
 gb|KDR55786.1| cell division protein FtsH [Arthrospira platensis str. Paraca]
Length=612

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  V++ +VERV  S D +   +TA DG +  V +PNDPDLI+IL+ N VDI+V
Sbjct  36   WKYSTFVQEVQQNRVERVSISADRTKALVTAQDGSKILVNLPNDPDLINILSENNVDIAV  95



>ref|WP_006669335.1| MULTISPECIES: cell division protein FtsH [Arthrospira]
 gb|EDZ94639.1| ATP-dependent metalloprotease FtsH [Arthrospira maxima CS-328]
Length=612

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  V++ +VERV  S D +   +TA DG +  V +PNDPDLI+IL+ N VDI+V
Sbjct  36   WKYSTFVQEVQQNRVERVSISADRTKALVTAQDGSKILVNLPNDPDLINILSENNVDIAV  95



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEFL  V++GKVE VR S D     +   +G    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQEGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_035174132.1| cell division protein FtsH, partial [Calothrix sp. PCC 7103]
Length=69

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +1

Query  421  QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV-DGRRATVIVPNDPDLIDILAMNGVDI  597
            QWRYS+F+  V+KG +E+V F +DG+   +T+  D ++  V + NDP+LI IL    VDI
Sbjct  6    QWRYSKFIQEVEKGNIEKVSFYRDGTTAIVTSKNDAKQKRVNLVNDPELIKILINKDVDI  65

Query  598  SV  603
            +V
Sbjct  66   NV  67



>ref|XP_005708438.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME31918.1| AAA-type ATPase [Galdieria sulphuraria]
Length=767

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 1/90 (1%)
 Frame = +1

Query  421  QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDI  597
            +WRYSE ++AVK+ +VE+V FS DG+ L    VDG R  +  +PND +L+ +L  + VDI
Sbjct  172  KWRYSELIHAVKEDQVEKVTFSPDGNQLLAIDVDGNRHKLDALPNDSNLLKLLTEHNVDI  231

Query  598  SVSEGEGGNGLFSFIGKSAFPFPCFRRAFL  687
             V       G F F+     P   F   FL
Sbjct  232  RVLPQRQEGGPFDFLKSLIVPGVLFGGLFL  261



>ref|WP_007356988.1| MULTISPECIES: cell division protein FtsH [Kamptonema]
 emb|CBN57796.1| FtsH peptidase [ [[Oscillatoria] sp. PCC 6506]
Length=612

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    W+YSEF+  V+  +V++V  + D +   +T+ DG +  V +PNDP+LI+IL  NG
Sbjct  31   PSRQLWKYSEFIEQVQSKRVDKVSINADRTRALVTSQDGTKVLVNLPNDPELINILTTNG  90

Query  589  VDISV  603
            VDISV
Sbjct  91   VDISV  95



>ref|WP_015173051.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
 gb|AFY67487.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
Length=613

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  600
            WRYS+F+ +V+  KVE+V  S D +   +T+ DG +  V I PNDPDLI+IL  N +DIS
Sbjct  36   WRYSQFIQSVENNKVEKVSISADRTRALVTSFDGSKILVNIPPNDPDLINILTANNIDIS  95

Query  601  V  603
            V
Sbjct  96   V  96



>ref|WP_015146710.1| membrane protease FtsH catalytic subunit [Oscillatoria acuminata]
 gb|AFY80060.1| membrane protease FtsH catalytic subunit [Oscillatoria acuminata 
PCC 6304]
Length=612

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 53/82 (65%), Gaps = 4/82 (5%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+  ++++V  + D S  ++TA DG++  V +PNDP+L++IL  + V+I V
Sbjct  36   WRYSQFIQEVQNDRIDKVVITSDRSRAKVTAQDGKKVVVNLPNDPELLNILTEHRVNIEV  95

Query  604  S-EGEGGNGLFSFIGKSAFPFP  666
            S +G+ G   F F   S+  FP
Sbjct  96   SPQGDEG---FWFKALSSLFFP  114



>ref|WP_017653544.1| cell division protein FtsH [Microchaete sp. PCC 7126]
Length=612

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 7/89 (8%)
 Frame = +1

Query  409  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  585
            P+G +  RYS+F+  V+KG+V++V  S D S   +T+ DG +  V + NDPDLI+ L   
Sbjct  30   PQGREPLRYSQFIQEVEKGRVDKVSLSADRSTALVTSRDGNKKVVTLVNDPDLINTLTAK  89

Query  586  GVDISV--SEGEGGNGLFSFIGKSAFPFP  666
            GVDISV     EG    F F   S+  FP
Sbjct  90   GVDISVLPQTDEG----FWFKALSSLFFP  114



>ref|WP_015177320.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis]
 gb|AFZ08063.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis 
PCC 7112]
Length=612

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    W+YS+F+  V+  +V+++  S D S   +TA DG +  V +PNDP+LI+IL  N 
Sbjct  31   PSREVWKYSQFIQEVEGKRVDKINISSDRSKALVTAQDGNKVLVNLPNDPELINILTKNN  90

Query  589  VDISV  603
            VDISV
Sbjct  91   VDISV  95



>ref|WP_006633639.1| cell division protein FtsH [Microcoleus vaginatus]
 gb|EGK87327.1| ATP-dependent metalloprotease FtsH [Microcoleus vaginatus FGP-2]
Length=612

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    W+YS+F+  V+  +V+++  S D S   +TA DG +  V +PNDP+LI+IL  N 
Sbjct  31   PSREVWKYSQFIQEVEGKRVDKINISSDRSKALVTAQDGNKVLVNLPNDPELINILTKNN  90

Query  589  VDISV  603
            VDISV
Sbjct  91   VDISV  95



>ref|WP_008316727.1| ATP-dependent metalloprotease FtsH [Leptolyngbya sp. PCC 6406]
Length=613

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR-RATVIVPNDPDLIDILAMNG  588
            E   WRYS FLNAV+   +ERV  S D +  + TA DG  + TV +PNDP+LI +L  N 
Sbjct  32   ETQSWRYSRFLNAVESNTIERVSISADRARARFTAPDGSGQVTVNLPNDPELIGLLEQNN  91

Query  589  VDISV  603
            VDI V
Sbjct  92   VDIVV  96



>ref|WP_009782358.1| cell division protein FtsH [Lyngbya sp. PCC 8106]
 gb|EAW38903.1| cell division protein [Lyngbya sp. PCC 8106]
Length=612

