BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049I12

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36051.1|  hypothetical protein MIMGU_mgv1a003633mg                214   3e-62   Erythranthe guttata [common monkey flower]
ref|XP_009595187.1|  PREDICTED: nicalin-1                               213   1e-61   Nicotiana tomentosiformis
ref|XP_011090327.1|  PREDICTED: nicalin-1 isoform X1                    208   6e-60   Sesamum indicum [beniseed]
ref|XP_004251075.1|  PREDICTED: nicalin-1-like                          206   4e-59   Solanum lycopersicum
ref|XP_006362903.1|  PREDICTED: nicalin-1-like                          206   7e-59   Solanum tuberosum [potatoes]
ref|XP_006592340.1|  PREDICTED: nicalin-1-like isoform X2               196   3e-57   
ref|XP_006592339.1|  PREDICTED: nicalin-1-like isoform X1               197   4e-57   
gb|EYU20529.1|  hypothetical protein MIMGU_mgv1a005130mg                198   8e-57   Erythranthe guttata [common monkey flower]
ref|XP_009793458.1|  PREDICTED: nicalin-1-like isoform X1               199   1e-56   Nicotiana sylvestris
ref|XP_009758150.1|  PREDICTED: nicalin-1-like                          199   2e-56   Nicotiana sylvestris
ref|XP_010912330.1|  PREDICTED: nicalin-1-like isoform X3               194   3e-55   
ref|XP_010912329.1|  PREDICTED: nicalin-1-like isoform X2               194   4e-55   
gb|KHN38614.1|  Nicalin-1                                               195   4e-55   Glycine soja [wild soybean]
ref|XP_010912328.1|  PREDICTED: nicalin-like isoform X1                 195   6e-55   Elaeis guineensis
gb|KHN21166.1|  Nicalin                                                 195   6e-55   Glycine soja [wild soybean]
ref|XP_011088931.1|  PREDICTED: nicalin-1-like                          194   1e-54   Sesamum indicum [beniseed]
ref|XP_003538104.1|  PREDICTED: nicalin-1-like                          194   2e-54   Glycine max [soybeans]
ref|XP_011043354.1|  PREDICTED: nicalin-1-like                          193   3e-54   Populus euphratica
ref|XP_007015761.1|  Endoplasmic reticulum, plasma membrane, vacu...    191   5e-54   
emb|CDP06883.1|  unnamed protein product                                192   5e-54   Coffea canephora [robusta coffee]
ref|XP_006362633.1|  PREDICTED: nicalin-1-like isoform X1               192   9e-54   Solanum tuberosum [potatoes]
ref|XP_006362634.1|  PREDICTED: nicalin-1-like isoform X2               192   9e-54   Solanum tuberosum [potatoes]
ref|XP_007015760.1|  Endoplasmic reticulum, plasma membrane, vacu...    190   3e-53   
ref|XP_004506200.1|  PREDICTED: nicalin-1-like                          189   5e-53   Cicer arietinum [garbanzo]
ref|XP_010931104.1|  PREDICTED: nicalin-like isoform X2                 188   1e-52   
ref|XP_010931103.1|  PREDICTED: nicalin-like isoform X1                 188   1e-52   Elaeis guineensis
ref|XP_007132463.1|  hypothetical protein PHAVU_011G096100g             188   2e-52   Phaseolus vulgaris [French bean]
ref|XP_008229012.1|  PREDICTED: nicalin-1                               188   2e-52   Prunus mume [ume]
ref|XP_008799667.1|  PREDICTED: nicalin-like isoform X2                 187   3e-52   
ref|XP_004228460.1|  PREDICTED: nicalin-1-like                          187   3e-52   
ref|XP_002312837.2|  hypothetical protein POPTR_0009s16200g             187   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_008799665.1|  PREDICTED: nicalin-like isoform X1                 187   5e-52   Phoenix dactylifera
ref|XP_002273260.1|  PREDICTED: nicalin-1                               186   7e-52   Vitis vinifera
gb|KEH29829.1|  M28 Zn-peptidase nicastrin                              187   8e-52   Medicago truncatula
gb|KEH29830.1|  M28 Zn-peptidase nicastrin                              186   9e-52   Medicago truncatula
gb|AAO00855.1|  putative protein                                        179   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007205001.1|  hypothetical protein PRUPE_ppa003566mg             185   3e-51   Prunus persica
gb|KJB35406.1|  hypothetical protein B456_006G113500                    180   3e-51   Gossypium raimondii
ref|XP_010245975.1|  PREDICTED: nicalin-1 isoform X2                    184   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010245968.1|  PREDICTED: nicalin-1 isoform X1                    184   4e-51   Nelumbo nucifera [Indian lotus]
gb|KJB55582.1|  hypothetical protein B456_009G084100                    184   5e-51   Gossypium raimondii
gb|KJB55581.1|  hypothetical protein B456_009G084100                    184   5e-51   Gossypium raimondii
ref|XP_008372817.1|  PREDICTED: nicalin-1-like                          175   7e-51   
gb|KJB35405.1|  hypothetical protein B456_006G113500                    181   9e-51   Gossypium raimondii
ref|XP_011006549.1|  PREDICTED: nicalin-1-like isoform X2               179   1e-50   Populus euphratica
gb|KDP24745.1|  hypothetical protein JCGZ_25494                         182   2e-50   Jatropha curcas
dbj|BAG15862.1|  hypothetical protein                                   182   2e-50   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009416037.1|  PREDICTED: nicalin                                 181   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010102017.1|  hypothetical protein L484_016307                   183   6e-50   
ref|XP_004291695.1|  PREDICTED: nicalin-1                               181   8e-50   Fragaria vesca subsp. vesca
ref|XP_002523845.1|  Nicalin precursor, putative                        180   1e-49   Ricinus communis
gb|KJB35404.1|  hypothetical protein B456_006G113500                    180   1e-49   Gossypium raimondii
ref|XP_006836081.1|  hypothetical protein AMTR_s00114p00123360          180   2e-49   Amborella trichopoda
ref|XP_006292677.1|  hypothetical protein CARUB_v10018921mg             180   2e-49   Capsella rubella
ref|XP_011006540.1|  PREDICTED: nicalin-1-like isoform X1               179   3e-49   Populus euphratica
gb|KCW50875.1|  hypothetical protein EUGRSUZ_J00522                     179   5e-49   Eucalyptus grandis [rose gum]
ref|NP_190019.1|  uncharacterized protein                               179   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010031534.1|  PREDICTED: nicalin-1                               179   6e-49   Eucalyptus grandis [rose gum]
ref|XP_010503086.1|  PREDICTED: nicalin-1-like                          179   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002875659.1|  hypothetical protein ARALYDRAFT_905545             178   7e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010514774.1|  PREDICTED: nicalin-1-like                          178   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009377813.1|  PREDICTED: nicalin-1-like                          177   2e-48   Pyrus x bretschneideri [bai li]
gb|EPS62126.1|  hypothetical protein M569_12666                         176   2e-48   Genlisea aurea
ref|XP_008784054.1|  PREDICTED: nicalin-like                            176   5e-48   Phoenix dactylifera
ref|XP_008355243.1|  PREDICTED: nicalin-1-like                          174   2e-47   
gb|KFK33877.1|  hypothetical protein AALP_AA5G071800                    174   4e-47   Arabis alpina [alpine rockcress]
ref|XP_010685410.1|  PREDICTED: nicalin-1                               173   5e-47   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY21224.1|  BnaC03g54000D                                          173   6e-47   Brassica napus [oilseed rape]
ref|XP_006404470.1|  hypothetical protein EUTSA_v10010249mg             173   6e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010425851.1|  PREDICTED: nicalin-1-like                          172   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009374972.1|  PREDICTED: nicalin-1-like                          172   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_006384766.1|  hypothetical protein POPTR_0004s20910g             170   8e-46   
gb|KDO58311.1|  hypothetical protein CISIN_1g0085682mg                  166   1e-45   Citrus sinensis [apfelsine]
ref|XP_006424178.1|  hypothetical protein CICLE_v10028115mg             167   2e-45   
ref|XP_006424179.1|  hypothetical protein CICLE_v10028115mg             167   1e-44   Citrus clementina [clementine]
ref|XP_006481501.1|  PREDICTED: nicalin-1-like                          167   1e-44   Citrus sinensis [apfelsine]
ref|XP_009150276.1|  PREDICTED: nicalin-1-like                          166   2e-44   Brassica rapa
emb|CDY30940.1|  BnaA06g19730D                                          164   1e-43   Brassica napus [oilseed rape]
ref|XP_008463652.1|  PREDICTED: nicalin-1                               155   1e-40   Cucumis melo [Oriental melon]
ref|XP_008344934.1|  PREDICTED: nicalin-1-like                          155   2e-40   
ref|XP_004139498.1|  PREDICTED: nicalin-like                            154   7e-40   Cucumis sativus [cucumbers]
gb|KGN64956.1|  hypothetical protein Csa_1G167840                       154   9e-40   Cucumis sativus [cucumbers]
ref|XP_009123309.1|  PREDICTED: nicalin-1-like                          153   1e-39   Brassica rapa
emb|CDY62392.1|  BnaC03g74930D                                          153   1e-39   Brassica napus [oilseed rape]
ref|XP_010541265.1|  PREDICTED: nicalin-1                               152   2e-39   Tarenaya hassleriana [spider flower]
emb|CDY47303.1|  BnaA06g38990D                                          150   1e-38   Brassica napus [oilseed rape]
gb|AFW65052.1|  hypothetical protein ZEAMMB73_261569                    143   3e-36   
gb|AFW65051.1|  hypothetical protein ZEAMMB73_261569                    143   3e-36   
ref|NP_001147070.1|  Nicalin precursor                                  143   3e-36   Zea mays [maize]
gb|ACL54544.1|  unknown                                                 143   4e-36   Zea mays [maize]
ref|XP_010234235.1|  PREDICTED: nicalin                                 142   6e-36   Brachypodium distachyon [annual false brome]
ref|XP_004972399.1|  PREDICTED: nicalin-like isoform X1                 135   1e-33   Setaria italica
ref|XP_002444854.1|  hypothetical protein SORBIDRAFT_07g000320          134   5e-33   Sorghum bicolor [broomcorn]
gb|AFW74195.1|  hypothetical protein ZEAMMB73_534170                    127   5e-32   
ref|XP_002975196.1|  hypothetical protein SELMODRAFT_102752             131   6e-32   
ref|XP_002977600.1|  hypothetical protein SELMODRAFT_106865             130   7e-32   
dbj|BAJ94473.1|  predicted protein                                      130   1e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN25311.1|  unknown                                                 126   4e-30   Zea mays [maize]
ref|NP_001060766.1|  Os08g0102100                                       123   3e-29   
ref|NP_001150971.1|  LOC100284604 precursor                             121   2e-28   
ref|XP_001784134.1|  predicted protein                                  120   3e-28   
ref|XP_006659731.1|  PREDICTED: nicalin-like                            119   1e-27   Oryza brachyantha
ref|XP_009589240.1|  PREDICTED: nicalin-1-like                          108   4e-24   
ref|XP_010912332.1|  PREDICTED: nicalin-like isoform X4               96.7    9e-20   Elaeis guineensis
emb|CAN69050.1|  hypothetical protein VITISV_001511                   85.9    1e-17   Vitis vinifera
gb|EEC82760.1|  hypothetical protein OsI_27484                        77.0    6e-13   Oryza sativa Indica Group [Indian rice]
gb|EMS68245.1|  Nicalin-1                                             77.0    8e-13   Triticum urartu
ref|XP_009793459.1|  PREDICTED: nicalin-1-like isoform X2             74.7    3e-12   Nicotiana sylvestris
gb|EMT04918.1|  hypothetical protein F775_32982                       69.7    1e-10   
ref|XP_007896945.1|  PREDICTED: nicalin                               55.8    7e-06   Callorhinchus milii [Australian ghost shark]
gb|ETE60869.1|  Nicalin                                               54.7    8e-06   Ophiophagus hannah
gb|KFM78747.1|  Nicalin-1                                             55.1    1e-05   Stegodyphus mimosarum
ref|XP_002606253.1|  hypothetical protein BRAFLDRAFT_84005            54.7    2e-05   Branchiostoma floridae
ref|XP_008343403.1|  PREDICTED: uncharacterized protein LOC103406172  54.3    2e-05   
ref|XP_009010054.1|  hypothetical protein HELRODRAFT_71336            53.9    3e-05   Helobdella robusta
ref|XP_002159640.2|  PREDICTED: nicalin-1-like                        52.0    1e-04   
ref|XP_006008163.1|  PREDICTED: nicalin-like isoform X2               51.6    2e-04   
ref|XP_008289125.1|  PREDICTED: nicalin isoform X4                    51.6    2e-04   Stegastes partitus
ref|XP_006008162.1|  PREDICTED: nicalin-like isoform X1               51.6    2e-04   
ref|XP_008289122.1|  PREDICTED: nicalin isoform X2                    51.6    2e-04   Stegastes partitus
ref|XP_008289126.1|  PREDICTED: nicalin isoform X5                    51.6    2e-04   Stegastes partitus
ref|XP_008289121.1|  PREDICTED: nicalin isoform X1                    51.6    2e-04   Stegastes partitus
ref|XP_008289127.1|  PREDICTED: nicalin isoform X6                    51.6    2e-04   Stegastes partitus
ref|XP_008289128.1|  PREDICTED: nicalin isoform X7                    51.2    2e-04   Stegastes partitus
ref|XP_008289123.1|  PREDICTED: nicalin isoform X3                    50.1    6e-04   Stegastes partitus



>gb|EYU36051.1| hypothetical protein MIMGU_mgv1a003633mg [Erythranthe guttata]
Length=572

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDAV  VDVYRLVQYDL GVP GSR+A+LNHHAGSSL S   G  ADLSR+V++LP
Sbjct  32   CVELGDAVTVVDVYRLVQYDLGGVPLGSRLAALNHHAGSSLFSSSAGVVADLSRTVLILP  91

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLT I+EYIGQ+K LGGLLLLLPP FSP++ D+ GG D +S   L + +L E+E+L
Sbjct  92   VRELNLTFIREYIGQSKPLGGLLLLLPPIFSPEHTDSGGGVDDDSAKVLLKEVLVEVERL  151

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH NIPYPVYF FED++IN++LADIK+ +DA GQPATATTGG+K VV+A
Sbjct  152  LIHANIPYPVYFGFEDEHINAMLADIKK-NDASGQPATATTGGYKLVVAA  200



>ref|XP_009595187.1| PREDICTED: nicalin-1 [Nicotiana tomentosiformis]
Length=563

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +1

Query  142  DAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELN  321
            DA+  VDVYRLVQYDLSGVP+GSR+A+LNHHAGSSL +      ADLSR+V+MLP+RELN
Sbjct  34   DAITVVDVYRLVQYDLSGVPFGSRLATLNHHAGSSLFAS-----ADLSRTVLMLPVRELN  88

Query  322  LTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVN  501
            L LIKEYIGQ  LLGGLLLLLPPKFSP+ +D A G D   + DL RN ++ELE+LLIH N
Sbjct  89   LDLIKEYIGQGNLLGGLLLLLPPKFSPEKVDAAVGDD--GDFDLLRNKVSELERLLIHAN  146

Query  502  IPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            IPYPVYFAFEDDNI++VLA++KR +DA GQPATATTGG+K VV A
Sbjct  147  IPYPVYFAFEDDNISAVLAEVKR-NDASGQPATATTGGYKLVVVA  190



>ref|XP_011090327.1| PREDICTED: nicalin-1 isoform X1 [Sesamum indicum]
Length=569

