BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049F11

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080690.1|  PREDICTED: lysosomal beta glucosidase-like         202   2e-57   Sesamum indicum [beniseed]
gb|EPS66750.1|  hypothetical protein M569_08026                         197   2e-56   Genlisea aurea
emb|CDP09157.1|  unnamed protein product                                197   2e-55   Coffea canephora [robusta coffee]
ref|XP_009603386.1|  PREDICTED: lysosomal beta glucosidase-like         196   4e-55   Nicotiana tomentosiformis
ref|XP_004294237.1|  PREDICTED: lysosomal beta glucosidase-like         196   7e-55   Fragaria vesca subsp. vesca
ref|XP_007016180.1|  Glycosyl hydrolase family protein isoform 6        193   9e-55   
ref|XP_007016175.1|  Glycosyl hydrolase family protein isoform 1        193   7e-54   
ref|XP_007016177.1|  Glycosyl hydrolase family protein isoform 3        193   7e-54   
ref|NP_190284.1|  glycosyl hydrolase family protein                     192   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207129.1|  hypothetical protein PRUPE_ppa003012mg             192   1e-53   Prunus persica
ref|XP_008366241.1|  PREDICTED: lysosomal beta glucosidase-like i...    189   1e-53   
ref|XP_009794314.1|  PREDICTED: lysosomal beta glucosidase-like         192   1e-53   Nicotiana sylvestris
ref|XP_010426157.1|  PREDICTED: lysosomal beta glucosidase-like         192   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008220446.1|  PREDICTED: lysosomal beta glucosidase-like         192   2e-53   Prunus mume [ume]
ref|XP_006404423.1|  hypothetical protein EUTSA_v10010212mg             192   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_009149938.1|  PREDICTED: lysosomal beta glucosidase              191   3e-53   Brassica rapa
emb|CDX99072.1|  BnaA06g17630D                                          191   4e-53   
gb|KEH34189.1|  glycoside hydrolase family 3 protein                    191   5e-53   Medicago truncatula
ref|XP_006293189.1|  hypothetical protein CARUB_v10019506mg             191   6e-53   Capsella rubella
ref|XP_010426159.1|  PREDICTED: lysosomal beta glucosidase-like         190   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004241177.1|  PREDICTED: lysosomal beta glucosidase-like         189   1e-52   Solanum lycopersicum
ref|XP_010515030.1|  PREDICTED: lysosomal beta glucosidase-like         190   1e-52   Camelina sativa [gold-of-pleasure]
gb|EYU45973.1|  hypothetical protein MIMGU_mgv1a003210mg                189   1e-52   Erythranthe guttata [common monkey flower]
gb|KFK34020.1|  hypothetical protein AALP_AA5G091600                    189   2e-52   Arabis alpina [alpine rockcress]
ref|XP_008366240.1|  PREDICTED: lysosomal beta glucosidase-like i...    189   2e-52   
ref|XP_009149942.1|  PREDICTED: lysosomal beta glucosidase              189   3e-52   Brassica rapa
ref|XP_006350824.1|  PREDICTED: lysosomal beta glucosidase-like         189   3e-52   Solanum tuberosum [potatoes]
gb|AFM39013.1|  glycosyl hydrolase                                      189   3e-52   Sinapis alba [bai jie]
ref|XP_006290760.1|  hypothetical protein CARUB_v10016864mg             189   3e-52   Capsella rubella
emb|CDX99078.1|  BnaA06g17690D                                          189   3e-52   
ref|XP_006404420.1|  hypothetical protein EUTSA_v10010213mg             188   4e-52   Eutrema salsugineum [saltwater cress]
ref|XP_002525596.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    188   5e-52   Ricinus communis
ref|XP_002877538.1|  glycosyl hydrolase family 3 protein                187   8e-52   
ref|XP_011080849.1|  PREDICTED: lysosomal beta glucosidase-like i...    187   1e-51   Sesamum indicum [beniseed]
ref|XP_010535411.1|  PREDICTED: lysosomal beta glucosidase-like i...    187   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_008457398.1|  PREDICTED: lysosomal beta glucosidase-like i...    187   1e-51   
ref|XP_002877536.1|  glycosyl hydrolase family 3 protein                187   1e-51   Arabidopsis lyrata subsp. lyrata
emb|CDX86119.1|  BnaC03g56340D                                          187   1e-51   
ref|XP_004296697.1|  PREDICTED: lysosomal beta glucosidase-like i...    187   2e-51   Fragaria vesca subsp. vesca