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 47/84 (56%), Gaps = 6/84 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  V+  +VERV  S D S   +TA DG +  V +P DP LIDIL+ N VDISV
Sbjct  36   WKYSTFIQEVENNQVERVSLSADRSKALVTAEDGAKIMVNLPPDPGLIDILSQNNVDISV  95

Query  604  --SEGEGGNGLFSFIGKSAFPFPC  669
                 EG    F F   S+  FP 
Sbjct  96   MPQSDEG----FWFKALSSLFFPI  115



>ref|WP_006198086.1| cell division protein FtsH [Nodularia spumigena]
 gb|EAW43768.1| cell division protein [Nodularia spumigena CCY9414]
 gb|AHJ29621.1| Cell division protein FtsH [Nodularia spumigena CCY9414]
Length=612

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    WRYS+F+  V +G+V+RV  S D S   +T+ DG +  V + NDP+LI+ L+  G
Sbjct  31   PTRETWRYSQFIQEVDQGRVDRVNLSADRSIAYVTSRDGDKKVVNLVNDPELINNLSDKG  90

Query  589  VDISV--SEGEGGNGLFSFIGKSAFPFP  666
            VDISV     EG    F F   S+  FP
Sbjct  91   VDISVVPQTDEG----FWFKALSSLFFP  114



>ref|WP_041036156.1| cell division protein FtsH [Tolypothrix campylonemoides]
 gb|KIJ75867.1| cell division protein FtsH [Tolypothrix campylonemoides VB511288]
Length=613

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 6/83 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+ G+V +V  S D S   +T  DG +  V + NDPDLI+ L  +GVDISV
Sbjct  37   WRYSQFIQEVQNGRVAKVSLSADRSTALVTPGDGSKKLVTLVNDPDLINTLTQHGVDISV  96

Query  604  --SEGEGGNGLFSFIGKSAFPFP  666
                 EG    F F   S+  FP
Sbjct  97   LPQTDEG----FWFKALSSLFFP  115



>ref|WP_009341877.1| cell division protein FtsH [Raphidiopsis brookii]
 gb|EFA73959.1| Peptidase M41, FtsH [Raphidiopsis brookii D9]
Length=613

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  585
            P+   WRYSEF+  V++G+VERV  S D +   +T   D  +  VI+ NDPDLI+ L+  
Sbjct  31   PQVETWRYSEFIQQVEQGRVERVSLSSDRTTAVVTPKYDPNKKRVILVNDPDLINTLSSK  90

Query  586  GVDISV  603
            GVDI+V
Sbjct  91   GVDIAV  96



>ref|WP_028090468.1| cell division protein FtsH [Dolichospermum circinale]
Length=614

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V++G+VERV  S D S   +T   D ++  V + NDPDLI+ L   GVDIS
Sbjct  37   WRYSQFIQEVERGRVERVSLSSDRSTALVTPKYDEKKKIVTLVNDPDLINTLTAKGVDIS  96

Query  601  V  603
            V
Sbjct  97   V  97



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+ AV+KG+V +VR S D +   +   DG +  V +P+DP+LI IL   GVDI+V
Sbjct  36   WRYSDFIQAVEKGRVAQVRLSADRTRALVKPQDGSQVIVNLPDDPELISILTERGVDIAV  95



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+ AV+KG+V +VR S D +   +   DG +  V +P+DP+LI IL   GVDI+V
Sbjct  36   WRYSDFIQAVEKGRVAQVRLSADRTRALVKPQDGSQVIVNLPDDPELISILTERGVDIAV  95



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRY +F++ VK  KVE V+ S D +   +TA DG +  V +PNDP+LI IL  N VDI V
Sbjct  36   WRYDQFIDNVKSKKVEIVQLSSDRTQAMVTAQDGTQYQVNLPNDPELISILTNNNVDIKV  95



>ref|WP_006278775.1| cell division protein FtsH [Cylindrospermopsis raciborskii]
 gb|EFA68434.1| Peptidase M41, FtsH [Cylindrospermopsis raciborskii CS-505]
Length=613

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  585
            P+   WRYSEF+  V++G+VERV  S D +   +T   D  +  VI+ NDPDLI+ L+  
Sbjct  31   PQVETWRYSEFIQQVEQGRVERVSLSSDRTTAVVTPKYDPNKKRVILVNDPDLINTLSNK  90

Query  586  GVDISV  603
            GVDI+V
Sbjct  91   GVDIAV  96



>ref|WP_023067153.1| ATP-dependent zinc metalloprotease FtsH 3 [Lyngbya aestuarii]
 gb|ERT06646.1| ATP-dependent zinc metalloprotease FtsH 3 [Lyngbya aestuarii 
BL J]
Length=612

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 47/84 (56%), Gaps = 6/84 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  V+  +VERV  S D S   +TA DG +  V +P DP LIDIL+ N VDISV
Sbjct  36   WKYSTFIQEVENNQVERVSLSADRSKALVTAEDGAKIMVNLPPDPGLIDILSENNVDISV  95

Query  604  --SEGEGGNGLFSFIGKSAFPFPC  669
                 EG    F F   S+  FP 
Sbjct  96   MPQSDEG----FWFKALSSLFFPI  115



>ref|WP_015214216.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica]
 gb|AFZ57570.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica 
PCC 7122]
Length=613

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 48/89 (54%), Gaps = 7/89 (8%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  585
            P+   WRYSEF+  V KG+VE+V  S D S   +T   D  +  V + NDPDLI+ L   
Sbjct  31   PQVETWRYSEFIQEVDKGRVEKVSLSSDRSTAMVTPKYDLNKKRVTLVNDPDLINTLTAK  90

Query  586  GVDISV--SEGEGGNGLFSFIGKSAFPFP  666
            GVDI+V     EG    F F   S+  FP
Sbjct  91   GVDIAVLPQTDEG----FWFKALSSLFFP  115



>ref|WP_028082599.1| cell division protein FtsH [Dolichospermum circinale]
Length=614

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V++G+VERV  S D S   +T   D ++  V + NDPDLI+ L   GVDIS
Sbjct  37   WRYSQFIQEVQRGRVERVSLSSDRSTALVTPKYDEKKKIVTLVNDPDLINTLTDKGVDIS  96

Query  601  V  603
            V
Sbjct  97   V  97



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +1

Query  418  SQWRYSEFLNAVKKGKVER-VRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVD  594
            + W+YS F+N V+ G+V+  V+ S D S   +TA DG +  V +PNDP LIDIL  N VD
Sbjct  39   TTWKYSRFINEVESGRVQGIVKLSADRSQALVTAQDGTQVEVNLPNDPQLIDILTDNNVD  98