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DAV  VDVYRLVQYDL GVP+GSR A+LNHHAGSSL S   G+ ADLSR+V++LP
Sbjct  30   CVELCDAVTVVDVYRLVQYDLGGVPFGSRFAALNHHAGSSLFS-SSGAAADLSRTVLILP  88

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELN+T I+EYIGQ K LGGLLLLLPP  SP + D  GGAD +S  +L + +L E+E+L
Sbjct  89   VRELNITFIREYIGQRKPLGGLLLLLPPVSSPQHTDIGGGADHDSAKELVKEVLIEVERL  148

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH NIPYPVYF FED+++N++LADIK+ +DA GQPATATTGG+K VV+A
Sbjct  149  LIHTNIPYPVYFGFEDEHVNAMLADIKK-NDATGQPATATTGGYKLVVAA  197



>ref|XP_004251075.1| PREDICTED: nicalin-1-like [Solanum lycopersicum]
Length=564

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+  DAV  VDVYRLVQYDLSGVP+GSR+A+LNHHAGSS  +    S  DLSR+V+MLP
Sbjct  28   CVDFCDAVTVVDVYRLVQYDLSGVPFGSRLATLNHHAGSSFFA--SSSTVDLSRTVLMLP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +REL+L LIKEYIGQ KLLGGLLLLLPP+FSP+ ++TA G D N   DL RN ++ELE+L
Sbjct  86   VRELDLDLIKEYIGQGKLLGGLLLLLPPQFSPEKVETAVGRDEN--FDLLRNKVSELERL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH NIPYPVYFAFEDDNIN+VLA++KR +DA GQPATATTGG+K VV+A
Sbjct  144  LIHANIPYPVYFAFEDDNINAVLAEVKR-NDASGQPATATTGGYKLVVAA  192



>ref|XP_006362903.1| PREDICTED: nicalin-1-like [Solanum tuberosum]
Length=578

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+  DAV  VDVYRLVQYDLSGVP+GSR+A+LNHHAGSS  +    S  DLSR+V+MLP
Sbjct  42   CVDFCDAVTVVDVYRLVQYDLSGVPFGSRLATLNHHAGSSFFA--SSSTVDLSRTVLMLP  99

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +REL+L LIKEYIGQ KLLGGLLLLLPP+FSP+ ++TA G D   + DL RN ++ELE+L
Sbjct  100  VRELDLDLIKEYIGQGKLLGGLLLLLPPQFSPEKVETAVGGD--EDFDLLRNKVSELERL  157

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH NIPYPVYFAFEDDNIN+VLA++KR +DA GQPATATTGG+K VV+A
Sbjct  158  LIHANIPYPVYFAFEDDNINAVLAEVKR-NDASGQPATATTGGYKLVVAA  206



>ref|XP_006592340.1| PREDICTED: nicalin-1-like isoform X2 [Glycine max]
Length=374

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+ASLNHHA S   SP     ADLSR+V+++P
Sbjct  26   CVDLCDGATVVDVYRLIQYDMSGVPFGSRLASLNHHAASLHFSP----HADLSRTVLLIP  81

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ +KEYI ++K LGGL+ LLP  FS +N D  G    +   +L +N L+ELEQ+
Sbjct  82   LRELNMSFVKEYIAESKPLGGLIFLLPRMFSFENKDGMGSNHQDESKELLKNALDELEQI  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH N+PYPVYFAFEDDNI++VL DIK+ +D  GQPATATTGG+KFVVSA
Sbjct  142  LIHANVPYPVYFAFEDDNIDAVLTDIKK-NDVTGQPATATTGGYKFVVSA  190



>ref|XP_006592339.1| PREDICTED: nicalin-1-like isoform X1 [Glycine max]
Length=389

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+ASLNHHA S   SP     ADLSR+V+++P
Sbjct  26   CVDLCDGATVVDVYRLIQYDMSGVPFGSRLASLNHHAASLHFSP----HADLSRTVLLIP  81

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ +KEYI ++K LGGL+ LLP  FS +N D  G    +   +L +N L+ELEQ+
Sbjct  82   LRELNMSFVKEYIAESKPLGGLIFLLPRMFSFENKDGMGSNHQDESKELLKNALDELEQI  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH N+PYPVYFAFEDDNI++VL DIK+ +D  GQPATATTGG+KFVVSA
Sbjct  142  LIHANVPYPVYFAFEDDNIDAVLTDIKK-NDVTGQPATATTGGYKFVVSA  190



>gb|EYU20529.1| hypothetical protein MIMGU_mgv1a005130mg [Erythranthe guttata]
Length=496

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 139/173 (80%), Gaps = 5/173 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLL--SPGDGSFADLSRSVIM  300
             VEL DAV  VDVYRLVQYDL+GVP+GSR+A+LNHHAGSSL   S   G+ ADLSR+V++
Sbjct  26   CVELCDAVTVVDVYRLVQYDLAGVPFGSRLAALNHHAGSSLFSASATAGAAADLSRTVLI  85

Query  301  LPLRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELE  480
            LP+RELNLT IKEYIGQ K LGGLLLLLPP F+P N D+ G  +  S  D  + +L EL+
Sbjct  86   LPVRELNLTFIKEYIGQTKPLGGLLLLLPPIFNPLNTDSRG--ESYSAKDNIKEVLTELD  143

Query  481  QLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSAR  639
            QLLIH NIPYPVYF FEDD++N+VLAD+K+ +DA GQPATATTGG+K VV AR
Sbjct  144  QLLIHANIPYPVYFGFEDDHVNTVLADVKK-NDAAGQPATATTGGYKLVVVAR  195



>ref|XP_009793458.1| PREDICTED: nicalin-1-like isoform X1 [Nicotiana sylvestris]
Length=565

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 141/170 (83%), Gaps = 4/170 (2%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DAV  VDVYRLVQYD+SGVP+GSR+A LNHHAGSSL + G GS +DLSR+V++LP
Sbjct  28   FVELSDAVTVVDVYRLVQYDISGVPFGSRLAVLNHHAGSSLFASG-GSGSDLSRTVLILP  86

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +REL+ TLIKEYI Q KLLGGLLLLLPPK SP+NLD A GAD    I+   + L ELE+L
Sbjct  87   VRELDPTLIKEYIEQKKLLGGLLLLLPPKLSPENLDNAFGAD--EGINSLMSKLAELERL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L H NIPYPVYFAFEDDNIN+VLA++KR +DA GQPATATTGG+K VV+A
Sbjct  145  LTHSNIPYPVYFAFEDDNINAVLAEVKR-NDASGQPATATTGGYKLVVAA  193



>ref|XP_009758150.1| PREDICTED: nicalin-1-like [Nicotiana sylvestris]
Length=562

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 137/165 (83%), Gaps = 8/165 (5%)
 Frame = +1

Query  142  DAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELN  321
            DA+  VDVYRLVQYDLSGVP+GSR+A+LNHHAGSSL +       DLSR+V+MLP+RELN
Sbjct  34   DAITVVDVYRLVQYDLSGVPFGSRLATLNHHAGSSLFAS-----VDLSRTVLMLPVRELN  88

Query  322  LTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVN  501
            L LIK YIGQ KLLGGLLLLLPPKFS + +D A G D   + DL RN ++ELE+LLIH N
Sbjct  89   LDLIKGYIGQGKLLGGLLLLLPPKFSLEKVDAAAGDD--GDFDLLRNKVSELERLLIHAN  146

Query  502  IPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            IPYPVYFAFEDDNIN+VLA++KR +DA GQPATATTGG+K VV+A
Sbjct  147  IPYPVYFAFEDDNINAVLAEVKR-NDASGQPATATTGGYKLVVAA  190



>ref|XP_010912330.1| PREDICTED: nicalin-1-like isoform X3 [Elaeis guineensis]
Length=491

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 130/169 (77%), Gaps = 9/169 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYD++GVPYGSR+A LNHHAG+S  +PG    ADLSR+V+M+P
Sbjct  32   CVELGDAATAVDVYRLIQYDIAGVPYGSRLAGLNHHAGASFFAPG----ADLSRTVVMMP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLT ++EYI  N+ LGGLLLLLP K      +   G   + +  L RNIL ELEQL
Sbjct  88   VRELNLTFLREYIISNQPLGGLLLLLPEKVG----NRIVGKIKSKDDGLMRNILVELEQL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH NIPYPVYFAFEDD IN+VLAD++R +DA GQP  ATTGG+K +VS
Sbjct  144  LIHANIPYPVYFAFEDDKINAVLADVRR-NDATGQPPMATTGGYKLLVS  191



>ref|XP_010912329.1| PREDICTED: nicalin-1-like isoform X2 [Elaeis guineensis]
Length=517

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 130/169 (77%), Gaps = 9/169 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYD++GVPYGSR+A LNHHAG+S  +PG    ADLSR+V+M+P
Sbjct  32   CVELGDAATAVDVYRLIQYDIAGVPYGSRLAGLNHHAGASFFAPG----ADLSRTVVMMP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLT ++EYI  N+ LGGLLLLLP K      +   G   + +  L RNIL ELEQL
Sbjct  88   VRELNLTFLREYIISNQPLGGLLLLLPEKVG----NRIVGKIKSKDDGLMRNILVELEQL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH NIPYPVYFAFEDD IN+VLAD++R +DA GQP  ATTGG+K +VS
Sbjct  144  LIHANIPYPVYFAFEDDKINAVLADVRR-NDATGQPPMATTGGYKLLVS  191



>gb|KHN38614.1| Nicalin-1, partial [Glycine soja]
Length=550

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+ASLNHHA S   SP      DLSR+V+++P
Sbjct  14   CVDLCDGATVVDVYRLIQYDMSGVPFGSRLASLNHHAASLHFSP----HVDLSRTVLLIP  69

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ +KEYI ++K LGGL+ LLP  FS +N D  G    +   +L +N+L+ELE++
Sbjct  70   LRELNMSFVKEYIAESKPLGGLIFLLPRMFSFENKDGMGSNHQDESKELLKNVLDELEKI  129

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH N+PYPVYFAFEDDNI++VL DIK+ +D  GQPATATTGG+KFVVSA
Sbjct  130  LIHANLPYPVYFAFEDDNIDAVLTDIKK-NDVTGQPATATTGGYKFVVSA  178



>ref|XP_010912328.1| PREDICTED: nicalin-like isoform X1 [Elaeis guineensis]
Length=564

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 130/169 (77%), Gaps = 9/169 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYD++GVPYGSR+A LNHHAG+S  +PG    ADLSR+V+M+P
Sbjct  32   CVELGDAATAVDVYRLIQYDIAGVPYGSRLAGLNHHAGASFFAPG----ADLSRTVVMMP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLT ++EYI  N+ LGGLLLLLP K      +   G   + +  L RNIL ELEQL
Sbjct  88   VRELNLTFLREYIISNQPLGGLLLLLPEKVG----NRIVGKIKSKDDGLMRNILVELEQL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH NIPYPVYFAFEDD IN+VLAD++R +DA GQP  ATTGG+K +VS
Sbjct  144  LIHANIPYPVYFAFEDDKINAVLADVRR-NDATGQPPMATTGGYKLLVS  191



>gb|KHN21166.1| Nicalin [Glycine soja]
Length=562

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 130/170 (76%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+ASLNHHA S   SP      DLSR+V+++P
Sbjct  26   CVDLCDGATVVDVYRLIQYDMSGVPFGSRLASLNHHAASLHFSP----HVDLSRTVLLIP  81

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ +KEYI ++K LGGL+ LLP  FS +N D  G    +   +L +N L+ELEQ+
Sbjct  82   LRELNMSFVKEYIAESKPLGGLIFLLPRMFSFENKDGMGSNHQDESKELLKNALDELEQI  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH N+PYPVYFAFEDDNI++VL DIK+ +D  GQPATATTGG+KFVVSA
Sbjct  142  LIHANLPYPVYFAFEDDNIDAVLTDIKK-NDVTGQPATATTGGYKFVVSA  190



>ref|XP_011088931.1| PREDICTED: nicalin-1-like [Sesamum indicum]
Length=569

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 141/172 (82%), Gaps = 3/172 (2%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLS--PGDGSFADLSRSVIM  300
             VEL DAV  VDVYRLVQYDL+GVP+GSR+A+LNHHAGSSL S     G+  DLSR+V++
Sbjct  27   CVELCDAVTVVDVYRLVQYDLAGVPFGSRLAALNHHAGSSLFSSSAAGGAVTDLSRTVLI  86

Query  301  LPLRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELE  480
            LP+RELNLT I+EYIGQ K LGGLLLLLP  F+P N+D+ GG+D +S   + + +L ELE
Sbjct  87   LPVRELNLTFIREYIGQKKPLGGLLLLLPQVFNPQNVDSGGGSDHDSATKVIKEVLVELE  146

Query  481  QLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            +LL+H NIPYPVYF FEDD++N+VLADIK+ +DA GQPATATTGG+K VV+A
Sbjct  147  KLLLHANIPYPVYFGFEDDHVNAVLADIKK-NDATGQPATATTGGYKLVVAA  197



>ref|XP_003538104.1| PREDICTED: nicalin-1-like [Glycine max]
Length=562

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+ASLNHHA S   SP     ADLSR+V+++P
Sbjct  26   CVDLCDGATVVDVYRLIQYDMSGVPFGSRLASLNHHAASLHFSP----HADLSRTVLLIP  81

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ +KEYI ++K LGGL+ LLP  FS +N D  G    +   +  +N+L+ELE++
Sbjct  82   LRELNMSFVKEYIAESKPLGGLIFLLPRMFSFENKDGMGSNHQDESKEPLKNVLDELEKI  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH N+PYPVYFAFEDDNI++VL DIK+ +D  GQPATATTGG+KFVVSA
Sbjct  142  LIHANLPYPVYFAFEDDNIDAVLTDIKK-NDVTGQPATATTGGYKFVVSA  190



>ref|XP_011043354.1| PREDICTED: nicalin-1-like [Populus euphratica]
Length=572

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 133/171 (78%), Gaps = 6/171 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L DA   VDVYRL+QYD+SGVP+GSR A+LNHHAGS   +PG     DLSR+V+++P
Sbjct  35   CVDLCDAATVVDVYRLIQYDISGVPFGSRFATLNHHAGSLHFAPG----VDLSRTVLIIP  90

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVN-SEIDLTRNILNELEQ  483
            +RELN+T +KEYI Q K LGGLL LLP  F+ +N + A  +     E +L + +L ELE+
Sbjct  91   VRELNITFVKEYISQRKPLGGLLFLLPQMFNFENREAATESKYQIHEKELMKTVLVELER  150

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LLIH NIPYPVYFAFEDD+I++VLAD+KRSD + GQPATATTGG+KFVVSA
Sbjct  151  LLIHANIPYPVYFAFEDDDIDAVLADVKRSDVS-GQPATATTGGYKFVVSA  200



>ref|XP_007015761.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 2 [Theobroma cacao]
 gb|EOY33380.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 2 [Theobroma cacao]
Length=473

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 128/168 (76%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA A VDVYRL+QYD+SG P+GSR+ASLNHHA S    PG    ADLSR+V+++P
Sbjct  30   CVELCDAAAVVDVYRLIQYDMSGSPFGSRLASLNHHAASLHFPPG----ADLSRTVLIIP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN+T ++EYI Q K LGGLL LLP  FS +N    GG     E +  +N+L ELEQL
Sbjct  86   LRELNITFVREYINQKKPLGGLLFLLPEVFSFEN----GGNKQIHEKEKMKNVLAELEQL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            LIH NIPYPVYFAFE+D I +VLADIK+ +DA+GQPATATTGG+K V+
Sbjct  142  LIHANIPYPVYFAFENDEIETVLADIKK-NDAIGQPATATTGGYKLVI  188