ref|XP_009337307.1|  PREDICTED: lysosomal beta glucosidase-like         186   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_009346879.1|  PREDICTED: lysosomal beta glucosidase-like i...    186   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_010503321.1|  PREDICTED: lysosomal beta glucosidase-like         186   3e-51   
ref|XP_010650935.1|  PREDICTED: lysosomal beta glucosidase-like         186   3e-51   Vitis vinifera
gb|KFK34021.1|  hypothetical protein AALP_AA5G091700                    186   3e-51   Arabis alpina [alpine rockcress]
ref|NP_001190024.1|  Glycosyl hydrolase family protein                  186   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190288.1|  Glycosyl hydrolase family protein                     186   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010256652.1|  PREDICTED: lysosomal beta glucosidase-like i...    185   5e-51   Nelumbo nucifera [Indian lotus]
emb|CDX86116.1|  BnaC03g56310D                                          186   5e-51   
ref|XP_006425018.1|  hypothetical protein CICLE_v10028048mg             186   5e-51   Citrus clementina [clementine]
ref|XP_009346882.1|  PREDICTED: lysosomal beta glucosidase-like         185   7e-51   Pyrus x bretschneideri [bai li]
emb|CDX68425.1|  BnaC01g25030D                                          185   7e-51   
ref|XP_010043457.1|  PREDICTED: lysosomal beta glucosidase-like         185   8e-51   Eucalyptus grandis [rose gum]
ref|XP_002877537.1|  hydrolase, hydrolyzing O-glycosyl compounds        184   1e-50   
ref|XP_006849495.1|  hypothetical protein AMTR_s00024p00127570          173   1e-50   
gb|KHF98973.1|  Lysosomal beta glucosidase                              183   2e-50   Gossypium arboreum [tree cotton]
ref|NP_001190023.1|  glycosyl hydrolase family protein                  184   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KJB83716.1|  hypothetical protein B456_013G260700                    184   2e-50   Gossypium raimondii
ref|XP_009150614.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    183   2e-50   
ref|NP_190285.3|  glycosyl hydrolase family protein                     184   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66542.1|  hypothetical protein M569_08231                         180   2e-50   Genlisea aurea
gb|KJB83715.1|  hypothetical protein B456_013G260700                    184   3e-50   Gossypium raimondii
gb|KFK34022.1|  hypothetical protein AALP_AA5G091800                    187   3e-50   Arabis alpina [alpine rockcress]
gb|KHN26387.1|  Lysosomal beta glucosidase                              183   4e-50   Glycine soja [wild soybean]
ref|XP_006591200.1|  PREDICTED: lysosomal beta glucosidase-like         183   4e-50   Glycine max [soybeans]
ref|XP_010256653.1|  PREDICTED: lysosomal beta glucosidase-like i...    182   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_011032150.1|  PREDICTED: lysosomal beta glucosidase-like         183   5e-50   Populus euphratica
ref|XP_004150629.1|  PREDICTED: lysosomal beta glucosidase-like         182   7e-50   
ref|XP_010256654.1|  PREDICTED: lysosomal beta glucosidase-like i...    182   7e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010686158.1|  PREDICTED: lysosomal beta glucosidase-like         185   9e-50   
ref|XP_004500232.1|  PREDICTED: lysosomal beta glucosidase-like         182   1e-49   Cicer arietinum [garbanzo]
ref|XP_010256651.1|  PREDICTED: lysosomal beta glucosidase-like i...    182   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010541442.1|  PREDICTED: lysosomal beta glucosidase-like         181   2e-49   Tarenaya hassleriana [spider flower]
gb|KFK26304.1|  hypothetical protein AALP_AA8G230300                    171   2e-49   Arabis alpina [alpine rockcress]
ref|XP_009757149.1|  PREDICTED: lysosomal beta glucosidase-like         181   2e-49   Nicotiana sylvestris
ref|XP_006344039.1|  PREDICTED: lysosomal beta glucosidase-like         181   3e-49   Solanum tuberosum [potatoes]
ref|XP_009610986.1|  PREDICTED: lysosomal beta glucosidase-like         181   3e-49   Nicotiana tomentosiformis
gb|KDP46532.1|  hypothetical protein JCGZ_08504                         180   4e-49   Jatropha curcas