Query  595  ISV  603
            I+V
Sbjct  99   IAV  101



>ref|WP_019497657.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=91

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            W YS+F+ +VK G+VERV  S D + A+    +D  R  V + NDP+LI+IL  N VDIS
Sbjct  27   WEYSKFIQSVKDGRVERVSLSADRTIAIVKVKLDPNRKKVNLSNDPNLINILTENQVDIS  86

Query  601  V  603
            V
Sbjct  87   V  87



>gb|KIJ85386.1| cell division protein FtsH [Scytonema tolypothrichoides VB-61278]
Length=613

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 6/88 (7%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    WRYS+F+  V+  +V++V  S D S   +T  DG +  V + NDPDLI+ L  N 
Sbjct  32   PSRETWRYSQFIQEVQNRRVDKVSLSADRSTALVTPKDGNKKLVTLVNDPDLINTLTQNN  91

Query  589  VDISV--SEGEGGNGLFSFIGKSAFPFP  666
            VDISV     EG    F F   S+  FP
Sbjct  92   VDISVLPQTDEG----FWFKALSSLFFP  115



>ref|WP_017291153.1| cell division protein FtsH [Leptolyngbya boryana]
Length=613

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+K  V +V  S D +   + + DG R  V +P DP+LI IL  N VDISV
Sbjct  36   WRYSQFIQEVEKNNVNKVSLSADRTRALVQSEDGNRVLVNLPTDPELISILTRNNVDISV  95

Query  604  SEGEGGNGLFSFIGKSAFPFPC  669
                 GN  F     S+  FP 
Sbjct  96   LPATDGND-FWLRAVSSLFFPI  116



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 6/84 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS+F+N V+ G VE V+ S D +   +   +G    V +PNDP LIDIL+  GVDI+V
Sbjct  40   WKYSKFINEVETGNVESVKISADRTRAVVIGQEGNPIVVNLPNDPQLIDILSQKGVDIAV  99

Query  604  --SEGEGGNGLFSFIGKSAFPFPC  669
                 EG    F F   S+  FP 
Sbjct  100  LPQSDEG----FWFRALSSLFFPI  119



>ref|WP_011613138.1| cell division protein FtsH [Trichodesmium erythraeum]
 gb|ABG52807.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Trichodesmium erythraeum IMS101]
Length=613

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS+F+  V+   VE+V  S D +  ++   DG    V +PNDPDLI+IL  N +DISV
Sbjct  37   WKYSQFIQQVENKNVEKVDISADRTVARVKVADGSVVRVNLPNDPDLINILTQNNIDISV  96



>gb|EWM30233.1| atp-dependent metalloprotease [Nannochloropsis gaditana]
Length=794

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISV  603
            RYS+FL+ V+KG++E+V FS DG  L  T  DG+R  +  +PNDPDL+  L    VD++V
Sbjct  129  RYSDFLDMVEKGQIEKVTFSADGQKLVATDTDGQRYRLDALPNDPDLLATLTQKMVDVTV  188



>ref|WP_015208761.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale]
 gb|AFZ25513.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale 
PCC 7417]
Length=613

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = +1

Query  403  DLPEGSQ--WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDI  573
            D P+ S+  WRYS+F+  V+KG+VE+V  S D S   +T   D  +  V + NDPDLI+ 
Sbjct  27   DKPQSSRETWRYSQFIQEVEKGRVEKVSLSSDRSTALVTPKYDPNKKLVTLVNDPDLINT  86

Query  574  LAMNGVDISV  603
            L   GVDISV
Sbjct  87   LTTKGVDISV  96



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTA-VDGRRATVIVPNDPDLIDILAMNG  588
            E   WRYS+FL+AV+  +VERV  S D S  + T    G + TV +PNDP+LI  L  N 
Sbjct  32   ESQTWRYSQFLDAVENNQVERVSISADRSQARFTDPAGGGQITVNLPNDPELISTLETNN  91

Query  589  VDISV  603
            VDI+V
Sbjct  92   VDIAV  96



>emb|CBN76650.1| FtsH protease [Ectocarpus siliculosus]
Length=738

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = +1

Query  340  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  519
            ASPF+ N    AP    Q +    E    RYS+F+NAV+K ++E+V FS DG  L     
Sbjct  104  ASPFA-NAGGQAPPAMMQRSVQTVE--NIRYSDFVNAVEKDEIEKVSFSYDGKKLVAVDT  160

Query  520  DGRRATV-IVPNDPDLIDILAMNGVDISV  603
            DG R  +  +PNDP+L+ IL  + VD++V
Sbjct  161  DGVRVKLDSIPNDPELLTILTKHKVDVTV  189



>ref|WP_015143924.1| ATP-dependent metalloprotease FtsH [Pleurocapsa minor]
 gb|AFY77621.1| ATP-dependent metalloprotease FtsH [Pleurocapsa sp. PCC 7327]
Length=618

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  600
            WRY +F++ V  G+VE V+ + D +   + A DG +  V ++PNDP LID L  NGVDIS
Sbjct  41   WRYDKFISEVTSGRVESVKLTADRTKAIVPAQDGTQVLVNLLPNDPQLIDFLTKNGVDIS  100

Query  601  V  603
            V
Sbjct  101  V  101



>ref|WP_015079544.1| ATP-dependent metalloprotease HflB (FtsH) [Anabaena sp. 90]
 gb|AFW94382.1| ATP-dependent metalloprotease HflB (FtsH) [Anabaena sp. 90]
Length=614

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  VK+G+VERV  S D S   +T   D  +  V + NDPDLI+ L   GVDI+
Sbjct  37   WRYSQFIQEVKQGRVERVSLSSDRSTALVTPKYDPNKKIVTLVNDPDLINTLTNKGVDIA  96

Query  601  V  603
            V
Sbjct  97   V  97



>ref|WP_027401619.1| cell division protein FtsH [Aphanizomenon flos-aquae]
 gb|KHG38940.1| cell division protein FtsH [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=614

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+KG+VERV  S D S   +T   D  +  V + NDPDLI+ L   GVDI+
Sbjct  37   WRYSQFIQEVEKGRVERVSLSSDRSTALVTPKYDPNKKIVTLVNDPDLINTLTNKGVDIA  96

Query  601  V  603
            V
Sbjct  97   V  97



>ref|XP_002177215.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51678.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=673