>emb|CDP06883.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 137/179 (77%), Gaps = 12/179 (7%)
 Frame = +1

Query  133  ELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFA-----------D  279
            +L + V  VDVYRLVQYDL+GVP+GSR ASLNHHA SSL S G GS +           D
Sbjct  35   DLCNGVTVVDVYRLVQYDLAGVPFGSRFASLNHHAASSLFSSGAGSGSGSGGGNSAAAAD  94

Query  280  LSRSVIMLPLRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTR  459
            LSR+V++LPLRELNL LI+EYIGQ K+LGGLLLLLP  F+P N+D  G AD     D++R
Sbjct  95   LSRTVLILPLRELNLALIREYIGQRKILGGLLLLLPSIFNPKNVDNTGEADHTPAEDVSR  154

Query  460  NILNELEQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            +IL ELEQLLIH NIPYPVYFAFE D+IN+VL D+KR +D  GQPATATTGG+K VV+A
Sbjct  155  DILVELEQLLIHANIPYPVYFAFEHDDINAVLVDVKR-NDVTGQPATATTGGYKLVVAA  212



>ref|XP_006362633.1| PREDICTED: nicalin-1-like isoform X1 [Solanum tuberosum]
Length=577

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 139/170 (82%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DAV AVDVYRLVQYD+SGVP+GSR+A+LNHHAGSS      GS +DLSR+V++LP
Sbjct  28   CVELSDAVTAVDVYRLVQYDISGVPFGSRLATLNHHAGSSFFG--SGSSSDLSRTVLILP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLTLI EYI Q KLLGGLLLLLPPKF P+N  +  GAD   +ID  RN L ELE L
Sbjct  86   VRELNLTLITEYIEQKKLLGGLLLLLPPKFRPENTGSTFGAD--EDIDSLRNKLVELEWL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L H NIPYPVYFAFEDDNIN+VLA+IKR +DA GQPATATTGG+K VV+A
Sbjct  144  LTHSNIPYPVYFAFEDDNINAVLAEIKR-NDASGQPATATTGGYKLVVAA  192



>ref|XP_006362634.1| PREDICTED: nicalin-1-like isoform X2 [Solanum tuberosum]
Length=564

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 139/170 (82%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DAV AVDVYRLVQYD+SGVP+GSR+A+LNHHAGSS      GS +DLSR+V++LP
Sbjct  28   CVELSDAVTAVDVYRLVQYDISGVPFGSRLATLNHHAGSSFFG--SGSSSDLSRTVLILP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLTLI EYI Q KLLGGLLLLLPPKF P+N  +  GAD   +ID  RN L ELE L
Sbjct  86   VRELNLTLITEYIEQKKLLGGLLLLLPPKFRPENTGSTFGAD--EDIDSLRNKLVELEWL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L H NIPYPVYFAFEDDNIN+VLA+IKR +DA GQPATATTGG+K VV+A
Sbjct  144  LTHSNIPYPVYFAFEDDNINAVLAEIKR-NDASGQPATATTGGYKLVVAA  192



>ref|XP_007015760.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 1 [Theobroma cacao]
 gb|EOY33379.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 1 [Theobroma cacao]
Length=562

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 128/168 (76%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA A VDVYRL+QYD+SG P+GSR+ASLNHHA S    PG    ADLSR+V+++P
Sbjct  30   CVELCDAAAVVDVYRLIQYDMSGSPFGSRLASLNHHAASLHFPPG----ADLSRTVLIIP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN+T ++EYI Q K LGGLL LLP  FS +N    GG     E +  +N+L ELEQL
Sbjct  86   LRELNITFVREYINQKKPLGGLLFLLPEVFSFEN----GGNKQIHEKEKMKNVLAELEQL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            LIH NIPYPVYFAFE+D I +VLADIK+ +DA+GQPATATTGG+K V+
Sbjct  142  LIHANIPYPVYFAFENDEIETVLADIKK-NDAIGQPATATTGGYKLVI  188



>ref|XP_004506200.1| PREDICTED: nicalin-1-like [Cicer arietinum]
Length=564

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 132/170 (78%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+ASLNHHA S   SP     ADLSR+V+++P
Sbjct  28   CVDLCDGATVVDVYRLIQYDMSGVPFGSRLASLNHHAASLHFSP----HADLSRTVLLIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ ++EYI  +K LGGL+LLLP  FS +N    G    +   +L +N+L+E+EQ+
Sbjct  84   LRELNMSFVQEYIAASKPLGGLILLLPQMFSVENKGGVGSNHDDGSKELLKNVLDEVEQI  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH N+PYPVYFAFED+NI++VL DIK+ +DA GQPATATTGG+KFVVSA
Sbjct  144  LIHTNLPYPVYFAFEDENIDTVLLDIKK-NDATGQPATATTGGYKFVVSA  192



>ref|XP_010931104.1| PREDICTED: nicalin-like isoform X2 [Elaeis guineensis]
Length=534

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 128/171 (75%), Gaps = 11/171 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYDL+GVPYGSR   LNHHAG+   +PG    AD SR+V+M+P
Sbjct  32   CVELGDAATAVDVYRLIQYDLAGVPYGSRFGGLNHHAGAFPFAPG----ADFSRTVVMMP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEID-LTRNILNELEQ  483
            +RELN T ++EYI   + LGGLL LLP K S   +      ++ S+ D L R IL ELEQ
Sbjct  88   VRELNFTFLREYIINKQQLGGLLFLLPQKVSKKIV-----GEIKSKDDGLMRKILVELEQ  142

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LLIH +IPYPVYFAFEDD IN++LAD++RS DA GQPATATTGG+K VVS+
Sbjct  143  LLIHASIPYPVYFAFEDDKINALLADVRRS-DATGQPATATTGGYKLVVSS  192



>ref|XP_010931103.1| PREDICTED: nicalin-like isoform X1 [Elaeis guineensis]
Length=564

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 128/171 (75%), Gaps = 11/171 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYDL+GVPYGSR   LNHHAG+   +PG    AD SR+V+M+P
Sbjct  32   CVELGDAATAVDVYRLIQYDLAGVPYGSRFGGLNHHAGAFPFAPG----ADFSRTVVMMP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEID-LTRNILNELEQ  483
            +RELN T ++EYI   + LGGLL LLP K S   +      ++ S+ D L R IL ELEQ
Sbjct  88   VRELNFTFLREYIINKQQLGGLLFLLPQKVSKKIV-----GEIKSKDDGLMRKILVELEQ  142

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LLIH +IPYPVYFAFEDD IN++LAD++RS DA GQPATATTGG+K VVS+
Sbjct  143  LLIHASIPYPVYFAFEDDKINALLADVRRS-DATGQPATATTGGYKLVVSS  192



>ref|XP_007132463.1| hypothetical protein PHAVU_011G096100g [Phaseolus vulgaris]
 gb|ESW04457.1| hypothetical protein PHAVU_011G096100g [Phaseolus vulgaris]
Length=561

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 8/170 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+ASLNHHA S   SP     ADLSR+V+++P
Sbjct  28   CVDLCDGATVVDVYRLIQYDMSGVPFGSRLASLNHHAASLHFSP----HADLSRTVLLIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ ++EYI ++K LGGL+ LLP  FS ++ D  G    +  +   +N+L ELEQ+
Sbjct  84   LRELNMSFVQEYISESKPLGGLIFLLPRMFSFESKDGMGNNHRDGPL---KNVLVELEQI  140

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH N+PYPVYFAFEDDNI++VLADIK+ +D  GQPATATTGG+KFVVSA
Sbjct  141  LIHANLPYPVYFAFEDDNIDAVLADIKK-NDVTGQPATATTGGYKFVVSA  189



>ref|XP_008229012.1| PREDICTED: nicalin-1 [Prunus mume]
Length=565

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 5/169 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SG P+GSR+A+LNHHAGS   +PG    +DLSR+V+++P
Sbjct  29   CVELCDAATVVDVYRLIQYDISGAPFGSRLANLNHHAGSLQFAPG----SDLSRTVLIIP  84

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ +KEYI QN+ LGGLL LLP  F+ +N + A        ++L +N L ELE+L
Sbjct  85   LRELNISFVKEYITQNQPLGGLLFLLPQIFNIENRERAKSNHQTDGVELLKNDLAELEKL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH  IPYPVYFAFEDD+I +VLAD+KR +DA GQPATATTGG+K VVS
Sbjct  145  LIHSKIPYPVYFAFEDDDIEAVLADVKR-NDATGQPATATTGGYKLVVS  192



>ref|XP_008799667.1| PREDICTED: nicalin-like isoform X2 [Phoenix dactylifera]
Length=519

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 128/171 (75%), Gaps = 11/171 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYDL+G+PYGSR A LNHHAG+   +PG    ADLSR+V+M+P
Sbjct  32   CVELGDAATAVDVYRLIQYDLAGMPYGSRHAGLNHHAGAFPFAPG----ADLSRTVVMMP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEID-LTRNILNELEQ  483
            +RELNLT ++EYI   +  GGLL LLP K     +      ++ S+ D L R IL ELEQ
Sbjct  88   VRELNLTFLQEYIINKQPFGGLLFLLPQKVGKKIV-----GEIKSKDDGLMRKILVELEQ  142

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LLIH +IPYPVYFAFEDD INS+LAD++RS DA GQP TATTGG+K VVS+
Sbjct  143  LLIHASIPYPVYFAFEDDKINSLLADVRRS-DASGQPTTATTGGYKLVVSS  192



>ref|XP_004228460.1| PREDICTED: nicalin-1-like [Solanum lycopersicum]
Length=565

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 5/170 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VE  DAV AVDVYRLVQYD++GVP+GSR+A+ NHHAGSS      GS +DLSR+V++LP
Sbjct  29   CVEFSDAVTAVDVYRLVQYDIAGVPFGSRLATFNHHAGSSFFG--SGSSSDLSRTVLILP  86

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLTLI EYI Q KLLGGLLLLLPPKF P+N  +  GAD   +ID  RN L ELE L
Sbjct  87   VRELNLTLITEYIEQKKLLGGLLLLLPPKFRPENTGSTFGAD--EDIDSLRNKLVELEWL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L H NIPYPVYFAFEDDNIN+VLA++KR +DA GQPATATTGG+K VV+A
Sbjct  145  LTHSNIPYPVYFAFEDDNINAVLAEVKR-NDASGQPATATTGGYKLVVAA  193



>ref|XP_002312837.2| hypothetical protein POPTR_0009s16200g [Populus trichocarpa]
 gb|EEE86792.2| hypothetical protein POPTR_0009s16200g [Populus trichocarpa]
Length=572

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 131/171 (77%), Gaps = 6/171 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L DA   VDVYRL+QYD+SGVP+GSR A+LNHHAGS   + G     DLSR+V+++P
Sbjct  35   CVDLCDAATVVDVYRLIQYDISGVPFGSRFATLNHHAGSLHFAAG----VDLSRTVLIIP  90

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVN-SEIDLTRNILNELEQ  483
            +RELN+T +KEYI Q K LGGLL LLP  F+ +N + A  +     E +L + +L ELE+
Sbjct  91   VRELNITFVKEYISQRKPLGGLLFLLPQMFNFENREAATESKYQIREKELMKTVLVELER  150

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LLIH NIPYPVYFAFEDD+I++VLAD+KRSD + GQPATATTGG+K VVSA
Sbjct  151  LLIHANIPYPVYFAFEDDDIDAVLADVKRSDVS-GQPATATTGGYKLVVSA  200



>ref|XP_008799665.1| PREDICTED: nicalin-like isoform X1 [Phoenix dactylifera]
Length=564

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 128/170 (75%), Gaps = 11/170 (6%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VELGDA  AVDVYRL+QYDL+G+PYGSR A LNHHAG+   +PG    ADLSR+V+M+P+
Sbjct  33   VELGDAATAVDVYRLIQYDLAGMPYGSRHAGLNHHAGAFPFAPG----ADLSRTVVMMPV  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEID-LTRNILNELEQL  486
            RELNLT ++EYI   +  GGLL LLP K     +      ++ S+ D L R IL ELEQL
Sbjct  89   RELNLTFLQEYIINKQPFGGLLFLLPQKVGKKIV-----GEIKSKDDGLMRKILVELEQL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH +IPYPVYFAFEDD INS+LAD++RS DA GQP TATTGG+K VVS+
Sbjct  144  LIHASIPYPVYFAFEDDKINSLLADVRRS-DASGQPTTATTGGYKLVVSS  192



>ref|XP_002273260.1| PREDICTED: nicalin-1 [Vitis vinifera]
 emb|CBI28285.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYDL+GVP+GSR+A+LNHHA S     G    ADLSR+V+++P
Sbjct  28   CVELCDAATVVDVYRLIQYDLAGVPFGSRLANLNHHAAS-----GFAPAADLSRTVVIVP  82

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +R++N+T I +YI Q + LGGLL LLP   S +N D  G  D   E  L RN+L ELEQL
Sbjct  83   VRDINITFIGDYITQKQPLGGLLFLLPRMISSENRDDMGRGDQTFEEKLMRNMLGELEQL  142

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH +IPYPVYFAFEDDNI+ VL DIKR +DA  QPATATTGG+K VVSA
Sbjct  143  LIHASIPYPVYFAFEDDNIDDVLTDIKR-NDATSQPATATTGGYKLVVSA  191



>gb|KEH29829.1| M28 Zn-peptidase nicastrin [Medicago truncatula]
Length=584

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 133/173 (77%), Gaps = 11/173 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+AS+NHHA S   +P     ADLSR+V+++P
Sbjct  28   CVDLCDGATVVDVYRLIQYDISGVPFGSRLASINHHAASLHFAPS----ADLSRTVLLIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSE---IDLTRNILNEL  477
            LRELN++ ++EYIG +K LGGL+ LLP  FS  N    GGA  N +    +  +N+L++L
Sbjct  84   LRELNMSFVQEYIGGSKPLGGLIFLLPQIFSFKN---KGGASSNHDDGSKEPLKNVLDKL  140

Query  478  EQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            EQ+LIH N+PYPVYFAFEDDNI++VL DIK+ +DA GQPATATTGG+KFVVSA
Sbjct  141  EQILIHTNLPYPVYFAFEDDNIDTVLLDIKK-NDASGQPATATTGGYKFVVSA  192



>gb|KEH29830.1| M28 Zn-peptidase nicastrin [Medicago truncatula]
Length=564

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 133/173 (77%), Gaps = 11/173 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L D    VDVYRL+QYD+SGVP+GSR+AS+NHHA S   +P     ADLSR+V+++P
Sbjct  28   CVDLCDGATVVDVYRLIQYDISGVPFGSRLASINHHAASLHFAPS----ADLSRTVLLIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSE---IDLTRNILNEL  477
            LRELN++ ++EYIG +K LGGL+ LLP  FS  N    GGA  N +    +  +N+L++L
Sbjct  84   LRELNMSFVQEYIGGSKPLGGLIFLLPQIFSFKN---KGGASSNHDDGSKEPLKNVLDKL  140

Query  478  EQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            EQ+LIH N+PYPVYFAFEDDNI++VL DIK+ +DA GQPATATTGG+KFVVSA
Sbjct  141  EQILIHTNLPYPVYFAFEDDNIDTVLLDIKK-NDASGQPATATTGGYKFVVSA  192



>gb|AAO00855.1| putative protein [Arabidopsis thaliana]
 gb|AAP13419.1| At3g44330 [Arabidopsis thaliana]
Length=277

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 129/168 (77%), Gaps = 8/168 (5%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LPL
Sbjct  33   VELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            REL++  +++YI Q + LGGLL+LLP  F P N+   GG  ++SE D  R++L +LE+LL
Sbjct  89   RELDIAFVQDYISQKQSLGGLLILLPQTFRPGNV---GGGSLSSENDGFRSLLGQLEKLL  145