ref|XP_002877539.1|  glycosyl hydrolase family 3 protein                179   1e-48   Arabidopsis lyrata subsp. lyrata
gb|KGN65790.1|  hypothetical protein Csa_1G528550                       179   1e-48   Cucumis sativus [cucumbers]
emb|CDP09158.1|  unnamed protein product                                179   1e-48   Coffea canephora [robusta coffee]
ref|XP_004169524.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    179   1e-48   
ref|XP_004150625.1|  PREDICTED: lysosomal beta glucosidase-like         179   1e-48   
ref|XP_008457393.1|  PREDICTED: lysosomal beta glucosidase-like i...    179   1e-48   Cucumis melo [Oriental melon]
emb|CDP22140.1|  unnamed protein product                                167   2e-48   Coffea canephora [robusta coffee]
gb|EYU45756.1|  hypothetical protein MIMGU_mgv1a003116mg                178   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_011016630.1|  PREDICTED: lysosomal beta glucosidase-like         170   2e-48   Populus euphratica
ref|XP_008457394.1|  PREDICTED: lysosomal beta glucosidase-like i...    178   2e-48   
ref|XP_009395658.1|  PREDICTED: lysosomal beta glucosidase-like         178   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADC55526.1|  beta-D-glucan glucohydrolase precursor                  178   3e-48   synthetic construct
pdb|1LQ2|A  Chain A, Crystal Structure Of Barley Beta-D-Glucan Gl...    178   3e-48   Hordeum vulgare [barley]
ref|XP_006445677.1|  hypothetical protein CICLE_v100182712mg            171   3e-48   
pdb|1EX1|A  Chain A, Beta-D-Glucan Exohydrolase From Barley             178   3e-48   Hordeum vulgare [barley]
dbj|BAK05680.1|  predicted protein                                      178   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006290765.1|  hypothetical protein CARUB_v10016871mg             177   3e-48   
gb|AAD23382.1|AF102868_1  beta-D-glucan exohydrolase isoenzyme ExoI     178   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96045.1|  predicted protein                                      178   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006495449.1|  PREDICTED: lysosomal beta glucosidase-like         170   5e-48   Citrus sinensis [apfelsine]
ref|XP_004172885.1|  PREDICTED: lysosomal beta glucosidase-like         169   5e-48   
gb|EMS53026.1|  Lysosomal beta glucosidase                              177   5e-48   Triticum urartu
ref|XP_009622673.1|  PREDICTED: lysosomal beta glucosidase-like         177   6e-48   Nicotiana tomentosiformis
gb|EMT26942.1|  Periplasmic beta-glucosidase                            176   7e-48   
ref|XP_008446716.1|  PREDICTED: lysosomal beta glucosidase isofor...    177   1e-47   Cucumis melo [Oriental melon]
ref|XP_010493212.1|  PREDICTED: lysosomal beta glucosidase-like         176   1e-47   Camelina sativa [gold-of-pleasure]
dbj|BAJ97948.1|  predicted protein                                      176   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002313393.1|  glycosyl hydrolase family 3 family protein         176   2e-47   
gb|AFW67618.1|  hypothetical protein ZEAMMB73_549956                    166   2e-47   
ref|XP_004236622.1|  PREDICTED: lysosomal beta glucosidase-like         176   2e-47   Solanum lycopersicum
emb|CDP21297.1|  unnamed protein product                                171   3e-47   Coffea canephora [robusta coffee]
ref|XP_008344987.1|  PREDICTED: lysosomal beta glucosidase-like         167   3e-47   
ref|XP_007206306.1|  hypothetical protein PRUPE_ppa025914mg             175   3e-47   
emb|CDP10536.1|  unnamed protein product                                165   3e-47   Coffea canephora [robusta coffee]
ref|XP_007016181.1|  Glycosyl hydrolase family protein                  175   3e-47   
ref|XP_006350208.1|  PREDICTED: lysosomal beta glucosidase-like         175   4e-47   Solanum tuberosum [potatoes]
gb|EMS53504.1|  Lysosomal beta glucosidase                              174   6e-47   Triticum urartu
ref|XP_008446717.1|  PREDICTED: lysosomal beta glucosidase isofor...    174   6e-47   Cucumis melo [Oriental melon]
ref|XP_010456613.1|  PREDICTED: lysosomal beta glucosidase-like         174   7e-47   
gb|ACR35273.1|  unknown                                                 166   8e-47   Zea mays [maize]