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 11/132 (8%)
 Frame = +1

Query  319  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQ--------WRYSEFLNAVKKGKVER  474
            P  T+   +  ++ + ++AP P +   +DLP   Q         RYS+FL  V   +VE+
Sbjct  26   PSRTSRRTNNSARYMAVDAPPPASN--NDLPVIQQNSYGQPTDVRYSDFLRLVNADRVEK  83

Query  475  VRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKS  651
            V FS DG+ L    VDG R  +  +PNDPDL+  L  + VD++V   +  +GL       
Sbjct  84   VTFSADGTQLLGVDVDGARVKIEALPNDPDLLTSLTTHKVDVTVLPAQEASGLGELAQSL  143

Query  652  AFPFPCFRRAFL  687
             FP   F   F 
Sbjct  144  IFPAALFAGLFF  155



>ref|WP_016949229.1| cell division protein FtsH [Anabaena sp. PCC 7108]
Length=613

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 48/89 (54%), Gaps = 7/89 (8%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  585
            P+   WRYS+F+  V+ GKVE+V  S D S   +T   D  +  V + NDPDLI+ L   
Sbjct  31   PQVETWRYSQFIQEVETGKVEKVSLSSDRSTAMVTPKYDPNKKRVTLVNDPDLINTLTAK  90

Query  586  GVDISV--SEGEGGNGLFSFIGKSAFPFP  666
            GVDI+V     EG    F F   S+  FP
Sbjct  91   GVDIAVLPQTDEG----FWFKALSSLFFP  115



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+KG+VE+V  S D S   +T   D  +  V + NDPDLI+ L  N VDIS
Sbjct  37   WRYSQFIQEVEKGRVEKVSLSSDRSTAVVTPKYDPNKKLVTLVNDPDLINTLTKNNVDIS  96

Query  601  V  603
            V
Sbjct  97   V  97



>ref|WP_026099187.1| cell division protein FtsH [Prochlorothrix hollandica]
Length=612

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  588
            P    WRYS F+   +  +V +V  S D +A ++T  DG +  V +P+DPDL++IL  + 
Sbjct  31   PTQEVWRYSRFIEEAQSNQVAKVEISPDRTAAKVTVNDGAKVYVNLPDDPDLLNILTRHN  90

Query  589  VDISVS  606
            VDISVS
Sbjct  91   VDISVS  96



>ref|XP_005708136.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME31616.1| AAA-type ATPase [Galdieria sulphuraria]
Length=775

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 69/168 (41%), Gaps = 23/168 (14%)
 Frame = +1

Query  169  LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASP  348
            L +N+  + +K    +   A +L  S+AP    +  A P               A N +P
Sbjct  89   LERNTLLEKWKATLKRIVFAIVLCLSVAPFQTTMTYAAPLRQSRSF-IHTRNTHAKNNTP  147

Query  349  FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR  528
            FS                       WRYS+ L AVK+G+V RV FS D S L     DG 
Sbjct  148  FSV--------------------WSWRYSQLLKAVKQGQVLRVIFSADQSQLIAITKDGG  187

Query  529  RATV--IVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGKSAFPFP  666
            R  +  + P+  +LI  L+ + VDI +      +GL  F+    FP P
Sbjct  188  RYKLRALPPHSSNLIAYLSKHKVDIVILPKYKESGLVYFLKGLLFPIP  235



>ref|WP_022606782.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae]
 gb|ERN41527.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae KORDI 
51-2]
Length=616

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YSEF+N +K  +VE+V+ S D S    TA DG +  V + NDP L  IL  N VDI V
Sbjct  40   WKYSEFINNIKNDRVEQVQLSSDRSEAIATAEDGSKVRVTLVNDPQLDQILLENKVDIDV  99



>ref|WP_013189950.1| cell division protein FtsH [Trichormus azollae]
 gb|ADI62930.1| ATP-dependent metalloprotease FtsH ['Nostoc azollae' 0708]
Length=613

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (54%), Gaps = 7/89 (8%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  585
            P+   WRYS+F+  V+ G+VE+V  S D S   +T   D  +  V + NDPDLI+ L   
Sbjct  31   PQVETWRYSQFIQEVESGRVEKVSLSSDRSTAMVTPKYDPNKKRVTLVNDPDLINTLTTK  90

Query  586  GVDISV--SEGEGGNGLFSFIGKSAFPFP  666
            GVDI+V     EG    F F   S+  FP
Sbjct  91   GVDIAVLPQTDEG----FWFKALSSLFFP  115



>ref|WP_015116388.1| membrane protease FtsH catalytic subunit [Rivularia sp. PCC 7116]
 gb|AFY52810.1| membrane protease FtsH catalytic subunit [Rivularia sp. PCC 7116]
Length=615

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYSEF+ AV+KGKVE+V  S D S   +T   +  +  V + ND DLI+ L  N VDIS
Sbjct  38   WRYSEFIQAVEKGKVEKVSLSSDRSTALVTPKFEPSKRVVTLVNDSDLINTLTKNNVDIS  97

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  98   VLPQTDEG----FWFKALSSLFFP  117



>ref|WP_006528450.1| ATP-dependent metalloprotease FtsH [Gloeocapsa sp. PCC 73106]
 gb|ELR98719.1| ATP-dependent metalloprotease FtsH [Gloeocapsa sp. PCC 73106]
Length=615

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS F+  V+  +VE V+ + D S   +T+ DG    V +PNDP L+DIL  N VDISV
Sbjct  39   WKYSTFIREVENNRVESVKLTPDRSQALVTSQDGTPVIVNLPNDPGLLDILTQNNVDISV  98



>ref|WP_036531425.1| cell division protein FtsH [Neosynechococcus sphagnicola]
 gb|KGF73398.1| cell division protein FtsH [Neosynechococcus sphagnicola sy1]
Length=613

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV-PNDPDLIDILAMN  585
            P    W+YS+F+  V+  KVE+VR S D +   + A DG    V + P+DPDLI+IL  N
Sbjct  31   PSRETWKYSQFIQEVEGKKVEKVRISADRTRAIVKAQDGSDVLVNLPPSDPDLINILTRN  90

Query  586  GVDISV  603
             VDISV
Sbjct  91   NVDISV  96



>ref|WP_015139560.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
 gb|AFY49129.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
Length=613

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+KG+VE+V  S D S   +T   D  +  V + NDPDL++ L   GVDIS
Sbjct  36   WRYSQFIQEVEKGRVEKVSLSADRSTALVTPKYDPSKKLVTLVNDPDLVNTLTSKGVDIS  95