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  146  VHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_007205001.1| hypothetical protein PRUPE_ppa003566mg [Prunus persica]
 gb|EMJ06200.1| hypothetical protein PRUPE_ppa003566mg [Prunus persica]
Length=565

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 129/169 (76%), Gaps = 5/169 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SG P+GSR+A+LNHHAGS   +PG    +DLSR+V+++P
Sbjct  29   CVELCDAATVVDVYRLIQYDISGAPFGSRLANLNHHAGSLHFAPG----SDLSRTVLIIP  84

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN++ +KEYI QN+ LGGLL LLP  F+ +N + A         +L +N L ELE+L
Sbjct  85   LRELNISFVKEYITQNQPLGGLLFLLPQIFNIENRERAKSNHQTDGEELLKNDLAELEKL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH  IPYPVYFAFEDD+I +VLAD+KR +DA GQPATATTGG+K VVS
Sbjct  145  LIHSKIPYPVYFAFEDDDIEAVLADVKR-NDATGQPATATTGGYKLVVS  192



>gb|KJB35406.1| hypothetical protein B456_006G113500 [Gossypium raimondii]
Length=341

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA AAVDVYRL+QYD+SG P+GSR A+LNHHA S    PG     DLSR+V+++P
Sbjct  30   CVELCDAAAAVDVYRLIQYDMSGSPFGSRFAALNHHAASLHFPPG----VDLSRTVLIIP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN+T ++EYI Q   LGGLL+LLP   S     T G   V+ E +  +N+L ELE+L
Sbjct  86   LRELNITFVREYINQKNPLGGLLVLLPEVLS---FKTGGNKQVH-EKEKMKNLLAELERL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H NIPYPVYFAFE+D I++VLADIK+ +D +GQPATATTGG+KFV+
Sbjct  142  LVHSNIPYPVYFAFENDEIDTVLADIKK-NDLMGQPATATTGGYKFVI  188



>ref|XP_010245975.1| PREDICTED: nicalin-1 isoform X2 [Nelumbo nucifera]
Length=538

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 133/169 (79%), Gaps = 5/169 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA   VDVYRL+QYDL+GVP+GSR+ASLNHHAGS   +PG    ADLSR+V+++P
Sbjct  28   CVELGDAATVVDVYRLIQYDLAGVPFGSRLASLNHHAGSLPFAPG----ADLSRTVVIIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
             RE+N+T +++YI Q + LGGLLLLLP   S ++ + A   D N+  +L R+ L ELE+L
Sbjct  84   FREVNITFLRDYIMQRQPLGGLLLLLPQNISSESREEAEEGDRNNGKELIRSELAELEKL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+HVNIPYPVYFAFEDD I +VLAD+K ++DA GQPATATTGG+K VVS
Sbjct  144  LVHVNIPYPVYFAFEDDKITAVLADVK-TNDATGQPATATTGGYKLVVS  191



>ref|XP_010245968.1| PREDICTED: nicalin-1 isoform X1 [Nelumbo nucifera]
Length=564

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 133/169 (79%), Gaps = 5/169 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA   VDVYRL+QYDL+GVP+GSR+ASLNHHAGS   +PG    ADLSR+V+++P
Sbjct  28   CVELGDAATVVDVYRLIQYDLAGVPFGSRLASLNHHAGSLPFAPG----ADLSRTVVIIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
             RE+N+T +++YI Q + LGGLLLLLP   S ++ + A   D N+  +L R+ L ELE+L
Sbjct  84   FREVNITFLRDYIMQRQPLGGLLLLLPQNISSESREEAEEGDRNNGKELIRSELAELEKL  143

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+HVNIPYPVYFAFEDD I +VLAD+K ++DA GQPATATTGG+K VVS
Sbjct  144  LVHVNIPYPVYFAFEDDKITAVLADVK-TNDATGQPATATTGGYKLVVS  191



>gb|KJB55582.1| hypothetical protein B456_009G084100 [Gossypium raimondii]
Length=562

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 126/168 (75%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA AA+DVYRL+QYD+SG  YGSR A LNHHA S    PG    ADLSR+V+++P
Sbjct  30   CVELCDAAAAIDVYRLIQYDMSGSAYGSRFAVLNHHAASLHFPPG----ADLSRAVLIIP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN+T ++EYI Q K LGGLL LLP  FS +N    GG     E +  +N+L ELEQL
Sbjct  86   LRELNITFVREYINQKKPLGGLLFLLPDIFSFEN----GGNKQVHEKEKLKNLLAELEQL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            LIH NIPYPVYFAFE+D I++VL DIK+ +DA+GQPATATTGG+K V+
Sbjct  142  LIHANIPYPVYFAFENDEIDTVLVDIKK-NDAIGQPATATTGGYKLVI  188



>gb|KJB55581.1| hypothetical protein B456_009G084100 [Gossypium raimondii]
 gb|KJB55583.1| hypothetical protein B456_009G084100 [Gossypium raimondii]
Length=562

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 126/168 (75%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA AA+DVYRL+QYD+SG  YGSR A LNHHA S    PG    ADLSR+V+++P
Sbjct  30   CVELCDAAAAIDVYRLIQYDMSGSAYGSRFAVLNHHAASLHFPPG----ADLSRAVLIIP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN+T ++EYI Q K LGGLL LLP  FS +N    GG     E +  +N+L ELEQL
Sbjct  86   LRELNITFVREYINQKKPLGGLLFLLPDIFSFEN----GGNKQVHEKEKLKNLLAELEQL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            LIH NIPYPVYFAFE+D I++VL DIK+ +DA+GQPATATTGG+K V+
Sbjct  142  LIHANIPYPVYFAFENDEIDTVLVDIKK-NDAIGQPATATTGGYKLVI  188



>ref|XP_008372817.1| PREDICTED: nicalin-1-like [Malus domestica]
Length=212

 Score =   175 bits (444),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 128/169 (76%), Gaps = 7/169 (4%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VEL DA   VDVYRL+QYD+SG P+GSR+A+LNHHAGS   +PG    +DLSR+V+++PL
Sbjct  33   VELCDAATVVDVYRLIQYDISGAPFGSRLANLNHHAGSLNFAPG----SDLSRTVLIIPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTA-GGADVNSEIDLTRNILNELEQL  486
             ELN++ + EYI Q + LGGLL LLP  FS ++ + A      + E+ + +N L ELE+L
Sbjct  89   HELNISFVSEYITQKQPLGGLLFLLPQIFSIESRERATSNHQTDGEVPM-KNYLAELEKL  147

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH  IPYPVYFAFEDD+I +VLAD+KR +DA GQPATATTGG+K VVS
Sbjct  148  LIHSKIPYPVYFAFEDDDIEAVLADVKR-NDATGQPATATTGGYKLVVS  195



>gb|KJB35405.1| hypothetical protein B456_006G113500 [Gossypium raimondii]
Length=407

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA AAVDVYRL+QYD+SG P+GSR A+LNHHA S    PG     DLSR+V+++P
Sbjct  30   CVELCDAAAAVDVYRLIQYDMSGSPFGSRFAALNHHAASLHFPPG----VDLSRTVLIIP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN+T ++EYI Q   LGGLL+LLP   S     T G   V+ E +  +N+L ELE+L
Sbjct  86   LRELNITFVREYINQKNPLGGLLVLLPEVLS---FKTGGNKQVH-EKEKMKNLLAELERL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H NIPYPVYFAFE+D I++VLADIK+ +D +GQPATATTGG+KFV+
Sbjct  142  LVHSNIPYPVYFAFENDEIDTVLADIKK-NDLMGQPATATTGGYKFVI  188



>ref|XP_011006549.1| PREDICTED: nicalin-1-like isoform X2 [Populus euphratica]
Length=376

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 128/171 (75%), Gaps = 6/171 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             +EL DA   VDVYRL+QYD+SG  +GSR ++LNHHAGS  L PG     DLSR+V+++P
Sbjct  28   WIELCDAATVVDVYRLIQYDISGAQFGSRFSTLNHHAGSLHLPPG----VDLSRTVVIIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVN-SEIDLTRNILNELEQ  483
            +RELN+TL+KE+I Q K LGGLL LLP   + +N D    +     E  LT N+L ELE+
Sbjct  84   VRELNITLVKEFIAQRKPLGGLLFLLPQMLNFENRDPTSESKYQIHEKKLTNNVLVELER  143

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LLI+ NIPYPVYFAFEDD+I++VLAD+KR +DA GQPATAT+G +K VVSA
Sbjct  144  LLIYANIPYPVYFAFEDDDIDAVLADVKR-NDASGQPATATSGSYKLVVSA  193



>gb|KDP24745.1| hypothetical protein JCGZ_25494 [Jatropha curcas]
Length=555

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 6/171 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR+A+LNHHAGS   +PG    ADLSR+V+M+P
Sbjct  18   CVELCDAATVVDVYRLIQYDISGVPFGSRLANLNHHAGSLHFAPG----ADLSRTVVMIP  73

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNL-DTAGGADVNSEIDLTRNILNELEQ  483
            +RELN+T +KEYI Q K LGGLL LLP  F+ +N  DT     ++ +  L + +L ELE+
Sbjct  74   VRELNITFVKEYITQRKPLGGLLFLLPQMFNFENRGDTGNNHQIHDDKQLMKIVLVELER  133

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LL+H NIPYPVYFAFEDD+I++VLAD+KRS DA GQPATATTGG+KFVVSA
Sbjct  134  LLLHANIPYPVYFAFEDDDIDAVLADVKRS-DATGQPATATTGGYKFVVSA  183



>dbj|BAG15862.1| hypothetical protein [Bruguiera gymnorhiza]
Length=567

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 130/172 (76%), Gaps = 7/172 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR+ASLNHHA S   +PG    AD+SR+ +M+P
Sbjct  29   CVELCDAATVVDVYRLIQYDISGVPFGSRLASLNHHAASLHFAPG----ADVSRAALMIP  84

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNS--EIDLTRNILNELE  480
            +RE+N+T ++E+I Q + LG LL LLP  F+ +N D  G        + ++ + +L ELE
Sbjct  85   VREMNITFVREFITQGRPLGSLLFLLPQMFNFNNGDGDGMRSKYQVHDKEMMKTLLAELE  144

Query  481  QLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            ++LIH  IPYPVYFAFE+DNI++VLAD+KR +DA+GQPATATTGG+K VV+A
Sbjct  145  RILIHAKIPYPVYFAFENDNIDAVLADVKR-NDAIGQPATATTGGYKLVVAA  195



>ref|XP_009416037.1| PREDICTED: nicalin [Musa acuminata subsp. malaccensis]
Length=562

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 9/170 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYDLSG PYGSR+A LNHHAG++  +      ADLSR+V++LP
Sbjct  31   CVELGDAATAVDVYRLIQYDLSGAPYGSRLAGLNHHAGAAPFA----PGADLSRTVVILP  86

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELNLT ++EYI   + LGGLLLLL      D    +GG + +  + L R+IL+ELEQL
Sbjct  87   VRELNLTFLQEYITSKQPLGGLLLLL----PQDIRHKSGGGNKSRNVGLLRSILSELEQL  142

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIHVN+PYPVYFA+EDD IN+VLAD++R  DA GQPATATTGG+K VVS 
Sbjct  143  LIHVNLPYPVYFAYEDDKINAVLADVRRG-DATGQPATATTGGYKLVVST  191



>ref|XP_010102017.1| hypothetical protein L484_016307 [Morus notabilis]
 gb|EXB91237.1| hypothetical protein L484_016307 [Morus notabilis]
Length=766

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 127/169 (75%), Gaps = 5/169 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL  A   VDVYRL+QYD++GVP+GSR+A+LNHHA S+   PG    +DLSR+V+++P
Sbjct  25   CVELCGAATVVDVYRLIQYDIAGVPFGSRLAALNHHAASTHFPPG----SDLSRTVLIIP  80

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
             R+LN++ +KEYI Q + LGGLL LLP  FS +N D  G    + E +  +N+L ELEQL
Sbjct  81   FRDLNISFVKEYISQRQPLGGLLFLLPQIFSYENKDGIGRNHQDHEREQIKNVLAELEQL  140

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+H NIPYPVYFAFED +I +VLADIKR +D  GQPATATTGG+K VVS
Sbjct  141  LVHSNIPYPVYFAFEDSDIEAVLADIKR-NDVTGQPATATTGGYKLVVS  188



>ref|XP_004291695.1| PREDICTED: nicalin-1 [Fragaria vesca subsp. vesca]
Length=565

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 127/169 (75%), Gaps = 5/169 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SG  +GSR+A+LNHHAGS    PG    +DLSR+V+++P
Sbjct  29   CVELCDAATVVDVYRLIQYDMSGAQFGSRLANLNHHAGSLHSPPG----SDLSRTVLIIP  84

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LR+LN+T + EYI Q + LGGLL+LLP  F P+N++ A  +      D  + +L ELE+L
Sbjct  85   LRDLNITFVTEYITQKQPLGGLLILLPQMFRPENIEMAKSSHQTDGDDQLKTVLAELEKL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH  IPYPVYFAFEDD+I +VLAD+KR +DA GQPATATTGG+K VVS
Sbjct  145  LIHSKIPYPVYFAFEDDDIEAVLADVKR-NDASGQPATATTGGYKLVVS  192



>ref|XP_002523845.1| Nicalin precursor, putative [Ricinus communis]
 gb|EEF38571.1| Nicalin precursor, putative [Ricinus communis]
Length=559

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 128/169 (76%), Gaps = 7/169 (4%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VEL DA   VDVYRL+QYD+SGVP+GSR+A+LNHHA S    PG    ADLSR+V+++P+
Sbjct  26   VELCDAATVVDVYRLIQYDISGVPFGSRLATLNHHASSLHFPPG----ADLSRTVLIIPI  81

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            RELNLT +KEYI + K LGGLL LLP      NL   G    + +++L + +L ELE+LL
Sbjct  82   RELNLTSLKEYITERKPLGGLLFLLPQTLY--NLQKRGVEYQSYDLELLKTLLAELERLL  139

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            IH ++PYPVYFAFEDD+I++VL DIKR +D  GQPATATTGGFK VV+A
Sbjct  140  IHASVPYPVYFAFEDDDIDAVLTDIKR-NDITGQPATATTGGFKLVVAA  187



>gb|KJB35404.1| hypothetical protein B456_006G113500 [Gossypium raimondii]
Length=562

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA AAVDVYRL+QYD+SG P+GSR A+LNHHA S    PG     DLSR+V+++P
Sbjct  30   CVELCDAAAAVDVYRLIQYDMSGSPFGSRFAALNHHAASLHFPPG----VDLSRTVLIIP  85

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LRELN+T ++EYI Q   LGGLL+LLP   S     T G   V+ E +  +N+L ELE+L
Sbjct  86   LRELNITFVREYINQKNPLGGLLVLLPEVLS---FKTGGNKQVH-EKEKMKNLLAELERL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H NIPYPVYFAFE+D I++VLADIK+ +D +GQPATATTGG+KFV+
Sbjct  142  LVHSNIPYPVYFAFENDEIDTVLADIKK-NDLMGQPATATTGGYKFVI  188



>ref|XP_006836081.1| hypothetical protein AMTR_s00114p00123360 [Amborella trichopoda]
 gb|ERM98934.1| hypothetical protein AMTR_s00114p00123360 [Amborella trichopoda]
Length=559

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 129/169 (76%), Gaps = 10/169 (6%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VEL DA A +DVYRL+QYDLSG P+GSR ASLNHHAGS+L SPG     DLSR+VIM+P+
Sbjct  29   VELCDASAVMDVYRLIQYDLSGSPFGSRRASLNHHAGSALFSPG----TDLSRTVIMVPV  84

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            RELN+TL+++Y+  NK   G LLLL  K S +  DT    +   ++   R++L+E+EQ L
Sbjct  85   RELNITLLRDYL-TNKYPLGGLLLLLSKKSAEEKDT----NTEEDVGFMRSVLSEIEQFL  139

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            IH NIPYPVYFA E++ ++++LAD+K+ +DA GQPATATTGGFK V+SA
Sbjct  140  IHANIPYPVYFAHEEEKVDAILADVKK-NDATGQPATATTGGFKLVLSA  187



>ref|XP_006292677.1| hypothetical protein CARUB_v10018921mg [Capsella rubella]
 gb|EOA25575.1| hypothetical protein CARUB_v10018921mg [Capsella rubella]
Length=565

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 128/169 (76%), Gaps = 8/169 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LP
Sbjct  32   CVELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LREL++  +++YI Q + LGGLL+LLP  F P N+D   G   +SE D  RN+L ELE+L
Sbjct  88   LRELDIGFVRDYISQKQSLGGLLILLPQTFRPGNID---GGSQSSENDGFRNLLAELEKL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  145  LVHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_011006540.1| PREDICTED: nicalin-1-like isoform X1 [Populus euphratica]
Length=565

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 128/171 (75%), Gaps = 6/171 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             +EL DA   VDVYRL+QYD+SG  +GSR ++LNHHAGS  L PG     DLSR+V+++P
Sbjct  28   WIELCDAATVVDVYRLIQYDISGAQFGSRFSTLNHHAGSLHLPPG----VDLSRTVVIIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVN-SEIDLTRNILNELEQ  483
            +RELN+TL+KE+I Q K LGGLL LLP   + +N D    +     E  LT N+L ELE+
Sbjct  84   VRELNITLVKEFIAQRKPLGGLLFLLPQMLNFENRDPTSESKYQIHEKKLTNNVLVELER  143

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LLI+ NIPYPVYFAFEDD+I++VLAD+KR +DA GQPATAT+G +K VVSA
Sbjct  144  LLIYANIPYPVYFAFEDDDIDAVLADVKR-NDASGQPATATSGSYKLVVSA  193



>gb|KCW50875.1| hypothetical protein EUGRSUZ_J00522 [Eucalyptus grandis]
Length=563

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 10/167 (6%)
 Frame = +1

Query  133  ELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLR  312
            EL DA   VDVYRL+QYD++G P+GSR+A LNHHA S    PG    ADLSR+V+++P+R
Sbjct  30   ELCDAATVVDVYRLIQYDIAGAPFGSRLAGLNHHASSLHFPPG----ADLSRTVLVIPVR  85

Query  313  ELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLI  492
            +LNL  +K+Y+ Q + LGGLL LLP  FS ++ +++G  +     +L +NI+ ELEQLLI
Sbjct  86   DLNLGYVKDYLSQRQPLGGLLFLLPQIFSFESKESSGNGE-----ELLKNIVMELEQLLI  140

Query  493  HVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            H NIPYPVYFAFE+D+IN+VLADIKR+D++ GQPATATTGG+K VVS
Sbjct  141  HTNIPYPVYFAFENDDINTVLADIKRNDES-GQPATATTGGYKLVVS  186



>ref|NP_190019.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB86911.1| putative protein [Arabidopsis thaliana]
 dbj|BAE98429.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77892.1| uncharacterized protein AT3G44330 [Arabidopsis thaliana]
Length=565

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 129/168 (77%), Gaps = 8/168 (5%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LPL
Sbjct  33   VELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            REL++  +++YI Q + LGGLL+LLP  F P N+   GG  ++SE D  R++L +LE+LL
Sbjct  89   RELDIAFVQDYISQKQSLGGLLILLPQTFRPGNV---GGGSLSSENDGFRSLLGQLEKLL  145

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  146  VHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_010031534.1| PREDICTED: nicalin-1 [Eucalyptus grandis]
 gb|KCW50874.1| hypothetical protein EUGRSUZ_J00522 [Eucalyptus grandis]
Length=559

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 10/167 (6%)
 Frame = +1

Query  133  ELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLR  312
            EL DA   VDVYRL+QYD++G P+GSR+A LNHHA S    PG    ADLSR+V+++P+R
Sbjct  30   ELCDAATVVDVYRLIQYDIAGAPFGSRLAGLNHHASSLHFPPG----ADLSRTVLVIPVR  85

Query  313  ELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLI  492
            +LNL  +K+Y+ Q + LGGLL LLP  FS ++ +++G  +     +L +NI+ ELEQLLI
Sbjct  86   DLNLGYVKDYLSQRQPLGGLLFLLPQIFSFESKESSGNGE-----ELLKNIVMELEQLLI  140

Query  493  HVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            H NIPYPVYFAFE+D+IN+VLADIKR+D++ GQPATATTGG+K VVS
Sbjct  141  HTNIPYPVYFAFENDDINTVLADIKRNDES-GQPATATTGGYKLVVS  186



>ref|XP_010503086.1| PREDICTED: nicalin-1-like [Camelina sativa]
Length=565

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 129/169 (76%), Gaps = 8/169 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LP
Sbjct  32   CVELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LREL++  +++YI Q + LGGLL+LLP  F P N+   GG   +SE D  RN+L +LE+L
Sbjct  88   LRELDIGFVQDYISQKQSLGGLLILLPQTFRPGNV---GGGSQSSENDGFRNLLAQLEKL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+H NIP+PVYFAFE+++ +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  145  LVHGNIPFPVYFAFENEDTDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_002875659.1| hypothetical protein ARALYDRAFT_905545 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51918.1| hypothetical protein ARALYDRAFT_905545 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LPL
Sbjct  33   VELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            REL++  +++YI Q + LGGLL+LLP  F P N+   GG  +NSE D  R +L +LE++L
Sbjct  89   RELDIGFVQDYISQKQSLGGLLILLPQTFRPGNV---GGGSLNSENDGFRKLLAQLEKIL  145

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  146  VHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_010514774.1| PREDICTED: nicalin-1-like [Camelina sativa]
Length=565

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 128/169 (76%), Gaps = 8/169 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LP
Sbjct  32   CVELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LREL++  +++YI Q + LGGLL+LLP  F P N+   GG   +SE D  RN+L +LE+L
Sbjct  88   LRELDIGFVQDYISQKQSLGGLLILLPQTFRPGNV---GGGSQSSENDGFRNLLAQLEKL  144

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  145  LVHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_009377813.1| PREDICTED: nicalin-1-like [Pyrus x bretschneideri]
Length=570

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 128/172 (74%), Gaps = 11/172 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SG P+GSR+A+LNHHAGS   +PG    +DLSR+V+++P
Sbjct  34   CVELCDAATVVDVYRLIQYDISGAPFGSRLANLNHHAGSLHFAPG----SDLSRTVLIIP  89

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEID---LTRNILNEL  477
            LRELN++ + EYI Q + LGGLL LLP  FS +N + A     N +ID     +N L EL
Sbjct  90   LRELNISFVTEYITQKQPLGGLLFLLPQIFSIENRERATS---NHQIDGKVPMKNYLAEL  146

Query  478  EQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            E+LLIH  IPYPVYFAFEDD+I +VLAD+KR +D  GQPATATTGG+K VVS
Sbjct  147  EKLLIHSKIPYPVYFAFEDDDIEAVLADVKR-NDVSGQPATATTGGYKLVVS  197



>gb|EPS62126.1| hypothetical protein M569_12666, partial [Genlisea aurea]
Length=485

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 129/176 (73%), Gaps = 8/176 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L  AVA VDVYRLVQYDLSGVP+GSR+A LNHHAGSS L     + ADLSR+V++LP
Sbjct  19   CVDLCGAVAVVDVYRLVQYDLSGVPFGSRLAGLNHHAGSSFLC-SSAAAADLSRTVLILP  77

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLT------RNIL  468
            +RELNLT I E+I Q + LGGLLLLLP  F+P N+D   G+D +S  +        RN+L
Sbjct  78   VRELNLTFIAEFIEQKRPLGGLLLLLPQVFNPQNIDIVVGSDRDSAEEDAAAAAAIRNLL  137

Query  469  NELEQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
             +LE LLIH  + YPVYF FED+++ +VL D+ ++ DA GQ ATATTGG+K VV++
Sbjct  138  IQLENLLIHSTVSYPVYFGFEDEHVTAVLHDVTKA-DASGQLATATTGGYKLVVAS  192



>ref|XP_008784054.1| PREDICTED: nicalin-like [Phoenix dactylifera]
Length=564

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 126/167 (75%), Gaps = 11/167 (7%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
            GDA  AVDVYRL+QYDL+GVPYGSR+A LNHHA +   +PG    ADLSR+V+M+P+REL
Sbjct  36   GDAATAVDVYRLIQYDLAGVPYGSRLAGLNHHACAPPFAPG----ADLSRTVVMMPVREL  91

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEID-LTRNILNELEQLLIH  495
            NLT ++EYI  N+ LGGLLLLLP K S   +      ++ S+ D L  NIL ELEQLLIH
Sbjct  92   NLTFLREYIINNQPLGGLLLLLPQKVSNRIV-----GEIKSKDDGLMGNILVELEQLLIH  146

Query  496  VNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
             NIPYPVYFAFEDD IN++ AD++RS DA GQP  A TGG+K VVS+
Sbjct  147  ANIPYPVYFAFEDDKINAIFADVRRS-DATGQPPMAPTGGYKLVVSS  192



>ref|XP_008355243.1| PREDICTED: nicalin-1-like [Malus domestica]
Length=570

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 128/170 (75%), Gaps = 7/170 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SG P+GSR+A+LNHHAGS   +PG    +DLSR+V+++P
Sbjct  34   CVELCDAATVVDVYRLIQYDISGAPFGSRLANLNHHAGSLHFAPG----SDLSRTVLIIP  89

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTA-GGADVNSEIDLTRNILNELEQ  483
            LRELN++ + +YI Q + LGGLL LLP  FS +N + A    + + E+ + +N L ELE+
Sbjct  90   LRELNISFVTDYITQKQPLGGLLFLLPQIFSIENRERATSNHETDGEVPM-KNYLAELEK  148

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LLIH  IPYPVYFAFEDD+  +VLAD+KR +D  GQPATATTGG+K VVS
Sbjct  149  LLIHSKIPYPVYFAFEDDDTEAVLADVKR-NDVSGQPATATTGGYKLVVS  197



>gb|KFK33877.1| hypothetical protein AALP_AA5G071800 [Arabis alpina]
Length=567

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 130/170 (76%), Gaps = 8/170 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             V+L DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S    PG    ADLSRSV++LP
Sbjct  32   CVDLCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQPG----ADLSRSVLILP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGAD-VNSEIDLTRNILNELEQ  483
            LREL++  +++YI Q + LGGLL+LLP  F P N+   GG++ + SE +  R +L +LE+
Sbjct  88   LRELDIGFVQDYISQKQSLGGLLILLPQMFRPGNV--GGGSNGLISETEGFRKLLAQLEK  145

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LL+H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  146  LLVHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  194



>ref|XP_010685410.1| PREDICTED: nicalin-1 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 132/169 (78%), Gaps = 5/169 (3%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA  AVDVYRL+QYDL+G P+GSR++SLNHHA SSL +P     ADLSR+V+++P
Sbjct  25   CVELGDAATAVDVYRLIQYDLAGSPFGSRLSSLNHHAASSLTTPN----ADLSRAVVIMP  80

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +R+L+L+ +K+YI + + LGGLL LLP  F+ +  ++   AD NSE +  R+ L  LE+L
Sbjct  81   IRDLHLSSVKDYIDRKQPLGGLLFLLPQAFNSEGRESKQDADHNSEEESERDKLLLLERL  140

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+H NIPYPVYFAFED++I +VL D+KRS DA GQPATATTGG+K VVS
Sbjct  141  LVHANIPYPVYFAFEDEHIKAVLDDVKRS-DATGQPATATTGGYKLVVS  188



>emb|CDY21224.1| BnaC03g54000D [Brassica napus]
Length=565

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            V+L DA   VDVYRLVQYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LPL
Sbjct  33   VDLCDAATVVDVYRLVQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            REL+L  +++YI Q + LGGLL+LLP    P N+   GG  V SE    R +L +LE+LL
Sbjct  89   RELDLGFLQDYISQKQSLGGLLILLPQTLRPGNI---GGGSVLSETQGFRKLLAQLEKLL  145

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  146  VHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_006404470.1| hypothetical protein EUTSA_v10010249mg [Eutrema salsugineum]
 gb|ESQ45923.1| hypothetical protein EUTSA_v10010249mg [Eutrema salsugineum]
Length=565

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 127/168 (76%), Gaps = 8/168 (5%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LPL
Sbjct  33   VELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            REL++  +++YI Q + LGGLL+LLP  F P N+   GG ++ SE +  R +L +LE+LL
Sbjct  89   RELDIGFVQDYISQKQSLGGLLILLPQMFRPGNI---GGGELISETEGFRKLLAQLEKLL  145

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +H NI +PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  146  VHGNIVFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  192



>ref|XP_010425851.1| PREDICTED: nicalin-1-like [Camelina sativa]
Length=570

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 128/174 (74%), Gaps = 13/174 (7%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSG-----VPYGSRIASLNHHAGSSLLSPGDGSFADLSRS  291
             VEL DA   VDVYRL+QYD+SG     VP+GSR +SLNHHA S     G    ADLSRS
Sbjct  32   CVELCDAATVVDVYRLIQYDISGYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRS  87

Query  292  VIMLPLRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILN  471
            V++LPLREL++  +++YI Q + LGGLL+LLP  F P N+   GG   +SE D  RN+L 
Sbjct  88   VLILPLRELDIGFVQDYISQKQSLGGLLILLPQTFRPGNV---GGGSQSSENDGFRNLLA  144

Query  472  ELEQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +LE+LL+H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  145  QLEKLLVHGNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  197



>ref|XP_009374972.1| PREDICTED: nicalin-1-like [Pyrus x bretschneideri]
Length=568

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SG P+GSR+A+LNHHAGS   + G    +DLSR+V+++P
Sbjct  32   CVELCDAATVVDVYRLIQYDISGAPFGSRLANLNHHAGSLNFASG----SDLSRTVLIIP  87

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTA-GGADVNSEIDLTRNILNELEQ  483
            L ELN++ + EYI Q + LGGLL LLP  F  +N + A      + E+ + +N L ELE+
Sbjct  88   LHELNISFVTEYITQKQPLGGLLFLLPQIFGIENRERATSNHQTDGEVPM-KNYLAELEK  146

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LLIH  IPYPVYFAFEDD+I +VLAD+KR +DA GQPATATTGG+K VVS
Sbjct  147  LLIHSKIPYPVYFAFEDDDIEAVLADVKR-NDATGQPATATTGGYKLVVS  195



>ref|XP_006384766.1| hypothetical protein POPTR_0004s20910g [Populus trichocarpa]
 gb|ERP62563.1| hypothetical protein POPTR_0004s20910g [Populus trichocarpa]
Length=540

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 115/170 (68%), Gaps = 29/170 (17%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             +EL DA   VDVYRL+QYD+SG  +GSR A+LNHHAGS  L PG     DLSR+V+++P
Sbjct  28   CIELCDAATVVDVYRLIQYDISGAQFGSRFATLNHHAGSLHLPPG----VDLSRTVVIIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELN+TL+K+   ++K                            E  LT+N+L ELE+L
Sbjct  84   VRELNITLVKDPTSESKYQI------------------------HEKKLTKNVLVELERL  119