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  96   VLPQTDEG----FWFKALSSLFFP  115



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +1

Query  538  VIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIG  645
            V+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+G
Sbjct  125  VVVPNDPDLIDILATNGVDISVSEGESAGPGGFVAFVG  162



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W+YS  +  V+ GK+E V+ S D +   +TA DG++  V +PNDP LI ILA    DISV
Sbjct  36   WKYSRLIQEVQDGKIETVKLSADRTRALVTAQDGKQVLVNLPNDPQLISILAEKVDDISV  95



>ref|WP_010995433.1| cell division protein FtsH [Nostoc sp. PCC 7120]
 dbj|BAB73218.1| cell division protein [Nostoc sp. PCC 7120]
Length=613

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+KG+VERV  S D S   +T   D  +  V + NDP+LI+ L   GVDI+
Sbjct  36   WRYSQFIQEVEKGRVERVSLSADRSTALVTPKYDPSKKLVTLVNDPELINTLTARGVDIT  95

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  96   VLPQTDEG----FWFKALSSLFFP  115



>ref|WP_011317448.1| cell division protein FtsH [Anabaena variabilis]
 gb|ABA20199.1| membrane protease FtsH catalytic subunit [Anabaena variabilis 
ATCC 29413]
Length=613

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+KG+VERV  S D S   +T   D  +  V + NDP+LI+ L   GVDI+
Sbjct  36   WRYSQFIQEVEKGRVERVSLSADRSTALVTPKYDPSKKLVTLVNDPELINTLTARGVDIT  95

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  96   VLPQTDEG----FWFKALSSLFFP  115



>ref|WP_019506377.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=616

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = +1

Query  409  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  585
            P+  Q W YS+ ++ V+  K+E V+ S D +  Q+   +G    V +PNDP LIDIL+ N
Sbjct  34   PQARQTWAYSKLIDEVQSNKIETVKISADRTKAQVIDREGTPILVNLPNDPQLIDILSDN  93

Query  586  GVDISV--SEGEGGNGLFSFIGKSAFPFPC  669
            GVDI++     EG    F F   S+  FP 
Sbjct  94   GVDIAILPQNDEG----FWFRALSSLLFPI  119



>ref|WP_017291152.1| hypothetical protein [Leptolyngbya boryana]
Length=104

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W YS+F+  V+K  V +V  + D + +   + DG+R  V +P+DP+LI+ L  N VDIS+
Sbjct  36   WEYSQFIQEVEKDNVNKVSLTADRTRILAQSEDGKRFLVNLPDDPELINTLVRNQVDISI  95



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 45/83 (54%), Gaps = 6/83 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+ G+V++V  S D S   +T   G +  V + NDPDLI+ L   GVDI V
Sbjct  37   WRYSQFIQEVQNGRVDKVSISADRSTAIVTPTSGDKKLVTLVNDPDLINTLNAKGVDIIV  96

Query  604  --SEGEGGNGLFSFIGKSAFPFP  666
                 EG    F F   S+  FP
Sbjct  97   LPQTDEG----FWFKALSSLFFP  115



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+ G VE+V  S D S AL +T  D  +  V + NDPDLI+ L    VDI+
Sbjct  37   WRYSQFIQEVQNGNVEKVSLSADRSTALVMTKNDTNKKLVTLVNDPDLINTLTQYKVDIT  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W YSEF+  V+  ++ +V  + D S  Q    DG R  V +PNDP+L+DIL  N VDI+V
Sbjct  36   WPYSEFIQQVESKQITKVSITPDRSQAQAITQDGTRVLVNLPNDPELLDILTTNNVDIAV  95



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+KG+VE+V  S D S   +T   +  +  V + NDPDLI+ L  N VDI+
Sbjct  37   WRYSQFIQEVEKGRVEKVSLSSDRSTAIVTPKYEPNKKLVTLVNDPDLINTLTKNNVDIT  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_011243527.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 dbj|BAD79405.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56329.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD56622.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=613

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYSEF+  V+  +V +V  S D S+  + A DG +  V +PNDP L+ IL  N VDISV
Sbjct  37   WRYSEFVQRVENKQVAKVILSPDRSSALVQAEDGDKVQVNLPNDPQLLKILTDNNVDISV  96



>ref|WP_027841867.1| cell division protein FtsH [Mastigocoleus testarum]
Length=613

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAM  582
            P+G + WRYS+F+  V++GKVE+V  S D +   +T + D  +  V + NDP LI+ L+ 
Sbjct  30   PQGKETWRYSQFIQKVEEGKVEKVSISSDRTTAVVTPSDDTEKRIVNLVNDPQLINTLSA  89

Query  583  NGVDISV  603
             GVDISV
Sbjct  90   KGVDISV  96



>ref|WP_015114520.1| membrane protease FtsH catalytic subunit [Nostoc sp. PCC 7107]
 gb|AFY44316.1| membrane protease FtsH catalytic subunit [Nostoc sp. PCC 7107]
Length=612

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = +1

Query  409  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  585
            P+ +Q WRYS+F+  V  G V +VR S D S   + + DG +  V + NDPDLI+ L   
Sbjct  30   PQNTQTWRYSQFIQEVNNGGVAQVRLSADRSTALVKSKDGTQIKVTLVNDPDLINTLTSK  89

Query  586  GVDISV--SEGEGGNGLFSFIGKSAFPFP  666
             VD SV     EG    F F   S+  FP
Sbjct  90   NVDFSVLPQTDEG----FWFKALSSLFFP  114



>ref|WP_012411183.1| cell division protein FtsH [Nostoc punctiforme]
 gb|ACC83227.1| ATP-dependent metalloprotease FtsH [Nostoc punctiforme PCC 73102]
Length=613

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS F+  V++G+VE+V  S D S   +T   D  +  V + NDPDLI+ L   GVDIS
Sbjct  36   WRYSRFIQEVQQGRVEKVSLSADRSTALVTPKYDPAKRIVTLVNDPDLINTLTSKGVDIS  95

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  96   VLPQTDEG----FWFKALSSLFFP  115



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W YSEF+  V+  ++ +V  + D S  Q    DG R  V +PNDP+L+DIL  N VDI+V
Sbjct  36   WPYSEFIQQVESKQITKVSITPDRSQAQAITQDGTRVLVNLPNDPELLDILTSNNVDIAV  95