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LI+ NIPYPVYFAFEDD+I++VLAD+KR +DA GQPATATTG +K VVSA
Sbjct  120  LIYANIPYPVYFAFEDDDIDAVLADVKR-NDASGQPATATTGSYKLVVSA  168



>gb|KDO58311.1| hypothetical protein CISIN_1g0085682mg, partial [Citrus sinensis]
 gb|KDO58312.1| hypothetical protein CISIN_1g0085682mg, partial [Citrus sinensis]
 gb|KDO58313.1| hypothetical protein CISIN_1g0085682mg, partial [Citrus sinensis]
Length=363

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR+ASLNHHAGS   SPG    ADLSR+V+M+P
Sbjct  28   CVELCDAATVVDVYRLIQYDISGVPFGSRLASLNHHAGSLHFSPG----ADLSRTVVMIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELN++ + EY+ +   LGG+L LLP  F  +N    GG DV  E ++ +N+L ELE+L
Sbjct  84   VRELNISFVTEYVSRKHPLGGMLFLLPEIFRLEN--GGGGKDVR-EKEVVKNVLLELEKL  140

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H  +PYPVYFAFE+D I++VL D+K+ +DA GQPATATTGG+K V+
Sbjct  141  LVHAKLPYPVYFAFENDEIDAVLDDVKK-NDATGQPATATTGGYKLVI  187



>ref|XP_006424178.1| hypothetical protein CICLE_v10028115mg [Citrus clementina]
 gb|ESR37418.1| hypothetical protein CICLE_v10028115mg [Citrus clementina]
Length=426

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR+ASLNHHAGS   SPG    ADLSR+V+M+P
Sbjct  28   CVELCDAATVVDVYRLIQYDISGVPFGSRLASLNHHAGSLHFSPG----ADLSRTVVMIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELN++ + EY+ +   LGG+L LLP  F  +N    GG DV  E ++ +N+L ELE+L
Sbjct  84   VRELNISFVTEYVSRKHPLGGMLFLLPEIFRLEN--GGGGKDVR-EKEVVKNVLLELEKL  140

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H  +PYPVYFAFE+D I++VL D+K+ +DA GQPATATTGG+K V+
Sbjct  141  LVHAKLPYPVYFAFENDEIDAVLDDVKK-NDATGQPATATTGGYKLVI  187



>ref|XP_006424179.1| hypothetical protein CICLE_v10028115mg [Citrus clementina]
 gb|ESR37419.1| hypothetical protein CICLE_v10028115mg [Citrus clementina]
Length=561

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR+ASLNHHAGS   SPG    ADLSR+V+M+P
Sbjct  28   CVELCDAATVVDVYRLIQYDISGVPFGSRLASLNHHAGSLHFSPG----ADLSRTVVMIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELN++ + EY+ +   LGG+L LLP  F  +N    GG DV  E ++ +N+L ELE+L
Sbjct  84   VRELNISFVTEYVSRKHPLGGMLFLLPEIFRLEN--GGGGKDVR-EKEVVKNVLLELEKL  140

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H  +PYPVYFAFE+D I++VL D+K+ +DA GQPATATTGG+K V+
Sbjct  141  LVHAKLPYPVYFAFENDEIDAVLDDVKK-NDATGQPATATTGGYKLVI  187



>ref|XP_006481501.1| PREDICTED: nicalin-1-like [Citrus sinensis]
Length=561

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR+ASLNHHAGS   SPG    ADLSR+V+M+P
Sbjct  28   CVELCDAATVVDVYRLIQYDISGVPFGSRLASLNHHAGSLHFSPG----ADLSRTVVMIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            +RELN++ + EY+ +   LGG+L LLP  F  +N    GG DV  E ++ +N+L ELE+L
Sbjct  84   VRELNISFVTEYVSRKHPLGGMLFLLPEIFRLEN--GGGGMDVR-EKEVVKNVLLELEKL  140

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H  +PYPVYFAFE+D I++VL D+K+ +DA GQPATATTGG+K V+
Sbjct  141  LVHAKLPYPVYFAFENDEIDAVLDDVKK-NDATGQPATATTGGYKLVI  187



>ref|XP_009150276.1| PREDICTED: nicalin-1-like [Brassica rapa]
Length=562

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 121/168 (72%), Gaps = 11/168 (7%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            V+L DA   VDVYRLVQYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LPL
Sbjct  33   VDLCDAATVVDVYRLVQYDISGVPFGSRFSSLNHHAASLSFHRG----ADLSRSVLILPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            REL+L  +++YI Q + LGGLL+LLP    P      G   V SE    R +L +LE LL
Sbjct  89   RELDLGFLQDYISQKQSLGGLLILLPQTLRP------GNNIVLSETQRFRKLLAQLENLL  142

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  143  VHANIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  189



>emb|CDY30940.1| BnaA06g19730D [Brassica napus]
Length=562

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 120/168 (71%), Gaps = 11/168 (7%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            V+L DA   VDVYRLVQYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LPL
Sbjct  33   VDLCDAATVVDVYRLVQYDISGVPFGSRFSSLNHHAASLSFQRG----ADLSRSVLILPL  88

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLL  489
            REL+L  +++YI Q + LGGLL+LLP    P      G   V SE    R +L +LE LL
Sbjct  89   RELDLGFLQDYISQKQSLGGLLILLPQTLRP------GNNIVLSETQGFRKLLAQLENLL  142

Query  490  IHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            +H NIP+PVYFAFE++  +++L D+K+ +DALGQ ATATTGG+K V+S
Sbjct  143  VHANIPFPVYFAFENEETDAMLVDVKK-NDALGQQATATTGGYKLVIS  189



>ref|XP_008463652.1| PREDICTED: nicalin-1 [Cucumis melo]
Length=563

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR A+LNHHA SSL  P   S ADLSR+V+++P
Sbjct  28   CVELCDAATVVDVYRLIQYDISGVPFGSRAATLNHHA-SSLHFP---SGADLSRTVLIIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L EL +T ++E I Q K LGGLL+LLP     ++L        N E  + +++L ELE+L
Sbjct  84   LCELKMTFLQECISQKKRLGGLLVLLPRILGSESLKNDDIKCTNGE-GVIKDLLVELERL  142

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            LIH  IPYPVYFA + ++I++VLAD+K ++DA GQ ATATTGG+K VVSA
Sbjct  143  LIHSTIPYPVYFASDGEDIDAVLADVK-NNDATGQLATATTGGYKLVVSA  191



>ref|XP_008344934.1| PREDICTED: nicalin-1-like, partial [Malus domestica]
Length=522

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 118/155 (76%), Gaps = 7/155 (5%)
 Frame = +1

Query  172  LVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELNLTLIKEYIGQ  351
            L+QYD+SG P+GSR+A+LNHHAGS   +PG    +DLSR+V+++PLRELN++ + +YI Q
Sbjct  1    LIQYDISGAPFGSRLANLNHHAGSLHFAPG----SDLSRTVLIIPLRELNISFVTDYITQ  56

Query  352  NKllgglllllPPKFSPDNLDTA-GGADVNSEIDLTRNILNELEQLLIHVNIPYPVYFAF  528
             + LGGLL LLP  FS +N + A    + + E+ + +N L ELE+LLIH  IPYPVYFAF
Sbjct  57   KQPLGGLLFLLPQIFSIENRERATSNHZTDGEVPM-KNYLAELEKLLIHSKIPYPVYFAF  115

Query  529  EDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            EDD+  +VLAD+KR +D  GQPATATTGG+K VVS
Sbjct  116  EDDDXEAVLADVKR-NDVSGQPATATTGGYKLVVS  149



>ref|XP_004139498.1| PREDICTED: nicalin-like [Cucumis sativus]
 ref|XP_004169889.1| PREDICTED: nicalin-like [Cucumis sativus]
Length=563

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 120/170 (71%), Gaps = 6/170 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR A+LNHHA S     G    ADLSR+V+++P
Sbjct  28   CVELCDAATVVDVYRLIQYDISGVPFGSRAATLNHHASSLHFPTG----ADLSRTVLIIP  83

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L ELN+T ++E I Q K LGGLL+LLP     ++L        N E  + + +  ELE+L
Sbjct  84   LCELNMTFLQECISQKKRLGGLLVLLPRILGSESLKNDDIKCPNGE-GVIKGLSVELERL  142

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  IPYPVYFA E ++I++VLAD+K ++DA GQ ATATTGG+K VVSA
Sbjct  143  LVHSTIPYPVYFASEGEDIDAVLADVK-NNDATGQLATATTGGYKLVVSA  191



>gb|KGN64956.1| hypothetical protein Csa_1G167840 [Cucumis sativus]
Length=650

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 120/170 (71%), Gaps = 6/170 (4%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR A+LNHHA S     G    ADLSR+V+++P
Sbjct  115  CVELCDAATVVDVYRLIQYDISGVPFGSRAATLNHHASSLHFPTG----ADLSRTVLIIP  170

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L ELN+T ++E I Q K LGGLL+LLP     ++L        N E  + + +  ELE+L
Sbjct  171  LCELNMTFLQECISQKKRLGGLLVLLPRILGSESLKNDDIKCPNGE-GVIKGLSVELERL  229

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  IPYPVYFA E ++I++VLAD+K ++DA GQ ATATTGG+K VVSA
Sbjct  230  LVHSTIPYPVYFASEGEDIDAVLADVK-NNDATGQLATATTGGYKLVVSA  278



>ref|XP_009123309.1| PREDICTED: nicalin-1-like [Brassica rapa]
Length=563

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 124/169 (73%), Gaps = 11/169 (7%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LP
Sbjct  33   CVELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQHG----ADLSRSVLILP  88

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LREL++  +++YI Q + LGGLL+LLP  F P  +   GG +     D  R +L +LE+L
Sbjct  89   LRELDIAFVQDYISQKQSLGGLLILLPQTFRPGYI---GGGETQ---DGLRVLLAQLEKL  142

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  143  LLHSNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  190



>emb|CDY62392.1| BnaC03g74930D [Brassica napus]
Length=562

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 123/169 (73%), Gaps = 12/169 (7%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SG P+GSR +SLNHHA S     G    ADLSRSV++LP
Sbjct  33   CVELCDAATVVDVYRLIQYDISGAPFGSRFSSLNHHAASLSFQHG----ADLSRSVLILP  88

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LREL++  +++YI Q + LGGLL+LLP  F P N+   GG +        R +L +LE+L
Sbjct  89   LRELDIAFVQDYISQKQSLGGLLILLPQTFRPGNI---GGGETQG----LRILLAQLEKL  141

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+H NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  142  LLHGNIPFPVYFAFENEETDTMLADVKK-NDALGQQATATTGGYKLVIS  189



>ref|XP_010541265.1| PREDICTED: nicalin-1 [Tarenaya hassleriana]
 ref|XP_010541266.1| PREDICTED: nicalin-1 [Tarenaya hassleriana]
Length=567

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 124/169 (73%), Gaps = 8/169 (5%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR ASLNHHA S     G    ADLSRSV+++P
Sbjct  34   CVELCDAATVVDVYRLIQYDISGVPFGSRFASLNHHAASLSFQRG----ADLSRSVLLVP  89

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
             REL++  +++YI Q + LGGLL+LLP  FSP   +T+G +    E +  R +L ELE+L
Sbjct  90   FRELDVGFVRDYISQKQSLGGLLILLPQTFSP---ETSGSSSQFFETEGFRKLLAELEKL  146

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LIH +I YPVYFAFE++  ++VLAD+ + +DALGQ ATATTGG+K V+S
Sbjct  147  LIHGSIAYPVYFAFENEETDAVLADVVK-NDALGQHATATTGGYKLVIS  194



>emb|CDY47303.1| BnaA06g38990D [Brassica napus]
Length=563

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 123/169 (73%), Gaps = 11/169 (7%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYD+SGVP+GSR +SLNHHA S     G    ADLSRSV++LP
Sbjct  33   CVELCDAATVVDVYRLIQYDISGVPFGSRFSSLNHHAASLSFQHG----ADLSRSVLILP  88

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            LREL++  +++YI Q + LGGLL+LLP  F P  +   GG +    +   R +L +LE+L
Sbjct  89   LRELDIAFVQDYISQKQSLGGLLILLPQTFRPGYI---GGGETQEGL---RVLLAQLEKL  142

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            L+  NIP+PVYFAFE++  +++LAD+K+ +DALGQ ATATTGG+K V+S
Sbjct  143  LLRTNIPFPVYFAFENEETDAMLADVKK-NDALGQQATATTGGYKLVIS  190



>gb|AFW65052.1| hypothetical protein ZEAMMB73_261569 [Zea mays]
Length=502

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 112/170 (66%), Gaps = 13/170 (8%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A LNHHA    L  G    ADLSRS ++ P
Sbjct  24   CVELGDAAAAVSVYRLIQYDLAGAPLGSRAAVLNHHAAVLPLPAG----ADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP           G  D   +    + +L ELE+L
Sbjct  80   LLDLPLSFLREYLVEKKQLGGLLILLP--------TNQGDKDSADDKGQVKGVLTELEKL  131

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  +PYPVYFA +DDN  ++LADI +   + GQPA+ATTGG+K VVS+
Sbjct  132  LVHEQVPYPVYFALDDDNFGNLLADIHKIASS-GQPASATTGGYKLVVSS  180



>gb|AFW65051.1| hypothetical protein ZEAMMB73_261569, partial [Zea mays]
Length=517

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 112/170 (66%), Gaps = 13/170 (8%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A LNHHA    L  G    ADLSRS ++ P
Sbjct  24   CVELGDAAAAVSVYRLIQYDLAGAPLGSRAAVLNHHAAVLPLPAG----ADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP           G  D   +    + +L ELE+L
Sbjct  80   LLDLPLSFLREYLVEKKQLGGLLILLP--------TNQGDKDSADDKGQVKGVLTELEKL  131

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  +PYPVYFA +DDN  ++LADI +   + GQPA+ATTGG+K VVS+
Sbjct  132  LVHEQVPYPVYFALDDDNFGNLLADIHKIASS-GQPASATTGGYKLVVSS  180



>ref|NP_001147070.1| Nicalin precursor [Zea mays]
 gb|ACF87501.1| unknown [Zea mays]
 gb|ACG25361.1| nicalin precursor [Zea mays]
 gb|AFW65053.1| nicalin [Zea mays]
Length=552

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 112/170 (66%), Gaps = 13/170 (8%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A LNHHA    L  G    ADLSRS ++ P
Sbjct  24   CVELGDAAAAVSVYRLIQYDLAGAPLGSRAAVLNHHAAVLPLPAG----ADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP           G  D   +    + +L ELE+L
Sbjct  80   LLDLPLSFLREYLVEKKQLGGLLILLP--------TNQGDKDSADDKGQVKGVLTELEKL  131

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  +PYPVYFA +DDN  ++LADI +   + GQPA+ATTGG+K VVS+
Sbjct  132  LVHEQVPYPVYFALDDDNFGNLLADIHKIASS-GQPASATTGGYKLVVSS  180



>gb|ACL54544.1| unknown [Zea mays]
Length=552

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 112/170 (66%), Gaps = 13/170 (8%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A LNHHA    L  G    ADLSRS ++ P
Sbjct  24   CVELGDAAAAVSVYRLIQYDLAGAPLGSRAAVLNHHAAVLPLPAG----ADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP           G  D   +    + +L ELE+L
Sbjct  80   LLDLPLSFLREYLVEKKQLGGLLILLP--------TNQGDKDSADDKGQVKCVLTELEKL  131

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  +PYPVYFA +DDN  ++LADI +   + GQPA+ATTGG+K VVS+
Sbjct  132  LVHEQVPYPVYFALDDDNFGNLLADIHKIASS-GQPASATTGGYKLVVSS  180