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAMN  585
            PE   WRYS+FL+AV+  ++ERV  S D +  + T  +G    ++ +PND +LI  L  N
Sbjct  31   PETQTWRYSQFLDAVQNNQIERVSISADRTRARFTDPEGNGQVIVNLPNDQELISTLETN  90

Query  586  GVDISV  603
             VDI V
Sbjct  91   NVDIVV  96



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  379  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  558
            KPQ+Q         +W YS+ ++ V+  KVE V+ S D +  ++T + G    V +PNDP
Sbjct  33   KPQSQ--------QRWAYSKLIDEVQNNKVEIVQISADRTKARVTDLMGNPILVNLPNDP  84

Query  559  DLIDILAMNGVDISV  603
            +LIDIL  N VDI+V
Sbjct  85   ELIDILMKNDVDIAV  99



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV-PNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+  KVE+V  S D +   + A DG +  V + PNDPDLI+IL  N V+I 
Sbjct  36   WRYSQFIQEVEGKKVEKVSISADRTRALVQASDGNKVMVNLPPNDPDLINILTENRVNIE  95

Query  601  V  603
            V
Sbjct  96   V  96



>ref|WP_015124055.1| membrane protease FtsH catalytic subunit [Synechococcus sp. PCC 
6312]
 gb|AFY60511.1| membrane protease FtsH catalytic subunit [Synechococcus sp. PCC 
6312]
Length=612

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYSE +  V+  +V ++  S D +  Q    DG R  V +P DP LIDIL  N VDISV
Sbjct  36   WRYSELIQEVENHQVAKLNISPDRTQAQAVTQDGTRVLVNLPPDPQLIDILTANNVDISV  95



>ref|WP_024546675.1| cell division protein FtsH [Synechococcus sp. NKBG15041c]
Length=620

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV-PNDPDLIDILAMNGVDIS  600
            WRYS+FL  V++G VE VR S D +   + A DG    V + P D +LIDIL+ N VDI+
Sbjct  39   WRYSQFLQEVQQGNVESVRISGDRTKAFVPAPDGTPILVNLPPGDTELIDILSENNVDIA  98

Query  601  VSEGEGGNGLFSFIGKSAFPF  663
            V      N +F  +    FP 
Sbjct  99   VLPQSDDNWIFRALSTLIFPI  119



>ref|WP_015133797.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
 gb|AFY38027.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
Length=620

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV-PNDPDLIDILAMNGVDIS  600
            WRYSEFL  V+ G +E V+ S D S   + A DG    V + P D +LIDIL+ N VDI+
Sbjct  39   WRYSEFLEQVQSGNIESVKISSDRSQAFVPAQDGTPILVNLPPGDTELIDILSNNSVDIA  98

Query  601  VSEGEGGNGLFSFIGKSAFPF  663
            V      N +F  +    FP 
Sbjct  99   VLPQSDDNWVFRALSTLIFPI  119



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +1

Query  409  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAMN  585
            PE   WRYS+FL+AV+  ++ERV  S D +  + T  +G    ++ +PND +LI  L  N
Sbjct  31   PETKTWRYSQFLDAVQNNQIERVSISADRTRARFTDPEGNGQVIVNLPNDQELISTLEDN  90

Query  586  GVDISV  603
             VDI V
Sbjct  91   NVDIVV  96



>ref|WP_029633975.1| cell division protein FtsH [[Scytonema hofmanni] UTEX B 1581]
Length=612

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 45/83 (54%), Gaps = 6/83 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+K  V +V  S D S   + +  G +  V + NDPDLI+ L+  GVDISV
Sbjct  36   WRYSQFIQEVEKNNVAKVSLSADRSTALVKSNQGTQFIVTLVNDPDLINTLSAKGVDISV  95

Query  604  --SEGEGGNGLFSFIGKSAFPFP  666
                 EG    F F   S+  FP
Sbjct  96   LPQTDEG----FWFKALSSLFFP  114



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG--RRATVIVPNDPDLIDILAMN  585
            E   WRYS F+N V+ G +E+V  S D +  +     G  RR  V +P+DP L+DIL  N
Sbjct  32   ETDAWRYSRFINQVESGAIEKVYISADRTQARFPDPTGEERRIVVNLPSDPGLVDILTEN  91

Query  586  GVDISVSEGEGGNGLFSFI  642
             VDI V      N L   +
Sbjct  92   SVDIEVQRQAEENRLLQVL  110



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR-RATVIVPNDPDLIDILAMNG  588
            E    RYS+F+N V++G+VE V  + D S  +  + DG  R  V +P DP L+D+L  N 
Sbjct  32   ETQSQRYSQFINDVQQGRVESVSITSDKSQARFASPDGTGRVVVNLPQDPGLVDLLTENN  91

Query  589  VDISV  603
            VDI+V
Sbjct  92   VDITV  96



>ref|WP_017315070.1| cell division protein FtsH [Mastigocladopsis repens]
Length=614

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+   VE+V  S D S AL +   D  +  V + NDPDLI+ L  +GVDIS
Sbjct  37   WRYSQFIREVQSDNVEKVSLSADRSTALVMPKNDPNKKLVTLVNDPDLINTLTQHGVDIS  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV-PNDPDLIDILAMNGVDIS  600
            WRYS+FL  V++G +E V+ S D +   + A DG    V + P D +LIDIL+ N VDI+
Sbjct  39   WRYSQFLQEVQQGNIESVKISGDRTKAFVPAQDGTPILVNLPPGDTELIDILSENNVDIA  98

Query  601  VSEGEGGNGLFSFIGKSAFPF  663
            V      N +F  +    FP 
Sbjct  99   VLPQSDDNWIFRALSTLIFPI  119



>gb|EJK55379.1| hypothetical protein THAOC_24887 [Thalassiosira oceanica]
Length=672

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISV  603
            RYS+FL  V   K+E+V FS DG+ L     DG R  +  +PNDPDL+  L  + VD++V
Sbjct  64   RYSDFLKLVNGDKIEKVTFSADGTQLLGVDTDGTRIKLEALPNDPDLLTQLTTHKVDVTV  123

Query  604  ---SEGEGGNG  627
               +E  GG G
Sbjct  124  LPSNEAAGGLG  134



>ref|WP_036486108.1| cell division protein FtsH [Myxosarcina sp. GI1]
Length=616

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 6/84 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            W YS+ +N V+ G+VE V+ + D +  Q+   +G    V +P D + IDIL+ NGVDI+V
Sbjct  40   WAYSKLINEVENGRVETVKITADRTKAQVIDSEGTPILVNLPQDREFIDILSENGVDIAV  99