>ref|XP_010234235.1| PREDICTED: nicalin [Brachypodium distachyon]
Length=555

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 10/168 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A+LNHHA +  L     + ADLSRS ++ P
Sbjct  24   CVELGDAAAAVGVYRLIQYDLAGAPLGSRAATLNHHAAALPLP----AGADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ +++Y+ + K LGGLL+LLP      NL    G + N +    + +L ELE+L
Sbjct  80   LLDLPLSFLRDYLAEKKHLGGLLILLP-----TNLSAKNGEENNDDKGQPKRVLAELEKL  134

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H  +PYPVYFAF DDN +++LADI++   + GQPA+A+TGG+K VV
Sbjct  135  LVHEEVPYPVYFAFHDDNFDNLLADIRKIASS-GQPASASTGGYKLVV  181



>ref|XP_004972399.1| PREDICTED: nicalin-like isoform X1 [Setaria italica]
Length=555

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 121/170 (71%), Gaps = 10/170 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A+LNHHA +  L PG    ADLSRS ++ P
Sbjct  24   CVELGDAAAAVSVYRLIQYDLAGAPLGSRSAALNHHAAALPLPPG----ADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP K S  +     G DV+      + +L ELE+L
Sbjct  80   LLDLPLSFLREYLVEKKHLGGLLILLPTKLSDKD---GTGNDVDR--GQVKGVLAELEKL  134

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  +PYPVYFAF DD+ +++LADI++   + GQPA+ATTGG+K VVS+
Sbjct  135  LVHEEVPYPVYFAFHDDDFDNLLADIRKIASS-GQPASATTGGYKLVVSS  183



>ref|XP_002444854.1| hypothetical protein SORBIDRAFT_07g000320 [Sorghum bicolor]
 gb|EES14349.1| hypothetical protein SORBIDRAFT_07g000320 [Sorghum bicolor]
Length=553

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 116/172 (67%), Gaps = 16/172 (9%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A +NHHA +  L     + ADLSRS ++ P
Sbjct  24   CVELGDAAAAVGVYRLIQYDLAGAPLGSRAAVINHHAAALPLP----AGADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEID--LTRNILNELE  480
            L +L L+ ++EY+ + K LGGLL+LLP         T  G D +S  D    + +L ELE
Sbjct  80   LLDLPLSFLREYLVEKKHLGGLLILLP---------TNRGGDKDSADDKGKVKGVLTELE  130

Query  481  QLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            +LL+H  +PYPVYFA  DD+ +++LADI +   + GQPA+ATTGG+K VVS+
Sbjct  131  KLLVHEQVPYPVYFALHDDSFDNLLADIHKIASS-GQPASATTGGYKLVVSS  181



>gb|AFW74195.1| hypothetical protein ZEAMMB73_534170, partial [Zea mays]
Length=222

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 116/170 (68%), Gaps = 17/170 (10%)
 Frame = +1

Query  130  VELGDAVAA-VDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
            VELGDA AA V VYRL+QYDL+G P GSR A LNHHA +  L     + ADLSRS ++ P
Sbjct  25   VELGDAAAAAVGVYRLIQYDLAGAPLGSRAAVLNHHAAALPLP----AGADLSRSALVAP  80

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP   + D++D  G           + +L ELE+L
Sbjct  81   LLDLPLSFLREYLVEKKHLGGLLILLPT--NNDSVDDKGQ---------FKGVLTELEKL  129

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  +PYPVYFA  DDN++++LADI R     GQPA+ATTGG+K VVS+
Sbjct  130  LLHEQVPYPVYFALHDDNLDNLLADIHRIAST-GQPASATTGGYKLVVSS  178



>ref|XP_002975196.1| hypothetical protein SELMODRAFT_102752 [Selaginella moellendorffii]
 gb|EFJ23981.1| hypothetical protein SELMODRAFT_102752 [Selaginella moellendorffii]
Length=555

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 113/170 (66%), Gaps = 16/170 (9%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            ++L DA +  DVYR +QYDL G+P GSR ASLNHHA S L  PG    +D++RSV++LP+
Sbjct  22   IDLCDAASVFDVYRAIQYDLRGIPMGSRRASLNHHASSGLSVPG----SDITRSVVILPI  77

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNE--LEQ  483
             ++N+TL+ EY+   ++LGGLLLLLP K         G  D N + D   N+  E  LE 
Sbjct  78   AKVNITLLNEYLQGKRILGGLLLLLPEK---------GHGDDNKDEDADENLQVERDLEN  128

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
             +I  N+PYPVYF +E  ++ ++L ++  ++D  G+PATATTGGFK VVS
Sbjct  129  WIIKNNVPYPVYFVYETPSLKALLDEVI-ANDLAGKPATATTGGFKLVVS  177



>ref|XP_002977600.1| hypothetical protein SELMODRAFT_106865 [Selaginella moellendorffii]
 gb|EFJ21604.1| hypothetical protein SELMODRAFT_106865 [Selaginella moellendorffii]
Length=547

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 113/170 (66%), Gaps = 16/170 (9%)
 Frame = +1

Query  130  VELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPL  309
            ++L DA +  DVYR +QYDL G+P GSR ASLNHHA S L  PG    +D++RSV++LP+
Sbjct  22   IDLCDAASVFDVYRAIQYDLRGIPMGSRRASLNHHASSGLSVPG----SDITRSVVILPI  77

Query  310  RELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNE--LEQ  483
             ++N+TL+ EY+   ++LGGLLLLLP K         G  D N + D   N+  E  LE 
Sbjct  78   AKVNITLLNEYLQGKRILGGLLLLLPEK---------GHGDDNKDEDADENLQVERDLEN  128

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
             +I  N+PYPVYF +E  ++ ++L ++  ++D  G+PATATTGGFK V+S
Sbjct  129  WIIKNNVPYPVYFVYETPSLKALLDEVI-ANDLAGKPATATTGGFKLVIS  177



>dbj|BAJ94473.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90738.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=555

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 10/168 (6%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A+LNHHA +  L  G    ADLSRS ++ P
Sbjct  24   CVELGDAAAAVGVYRLIQYDLAGAPLGSRAAALNHHAAAFPLPAG----ADLSRSALVAP  79

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP   S  N++  G  D   E    +N+L ELE+L
Sbjct  80   LLDLPLSFLREYLAEKKHLGGLLVLLPRNISAKNVE--GNNDDKGE---PKNVLAELEKL  134

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L+H  +P+PVYFAF D+N++++L DI++   + GQPA+A+TGG+K VV
Sbjct  135  LMHEEVPFPVYFAFHDENLDNLLEDIRKIASS-GQPASASTGGYKLVV  181



>gb|ACN25311.1| unknown [Zea mays]
 gb|AFW74196.1| nicalin [Zea mays]
Length=550

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 116/170 (68%), Gaps = 17/170 (10%)
 Frame = +1

Query  130  VELGDAVAA-VDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
            VELGDA AA V VYRL+QYDL+G P GSR A LNHHA +  L     + ADLSRS ++ P
Sbjct  25   VELGDAAAAAVGVYRLIQYDLAGAPLGSRAAVLNHHAAALPLP----AGADLSRSALVAP  80

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP   + D++D  G           + +L ELE+L
Sbjct  81   LLDLPLSFLREYLVEKKHLGGLLILLPT--NNDSVDDKGQ---------FKGVLTELEKL  129

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  +PYPVYFA  DDN++++LADI R     GQPA+ATTGG+K VVS+
Sbjct  130  LLHEQVPYPVYFALHDDNLDNLLADIHRIAST-GQPASATTGGYKLVVSS  178



>ref|NP_001060766.1| Os08g0102100 [Oryza sativa Japonica Group]
 dbj|BAD03560.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD33156.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22680.1| Os08g0102100 [Oryza sativa Japonica Group]
 dbj|BAG89235.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67893.1| hypothetical protein OsJ_25727 [Oryza sativa Japonica Group]
Length=555

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 17/171 (10%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GSR A+LNHHA +  L     + ADLSRS ++ P
Sbjct  27   CVELGDAAAAVGVYRLIQYDLAGAPLGSRAAALNHHAAALPLP----AAADLSRSALVAP  82

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFS--PDNLDTAGGADVNSEIDLTRNILNELE  480
            L +L L  +++Y+   K LGGLL+LLP K +  P+N D              +  L ELE
Sbjct  83   LLDLPLAFLRDYLADKKYLGGLLILLPKKLNHEPNNEDKGQ----------VKASLAELE  132

Query  481  QLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            QLL+H  +PYPVYFAF+DD+ +++LADI++   + GQPA+ATTGG+K VVS
Sbjct  133  QLLLHQQVPYPVYFAFQDDHFDNLLADIRKIASS-GQPASATTGGYKLVVS  182



>ref|NP_001150971.1| LOC100284604 precursor [Zea mays]
 gb|ACG41111.1| nicalin precursor [Zea mays]
Length=550

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 17/170 (10%)
 Frame = +1

Query  130  VELGDAVAA-VDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
            VELGDA AA V VYRL+QYDL+G P GSR A LNHHA +  L     + ADLSRS ++ P
Sbjct  25   VELGDAAAAAVGVYRLIQYDLAGAPLGSRAAVLNHHAAALPLP----AGADLSRSALVAP  80

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQL  486
            L +L L+ ++EY+ + K LGGLL+LLP   + D++D  G           + +L ELE+L
Sbjct  81   LLDLPLSFLREYLVEKKHLGGLLILLPT--NNDSVDDKGQ---------FKGVLTELEKL  129

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L+H  + YPVYFA  DDN++++LADI +     GQPA+ATTGG+K VVS+
Sbjct  130  LLHEQVSYPVYFALHDDNLDNLLADIHKIAST-GQPASATTGGYKLVVSS  178



>ref|XP_001784134.1| predicted protein [Physcomitrella patens]
 gb|EDQ51058.1| predicted protein [Physcomitrella patens]
Length=554

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 10/157 (6%)
 Frame = +1

Query  166  YRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELNLTLIKEYI  345
            YR++QYDL G P GSR A+LNHH  S      D   ADLSR+V++LP  ++N++ + E++
Sbjct  36   YRMIQYDLKGNPMGSRRAALNHHTVSGF----DVQGADLSRAVVILPALKVNISSLDEFV  91

Query  346  GQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVNIPYPVYFA  525
             QNK L G LLLL P+ S    D  GGA+ +   +     L ELEQ L+H    YPVYFA
Sbjct  92   -QNKGLLGGLLLLLPQRS----DETGGAEGDDSDEKVAKALAELEQWLVHNTFQYPVYFA  146

Query  526  FEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            +ED+N+  +L ++  SD A G+PA+AT GG+K VVSA
Sbjct  147  YEDENLLKLLHEVAASDAA-GRPASATNGGYKLVVSA  182



>ref|XP_006659731.1| PREDICTED: nicalin-like [Oryza brachyantha]
Length=557

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 119/170 (70%), Gaps = 12/170 (7%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VELGDA AAV VYRL+QYDL+G P GS  ASLNHHA +  L     + ADLSRS ++ P
Sbjct  26   CVELGDAAAAVGVYRLIQYDLAGAPLGSPAASLNHHAAALPLP----AGADLSRSALVAP  81

Query  307  LRELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSE-IDLTRNILNELEQ  483
            L +L L  ++EY+ + K LGGLL+LLP K + ++      A  NSE     ++ L ELE+
Sbjct  82   LLDLPLAFLREYLAEKKHLGGLLILLPKKLNDED------ASANSEGKGQVKSSLAELEK  135

Query  484  LLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            LL+H  +PYPVYFAF+DD+ +++L+DI++   + GQPA+ATTGG+K VVS
Sbjct  136  LLLHEEVPYPVYFAFQDDHFDNLLSDIRKIASS-GQPASATTGGYKLVVS  184



>ref|XP_009589240.1| PREDICTED: nicalin-1-like, partial [Nicotiana tomentosiformis]
Length=479

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = +1

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +++LI EYI Q KLLGGLLLLLPPK SP+NLD A GAD    I+   + L ELE+LL H 
Sbjct  5    SISLIAEYIEQKKLLGGLLLLLPPKLSPENLDNAFGAD--EGINSLMSKLAELERLLTHS  62

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            NIPYPVYFAFEDDNIN+VLA++KR +DA GQPATATTGG+K VV+A
Sbjct  63   NIPYPVYFAFEDDNINAVLAEVKR-NDASGQPATATTGGYKLVVAA  107



>ref|XP_010912332.1| PREDICTED: nicalin-like isoform X4 [Elaeis guineensis]
Length=488

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  451  LTRNILNELEQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVV  630
            L RNIL ELEQLLIH NIPYPVYFAFEDD IN+VLAD++R +DA GQP  ATTGG+K +V
Sbjct  56   LMRNILVELEQLLIHANIPYPVYFAFEDDKINAVLADVRR-NDATGQPPMATTGGYKLLV  114

Query  631  S  633
            S
Sbjct  115  S  115



>emb|CAN69050.1| hypothetical protein VITISV_001511 [Vitis vinifera]
Length=117

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 5/76 (7%)
 Frame = +1

Query  127  LVELGDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLP  306
             VEL DA   VDVYRL+QYDL+GVP+GSR+A+LNHHA S     G    ADLSR+V+++P
Sbjct  28   CVELCDAATVVDVYRLIQYDLAGVPFGSRLANLNHHAAS-----GFAPAADLSRTVVIVP  82

Query  307  LRELNLTLIKEYIGQN  354
            +R++N+T I     QN
Sbjct  83   VRDINITFIGGSTFQN  98



>gb|EEC82760.1| hypothetical protein OsI_27484 [Oryza sativa Indica Group]
Length=475

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  466  LNELEQLLIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
            L ELEQLL+H  +PYPVYFAF+DD+ +++LADI++   + GQPA+ATTGG+K VVS 
Sbjct  48   LAELEQLLLHQQVPYPVYFAFQDDHFDNLLADIRKIASS-GQPASATTGGYKLVVST  103



>gb|EMS68245.1| Nicalin-1 [Triticum urartu]
Length=591

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 103/190 (54%), Gaps = 52/190 (27%)
 Frame = +1

Query  187  LSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELNLTLIK----------  336
            L+G P GSR A+LNHHA +  L  G    ADLSRS ++ PL +L L+ ++          
Sbjct  94   LAGAPLGSRAAALNHHAAAFPLPAG----ADLSRSALVAPLLDLPLSFLRVLTNFCFITY  149

Query  337  --EYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVNIP-  507
              EY+ + K LGGLL+LLP   S  N++  G  D   E    +N+L ELE+LL+H  +P 
Sbjct  150  YSEYLAEKKHLGGLLILLPRNISAKNVE--GNNDDKGE---PKNVLAELEKLLMHEEVPS  204

Query  508  -----------------------------YPVYFAFEDDNINSVLADIKRSDDALGQPAT  600
                                         +PVYFAF DDN++++LADI++   + GQPA+
Sbjct  205  KCPASSLFSDQLFKYDIIFWLTHVHYSMQFPVYFAFHDDNLDNLLADIRKIASS-GQPAS  263

Query  601  ATTGGFKFVV  630
            A+TGG+K VV
Sbjct  264  ASTGGYKLVV  273



>ref|XP_009793459.1| PREDICTED: nicalin-1-like isoform X2 [Nicotiana sylvestris]
Length=472

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +1

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVSA  636
             I +++ YPVYFAFEDDNIN+VLA++KR +DA GQPATATTGG+K VV+A
Sbjct  52   WIPLSLKYPVYFAFEDDNINAVLAEVKR-NDASGQPATATTGGYKLVVAA  100