Query  604  --SEGEGGNGLFSFIGKSAFPFPC  669
                 EG    F F   S+  FP 
Sbjct  100  LPQNDEG----FWFRALSSLFFPI  119



>ref|WP_032525350.1| hypothetical protein, partial [Prochlorococcus sp. scB241_526K3]
Length=89

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVS  606
            RYS+F+ AV+  ++ RV  S D +  Q+   DG R+ V +  D DL+ IL  N VDI+V+
Sbjct  22   RYSDFIEAVQDKEISRVLISPDNATAQVVENDGSRSEVNLAPDKDLLKILTENNVDIAVT  81



>ref|XP_002287516.1| metalloprotease [Thalassiosira pseudonana CCMP1335]
 gb|EED94959.1| metalloprotease, partial [Thalassiosira pseudonana CCMP1335]
Length=581

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISV  603
            RYS+FL  V   K+E+V FS DG+ L     DG R  +  +PNDPDL+  L  + VD++V
Sbjct  1    RYSDFLKLVNGDKIEKVTFSADGTQLLGVDTDGTRIKLEALPNDPDLLTQLTSHKVDVTV  60

Query  604  ---SEGEGGNG  627
               +E  GG G
Sbjct  61   LPSNEAAGGLG  71



>ref|WP_025913223.1| hypothetical protein [Prochlorococcus sp. scB245a_520D2]
Length=149

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 47/92 (51%), Gaps = 7/92 (8%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVS  606
            RYS+F+ AV+  ++ RV  S D +  Q+   DG R+ V +  D DL+ IL  N VDI+V+
Sbjct  39   RYSDFIEAVQDKEISRVLISPDNATAQVVENDGSRSEVNLAPDKDLLKILTENNVDIAVT  98

Query  607  EGEGGNGLFSFIGKSAFP-------FPCFRRA  681
              +  N     +    FP       F  FRR+
Sbjct  99   PTKLANPWQQAVSSLIFPVLLIGGLFFLFRRS  130



>ref|WP_017743955.1| cell division protein FtsH [Scytonema hofmanni]
Length=614

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+ G VE+V  S D S AL +   D  +  V + NDPDLI+ L    VDI+
Sbjct  37   WRYSQFIQEVQNGNVEKVSLSADRSTALVMPKNDTNKKLVTLVNDPDLINTLTQYQVDIT  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_036972775.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=240

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + VDI+V
Sbjct  38   RYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNVDIAV  96



>ref|WP_035262561.1| cell division protein FtsH [Actibacterium mucosum]
 gb|KAJ54100.1| cell division protein FtsH [Actibacterium mucosum KCTC 23349]
Length=639

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            + YS+FL+ V+ GKV  V    DG    +T  DGR++T IVP+  DL D L    V+++ 
Sbjct  36   YSYSDFLDDVEAGKVSAVTI--DGEKAVITGTDGRQSTTIVPDGVDLTDRLVEADVEVTA  93

Query  604  SEGEGGNGLFSFIGKSAFPF  663
               E  NGL ++IG +  PF
Sbjct  94   RAQE-RNGLLAYIG-TLLPF  111



>ref|WP_013506914.1| ATP-dependent metalloprotease [Desulfurispirillum indicum]
 gb|ADU67040.1| ATP-dependent metalloprotease FtsH [Desulfurispirillum indicum 
S5]
Length=651

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query  430  YSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSE  609
            YSEF++ V +G + +V+    G  +  + +DGRR   I P+DPDLI  L   G+ I V E
Sbjct  38   YSEFISMVDRGTISQVQIQ--GKKVTASGMDGRRIETIAPDDPDLIPTLKARGLRIEVKE  95

Query  610  GEGGNGLFSFIGKSAFPFPCFRRAFLSF  693
             EG   L   +  S FP       ++ F
Sbjct  96   PEGTPWLLQIL-ISWFPMLLLIGVWIFF  122



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG--RRATVIVPNDPDLIDILAMN  585
            E   WRYS F+N V+   +E+V  S D +  +     G  RR  V +P+DP L+DIL  N
Sbjct  32   ETETWRYSRFINQVESRAIEKVYISADRTQARFPDPSGEERRVVVNLPSDPGLVDILTEN  91

Query  586  GVDISVSEGEGGNGLFSFI  642
             VDI V      N L   +
Sbjct  92   SVDIEVQRQAEENRLLQVL  110



>ref|WP_035155002.1| cell division protein FtsH [Calothrix sp. 336/3]
 gb|KFB84628.1| cell division protein FtsH [Calothrix sp. 336/3]
Length=613

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+  +VE+V  S D +   +T   G +  V + +DPDLI+ L  + VDI V
Sbjct  37   WRYSQFIQEVENDRVEKVSLSSDRTTALVTPTSGEKKLVTLVSDPDLINTLTKHNVDIIV  96

Query  604  --SEGEGGNGLFSFIGKSAFPFP  666
                 EG    F F   S+  FP
Sbjct  97   LPQTDEG----FWFKALSSLFFP  115



>ref|WP_011363329.1| cell division protein FtsH [Synechococcus sp. CC9605]
 gb|ABB34077.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. CC9605]
Length=616

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +1

Query  358  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRAT  537
            ++V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA 
Sbjct  17   SIVVIAPAFFGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQ  76

Query  538  VIVPNDPDLIDILAMNGVDISV  603
            V +  D +L+ +L  + VDI+V
Sbjct  77   VNLAPDRELLGLLTEHSVDIAV  98



>gb|AHF62715.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. WH 8109]
Length=616

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +1

Query  361  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV  540
            +V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA V
Sbjct  18   IVVIAPAFFGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQV  77

Query  541  IVPNDPDLIDILAMNGVDISV  603
             +  D +L+ +L  + VDI+V
Sbjct  78   NLAPDRELLGLLTEHSVDIAV  98



>emb|CCQ73321.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Magnetospira sp. QH-2]
Length=643

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 47/91 (52%), Gaps = 3/91 (3%)
 Frame = +1

Query  391  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLID  570
            Q AS  P  +   YSEFL AV+ G+V  V     G  +Q +  DGR  T   P+DP LID
Sbjct  25   QSASQQPTHTSQSYSEFLGAVETGEVTNVTIQ--GRNIQGSYRDGRPFTTYAPDDPKLID  82

Query  571  ILAMNGVDISVSEGEGGNGLFSFIGKSAFPF  663
             L   GV ++    E G+ L S +  S FPF
Sbjct  83   RLTEKGVAVTAKPVEEGSLLVSIL-VSWFPF  112



>ref|WP_029981286.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=182

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 47/92 (51%), Gaps = 7/92 (8%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVS  606
            RYS+F+ AV+  ++ RV  S D +  Q+   DG R+ V +  D DL+ IL  N VDI+V+
Sbjct  39   RYSDFIEAVQDKEISRVLISPDNATAQVVENDGSRSEVNLAPDKDLLKILTENNVDIAVT  98

Query  607  EGEGGNGLFSFIGKSAFP-------FPCFRRA  681
              +  N     +    FP       F  FRR+
Sbjct  99   PTKLANPWQQAVSSLIFPVLLIGGLFFLFRRS  130



>ref|WP_019494535.1| cell division protein FtsH [Calothrix sp. PCC 7103]
Length=620

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+F+  V+KG V +VR S D +   + +  G +  V + +DP LI+ L    VDISV
Sbjct  44   WRYSQFIQEVEKGNVAQVRLSADRTQAIVKSQSGNQVLVTLVDDPQLINTLTEKNVDISV  103

Query  604  --SEGEGGNGLFSFIGKSAFPFP  666
                 EG    F F   S+  FP
Sbjct  104  LPQTDEG----FWFKALSSLFFP  122



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGV  591
            E    RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + V
Sbjct  33   ERETLRYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNV  92

Query  592  DISV  603
            DI+V
Sbjct  93   DIAV  96



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGV  591
            E    RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + V
Sbjct  33   ERETLRYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNV  92

Query  592  DISV  603
            DI+V
Sbjct  93   DIAV  96



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +1

Query  412  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGV  591
            E    RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + V
Sbjct  33   ERETLRYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNV  92

Query  592  DISV  603
            DI+V
Sbjct  93   DIAV  96



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAVVTPKFDSKKKLVTLVNDPNLINELNEQNVDII  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+  KVE+V  S D S   +T   D ++  V + NDP+LI+ L   GVDI 
Sbjct  37   WRYSQFIQEVRNNKVEKVSISADRSTAIVTPKFDSKKKLVTLVNDPNLINELNEKGVDII  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAVVTPKFDSKKKLVTLVNDPNLINELNEQNVDII  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|XP_005538209.1| cell division protein FtsH [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82173.1| cell division protein FtsH [Cyanidioschyzon merolae strain 10D]
Length=776

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 43/85 (51%), Gaps = 1/85 (1%)
 Frame = +1

Query  421  QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDI  597
              RYSEF + +   ++E+V FS D     +   DG R  +  +PNDPDL+  L  + VDI
Sbjct  191  HVRYSEFWDMIVHDRIEKVTFSPDMQRALVIDTDGNRFRMDALPNDPDLLPTLTKHKVDI  250

Query  598  SVSEGEGGNGLFSFIGKSAFPFPCF  672
             V   +  NG+  F+    FP   F
Sbjct  251  IVLPAQQDNGIGDFLRSLIFPALLF  275



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAIVTPKFDSKKKLVTLVNDPNLINELNEQSVDII  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  600
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAIVTPKFDSKKKLVTLVNDPNLINELNEQSVDII  96

Query  601  V--SEGEGGNGLFSFIGKSAFPFP  666
            V     EG    F F   S+  FP
Sbjct  97   VLPQTDEG----FWFKALSSLFFP  116



>ref|WP_025970577.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_521M10]
Length=227

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 47/92 (51%), Gaps = 7/92 (8%)
 Frame = +1

Query  427  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVS  606
            RYS+F+ AV+  ++ RV  S D +  Q+   DG R+ V +  D DL+ IL  N VDI+V+
Sbjct  39   RYSDFIEAVQDKEISRVLISPDNATAQVVENDGSRSEVNLAPDKDLLKILTENNVDIAVT  98

Query  607  EGEGGNGLFSFIGKSAFP-------FPCFRRA  681
              +  N     +    FP       F  FRR+
Sbjct  99   PTKLANPWQQAVSSLIFPVLLIGGLFFLFRRS  130



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  430  YSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAMNGVDISV  603
            YSEF+  V+  KV+RV  S D +  ++   +G    ++ +PNDPDLI+IL+ NGVDI+V
Sbjct  42   YSEFIERVESNKVDRVTLSSDRTQAKVPNPEGGAPLLVNLPNDPDLINILSQNGVDIAV  100



>gb|ADD94882.1| FtsH peptidase [uncultured marine bacterium MedDCM-OCT-S09-C166]
Length=616

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +1

Query  361  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV  540
            +V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA V
Sbjct  18   IVVIAPAFIGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQV  77

Query  541  IVPNDPDLIDILAMNGVDISV  603
             +  D +L+ +L  + VDI+V
Sbjct  78   NLAPDRELLGLLTEHSVDIAV  98



>ref|WP_010468934.1| cell division protein FtsH [Acaryochloris sp. CCMEE 5410]
Length=608

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  603
            WRYS+ +  V+   VE++R S D +  ++ + +G   TV +P DPD IDIL    VDI+V
Sbjct  36   WRYSKLIEEVENNNVEKIRISADRTMAEVKSGEG-TITVNLPPDPDFIDILTKQDVDIAV  94



>ref|WP_015173052.1| FtsH peptidase [Geitlerinema sp. PCC 7407]
 gb|AFY67488.1| FtsH peptidase [Geitlerinema sp. PCC 7407]
Length=133

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  424  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV-PNDPDLIDILAMNGVDIS  600
            W YS+F+ +V+   V +V  S D S   +T+ DG +  V + PNDP+LI+ L  N VDI+
Sbjct  36   WDYSQFIQSVEDKTVVKVSISDDRSRALVTSSDGSQVWVDIPPNDPNLINTLVDNNVDIA  95

Query  601  V  603
            V
Sbjct  96   V  96



>ref|WP_036922150.1| cell division protein FtsH [Prochlorococcus marinus]
Length=618

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 5/75 (7%)
 Frame = +1

Query  379  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  558
            KP A+ A+        RYS+F+ AV++ +V RV  S D    Q+   DG R+ V +  D 
Sbjct  28   KPNAENAT-----KTLRYSDFIEAVQEKEVSRVLISPDNGTAQVVENDGSRSEVNLAPDK  82

Query  559  DLIDILAMNGVDISV  603
            DL+ IL  N VDI+V
Sbjct  83   DLLKILTENDVDIAV  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320