>gb|EMT04918.1| hypothetical protein F775_32982 [Aegilops tauschii]
Length=409

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 24/121 (20%)
 Frame = +1

Query  322  LTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVN  501
            +T   EY+ + K LGGLL+LLP   S  N++  G  D   E    +N+L ELE+LL+H  
Sbjct  24   ITYYSEYLAEKKHLGGLLILLPRNISAKNVE--GNNDDKGE---PKNVLAELEKLLMHEE  78

Query  502  IP------------------YPVYFAFEDDNINSVLADIKRSDDALGQPATATTGGFKFV  627
            +P                  +PVYFAF DDN++++LADI++   + GQPA+A+TGG+K V
Sbjct  79   VPLLTKLLFVLKHARFKLLLFPVYFAFHDDNLDNLLADIRKIASS-GQPASASTGGYKLV  137

Query  628  V  630
            V
Sbjct  138  V  138



>ref|XP_007896945.1| PREDICTED: nicalin [Callorhinchus milii]
Length=560

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 76/172 (44%), Gaps = 31/172 (18%)
 Frame = +1

Query  142  DAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFAD-LSRSVIMLPLREL  318
            +A     VYR+ QYDL G  YG+R A LN  A +          AD LSR  +++ L E 
Sbjct  38   EAAHEFTVYRMQQYDLQGQAYGTRNAMLNTEARTVE--------ADVLSRRCVIMRLAEF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    +E I Q+     ++L       P N+ T          D+ +  + E+E  L+  
Sbjct  90   SFEKFQEAIRQSAGAVVVIL-------PQNMSTMPQ-------DVIQQFM-EIEPELLAT  134

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+    K +  + G  +       TAT  GF+ V S
Sbjct  135  ETIVPVYFALEDDELLSIHDQTKAASVSQGTASAAEVLIHTATANGFQMVTS  186



>gb|ETE60869.1| Nicalin, partial [Ophiophagus hannah]
Length=226

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 74/158 (47%), Gaps = 24/158 (15%)
 Frame = +1

Query  163  VYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFAD-LSRSVIMLPLRELNLTLIKE  339
            VYR+ QY+L G PYG+R A LN  A +          AD LSR  +M+ L + +    ++
Sbjct  49   VYRMQQYELGGQPYGTRNAVLNTEARTVE--------ADVLSRRCVMIRLMDFSYEQYQK  100

Query  340  YIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVNIPYPVY  519
             + Q+     ++L       P N+ +          D+ R  + E+E  ++ +    PVY
Sbjct  101  ALRQSAGAVVIIL-------PHNMASVPQ-------DIIRQFM-EIEPEMLAMETIVPVY  145

Query  520  FAFEDDNINSVLADIKRSDDALGQPATATTGGFKFVVS  633
            FA EDD + S+    + +  + G  + A   GF+ V S
Sbjct  146  FAKEDDELLSIYEQTQAASASQGTASAAEANGFQMVTS  183



>gb|KFM78747.1| Nicalin-1, partial [Stegodyphus mimosarum]
Length=563

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 77/177 (44%), Gaps = 42/177 (24%)
 Frame = +1

Query  145  AVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELNL  324
            A     VYR+  +DL G P+G R + LN  A +   +P        +R  ++  L EL  
Sbjct  39   AAHEFTVYRMQHFDLHGTPHGCRSSILNMEAKTLYTTP-------YTRRCVVARLSELTF  91

Query  325  TLIKEYIGQNKllgglllllPPKFSPDNLDTAGG------ADVNSEIDLTRNILNELEQL  486
               +E I QN                     AGG      A+V+S     + ++ ELE+ 
Sbjct  92   AHYQEIIHQN---------------------AGGLLILISANVSSIPSSEQQVIMELEKH  130

Query  487  LIHVNIPYPVYFAFEDDNINSVLADIKRS--------DDALGQPATATTGGFKFVVS  633
            ++  ++  PVYFA+E + I  +   ++++          A   P++ T+ G++ VVS
Sbjct  131  MLEDDVTIPVYFAYETEEILDMYYSMEQTSPLQQKSRSAAEELPSSITSSGYQLVVS  187



>ref|XP_002606253.1| hypothetical protein BRAFLDRAFT_84005 [Branchiostoma floridae]
 gb|EEN62263.1| hypothetical protein BRAFLDRAFT_84005 [Branchiostoma floridae]
Length=557

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 78/170 (46%), Gaps = 30/170 (18%)
 Frame = +1

Query  142  DAVAAVDVYRLVQYDLSGVPYGSRIASLNHHA---GSSLLSPGDGSFADLSRSVIMLPLR  312
            +A     VYR+ Q+DL G  YG R A +N  A   G+S+          L+R  ++  L 
Sbjct  37   EAAHEFSVYRMQQFDLQGTSYGCRNAIVNMEARSLGASM----------LTRRCVVTRLA  86

Query  313  ELNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLI  492
            +L +   K+ + Q+     +LL       PD+L      ++   I+L  +++++      
Sbjct  87   DLTVDKFKDLVDQSAGAVLVLL-------PDDLSNVPRENLEEFIELEHDLMDQ------  133

Query  493  HVNIPYPVYFAFEDDNINSVLADIK--RSDDALGQPATATTGGFKFVVSA  636
              ++  PVYFA EDD +  + A I+   + D       A+  GF+ V +A
Sbjct  134  --DVNTPVYFAVEDDTLTKIYAAIQDGSNTDKAATATEASANGFQMVTTA  181



>ref|XP_008343403.1| PREDICTED: uncharacterized protein LOC103406172 [Malus domestica]
Length=342

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = -1

Query  419  AVSRLSGLNFGGSNNSKPPKSLFCPIYSLMRVRFSSRSGSMITDRDRSAKEPSPGDNNEE  240
             V  L+ L    S NSKPP+  F  +YS+     SS  G M T  +RS      G   +E
Sbjct  201  TVGYLATLAEIHSKNSKPPRGCFWVLYSVTXEMLSSCKGMMRTVXERS----ESGAKFKE  256

Query  239  PA*WLSEAMRDP*GTPERSYW  177
            PA WL  A RDP G PE SYW
Sbjct  257  PAWWLRLASRDPKGAPEMSYW  277



>ref|XP_009010054.1| hypothetical protein HELRODRAFT_71336 [Helobdella robusta]
 gb|ESO11566.1| hypothetical protein HELRODRAFT_71336 [Helobdella robusta]
Length=518

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 74/163 (45%), Gaps = 29/163 (18%)
 Frame = +1

Query  163  VYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELNLTLIKEY  342
            VYR+ Q+DL GV +G R A +N  A      P   S    +R  ++  L+EL  +  KE 
Sbjct  31   VYRMQQFDLQGVSHGCRNAIINVEA-----RPITASV--YTRKCVVSKLKELAFSKYKEI  83

Query  343  IGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVNIPYPVYF  522
            + QN     +LL       P   D     D    I+L   +L++  QL        PVYF
Sbjct  84   LQQNANGLLVLL-------PRTFDQISREDEEHLIELEHQLLSDETQL--------PVYF  128

Query  523  AFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVV  630
            A+EDD + ++  D+K   +A    +       ++   GF+F++
Sbjct  129  AYEDDKLLNIYEDLKSFGNADSAESALEAIVRSSNLYGFQFII  171



>ref|XP_002159640.2| PREDICTED: nicalin-1-like, partial [Hydra vulgaris]
Length=489

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 75/165 (45%), Gaps = 29/165 (18%)
 Frame = +1

Query  163  VYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLRELNLTLIKEY  342
            VYR+ QYDL G  YGSR AS+N  A  SL+S       +L R   ++ + +L +  +++ 
Sbjct  45   VYRMQQYDLYGAKYGSRSASINLEA-RSLISD------NLIRRCAVVRIAQLQIDQLQKA  97

Query  343  IGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHVNIPYPVYF  522
            I        +LL       P N++    A        T   +  LE  L+ V++P PVYF
Sbjct  98   ISDGLSALLILL-------PANIEKVSNA--------TLERIQYLENNLLQVDLPIPVYF  142

Query  523  AFEDDNINSVLADIKRS---DDAL----GQPATATTGGFKFVVSA  636
            + E D + S+  +I  S   D A        A A+   F F+  A
Sbjct  143  SHETDALKSLFEEITSSVHRDTATSAVKAMTAVASANSFHFLTDA  187



>ref|XP_006008163.1| PREDICTED: nicalin-like isoform X2 [Latimeria chalumnae]
Length=497

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 75/172 (44%), Gaps = 31/172 (18%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFAD-LSRSVIMLPLRE  315
             +A     VYR+ QYDL G PYG+R A LN  A +          AD LSR  I++ L +
Sbjct  38   AEAAHEFSVYRMQQYDLQGQPYGTRSAVLNTEARTVE--------ADVLSRRCILMRLLD  89

Query  316  LNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIH  495
             +    +  I Q+     ++L       P N+ +A   D+  +         E+E  L+ 
Sbjct  90   FSYEKYRNAIQQSAGAVLIML-------PQNM-SAMPQDIIQQ-------FMEIEPELLA  134

Query  496  VNIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVV  630
                 PVYFA ED+ + S+    + +  + G  +       TAT  GF+ V 
Sbjct  135  TETLVPVYFAVEDEALVSIYEQTRTASSSQGTASAAEVLLHTATANGFQMVT  186



>ref|XP_008289125.1| PREDICTED: nicalin isoform X4 [Stegastes partitus]
Length=577

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 29/172 (17%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
             +A     VYR+ QYDL G PYG+R A LN  A +            LSR  +++ L + 
Sbjct  37   AEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTV-------EAEVLSRRCVIMRLADF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    ++ + Q+     ++L       P N+            D+ +  + ELE  ++  
Sbjct  90   SYDKYQKALRQSAGAVVIIL-------PKNMSAVPQ-------DIVQQFM-ELEPEMLAT  134

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+      S  + G  +       TAT  GF+ V S
Sbjct  135  ETIVPVYFAMEDDELMSIYTQTLTSSSSQGALSAAEVLLHTATANGFQMVTS  186



>ref|XP_006008162.1| PREDICTED: nicalin-like isoform X1 [Latimeria chalumnae]
Length=498

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 75/172 (44%), Gaps = 31/172 (18%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFAD-LSRSVIMLPLRE  315
             +A     VYR+ QYDL G PYG+R A LN  A +          AD LSR  I++ L +
Sbjct  38   AEAAHEFSVYRMQQYDLQGQPYGTRSAVLNTEARTVE--------ADVLSRRCILMRLLD  89

Query  316  LNLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIH  495
             +    +  I Q+     ++L       P N+ +A   D+  +         E+E  L+ 
Sbjct  90   FSYEKYRNAIQQSAGAVLIML-------PQNM-SAMPQDIIQQ-------FMEIEPELLA  134

Query  496  VNIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVV  630
                 PVYFA ED+ + S+    + +  + G  +       TAT  GF+ V 
Sbjct  135  TETLVPVYFAVEDEALVSIYEQTRTASSSQGTASAAEVLLHTATANGFQMVT  186



>ref|XP_008289122.1| PREDICTED: nicalin isoform X2 [Stegastes partitus]
Length=580

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 29/172 (17%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
             +A     VYR+ QYDL G PYG+R A LN  A +            LSR  +++ L + 
Sbjct  37   AEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTV-------EAEVLSRRCVIMRLADF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    ++ + Q+     ++L       P N+            D+ +  + ELE  ++  
Sbjct  90   SYDKYQKALRQSAGAVVIIL-------PKNMSAVPQ-------DIVQQFM-ELEPEMLAT  134

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+      S  + G  +       TAT  GF+ V S
Sbjct  135  ETIVPVYFAMEDDELMSIYTQTLTSSSSQGALSAAEVLLHTATANGFQMVTS  186



>ref|XP_008289126.1| PREDICTED: nicalin isoform X5 [Stegastes partitus]
Length=576

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 29/172 (17%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
             +A     VYR+ QYDL G PYG+R A LN  A +            LSR  +++ L + 
Sbjct  37   AEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTV-------EAEVLSRRCVIMRLADF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    ++ + Q+     ++L       P N+            D+ +  + ELE  ++  
Sbjct  90   SYDKYQKALRQSAGAVVIIL-------PKNMSAVPQ-------DIVQQFM-ELEPEMLAT  134

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+      S  + G  +       TAT  GF+ V S
Sbjct  135  ETIVPVYFAMEDDELMSIYTQTLTSSSSQGALSAAEVLLHTATANGFQMVTS  186



>ref|XP_008289121.1| PREDICTED: nicalin isoform X1 [Stegastes partitus]
Length=581

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 29/172 (17%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
             +A     VYR+ QYDL G PYG+R A LN  A +            LSR  +++ L + 
Sbjct  37   AEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTV-------EAEVLSRRCVIMRLADF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    ++ + Q+     ++L       P N+            D+ +  + ELE  ++  
Sbjct  90   SYDKYQKALRQSAGAVVIIL-------PKNMSAVPQ-------DIVQQFM-ELEPEMLAT  134

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+      S  + G  +       TAT  GF+ V S
Sbjct  135  ETIVPVYFAMEDDELMSIYTQTLTSSSSQGALSAAEVLLHTATANGFQMVTS  186



>ref|XP_008289127.1| PREDICTED: nicalin isoform X6 [Stegastes partitus]
Length=565

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 29/172 (17%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
             +A     VYR+ QYDL G PYG+R A LN  A +            LSR  +++ L + 
Sbjct  37   AEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTV-------EAEVLSRRCVIMRLADF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    ++ + Q+     ++L       P N+            D+ +  + ELE  ++  
Sbjct  90   SYDKYQKALRQSAGAVVIIL-------PKNMSAVPQ-------DIVQQFM-ELEPEMLAT  134

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+      S  + G  +       TAT  GF+ V S
Sbjct  135  ETIVPVYFAMEDDELMSIYTQTLTSSSSQGALSAAEVLLHTATANGFQMVTS  186



>ref|XP_008289128.1| PREDICTED: nicalin isoform X7 [Stegastes partitus]
Length=561

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 29/172 (17%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
             +A     VYR+ QYDL G PYG+R A LN  A +            LSR  +++ L + 
Sbjct  37   AEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTV-------EAEVLSRRCVIMRLADF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    ++ + Q+     ++L       P N+            D+ +  + ELE  ++  
Sbjct  90   SYDKYQKALRQSAGAVVIIL-------PKNMSAVPQ-------DIVQQFM-ELEPEMLAT  134

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+      S  + G  +       TAT  GF+ V S
Sbjct  135  ETIVPVYFAMEDDELMSIYTQTLTSSSSQGALSAAEVLLHTATANGFQMVTS  186



>ref|XP_008289123.1| PREDICTED: nicalin isoform X3 [Stegastes partitus]
Length=580

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 70/172 (41%), Gaps = 30/172 (17%)
 Frame = +1

Query  139  GDAVAAVDVYRLVQYDLSGVPYGSRIASLNHHAGSSLLSPGDGSFADLSRSVIMLPLREL  318
             +A     VYR+ QYDL G PYG+R A LN  A +            LSR  +++ L + 
Sbjct  37   AEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTV-------EAEVLSRRCVIMRLADF  89

Query  319  NLTLIKEYIGQNKllgglllllPPKFSPDNLDTAGGADVNSEIDLTRNILNELEQLLIHV  498
            +    ++ + Q+     ++L       P N+       V            ELE  ++  
Sbjct  90   SYDKYQKALRQSAGAVVIIL-------PKNMSAVPQDIVQ---------FMELEPEMLAT  133

Query  499  NIPYPVYFAFEDDNINSVLADIKRSDDALGQPA-------TATTGGFKFVVS  633
                PVYFA EDD + S+      S  + G  +       TAT  GF+ V S
Sbjct  134  ETIVPVYFAMEDDELMSIYTQTLTSSSSQGALSAAEVLLHTATANGFQMVTS  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750