ref|XP_010908052.1|  PREDICTED: lysosomal beta glucosidase-like i...    174   8e-47   Elaeis guineensis
ref|XP_010420941.1|  PREDICTED: lysosomal beta glucosidase-like         174   8e-47   
gb|EPS72736.1|  hypothetical protein M569_02021                         174   9e-47   Genlisea aurea
ref|XP_008230878.1|  PREDICTED: lysosomal beta glucosidase-like         174   1e-46   Prunus mume [ume]
ref|XP_010229891.1|  PREDICTED: lysosomal beta glucosidase-like i...    174   1e-46   Brachypodium distachyon [annual false brome]
ref|XP_010923121.1|  PREDICTED: lysosomal beta glucosidase-like         173   1e-46   Elaeis guineensis
ref|XP_003559552.1|  PREDICTED: lysosomal beta glucosidase-like i...    173   1e-46   
ref|XP_006286473.1|  hypothetical protein CARUB_v10000466mg             173   2e-46   Capsella rubella
ref|XP_010253611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    177   2e-46   
ref|XP_009412935.1|  PREDICTED: lysosomal beta glucosidase-like         173   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN81230.1|  hypothetical protein VITISV_033665                     173   2e-46   Vitis vinifera
ref|XP_006400663.1|  hypothetical protein EUTSA_v10015493mg             163   2e-46   
ref|XP_004135054.1|  PREDICTED: lysosomal beta glucosidase-like         172   3e-46   Cucumis sativus [cucumbers]
ref|NP_001078254.1|  glycosyl hydrolase family protein                  170   3e-46   
gb|ABF98889.1|  Glycosyl hydrolase family 3 N terminal domain con...    169   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004159282.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    172   3e-46   
dbj|BAF00158.1|  beta-D-glucan exohydrolase - like protein              170   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EYU39164.1|  hypothetical protein MIMGU_mgv1a019891mg                168   4e-46   Erythranthe guttata [common monkey flower]
ref|XP_010452390.1|  PREDICTED: lysosomal beta glucosidase-like         172   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008240500.1|  PREDICTED: lysosomal beta glucosidase-like         172   5e-46   Prunus mume [ume]
emb|CDP15627.1|  unnamed protein product                                171   7e-46   Coffea canephora [robusta coffee]
ref|XP_010923122.1|  PREDICTED: lysosomal beta glucosidase-like         171   1e-45   Elaeis guineensis
ref|XP_007204092.1|  hypothetical protein PRUPE_ppa002894mg             171   1e-45   
ref|XP_004981777.1|  PREDICTED: lysosomal beta glucosidase-like         170   2e-45   Setaria italica
gb|AFW78103.1|  hypothetical protein ZEAMMB73_707266                    162   2e-45   
gb|KDO52251.1|  hypothetical protein CISIN_1g036635mg                   169   2e-45   Citrus sinensis [apfelsine]
ref|XP_006826369.1|  hypothetical protein AMTR_s00004p00131000          170   2e-45   
ref|XP_008791332.1|  PREDICTED: uncharacterized protein LOC103708265    166   2e-45   
ref|XP_010694376.1|  PREDICTED: lysosomal beta glucosidase              170   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002874025.1|  glycosyl hydrolase family 3 protein                170   2e-45   
gb|EPS66822.1|  hypothetical protein M569_07948                         170   2e-45   Genlisea aurea
ref|NP_197595.2|  glycosyl hydrolase family protein                     170   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KEH25593.1|  beta-D-glucoside glucohydrolase                         170   2e-45   Medicago truncatula
ref|XP_006485566.1|  PREDICTED: lysosomal beta glucosidase-like         170   2e-45   Citrus sinensis [apfelsine]
ref|XP_004173167.1|  PREDICTED: lysosomal beta glucosidase-like         166   2e-45   
ref|XP_004981771.1|  PREDICTED: lysosomal beta glucosidase-like i...    170   2e-45   Setaria italica
gb|AAR14129.1|  exo-beta-glucanase                                      170   2e-45   Lilium longiflorum [Easter lily]
ref|XP_004981770.1|  PREDICTED: lysosomal beta glucosidase-like i...    170   2e-45   Setaria italica
ref|XP_008363217.1|  PREDICTED: lysosomal beta glucosidase-like         170   2e-45   
ref|XP_004981769.1|  PREDICTED: lysosomal beta glucosidase-like i...    170   3e-45   
ref|XP_008785418.1|  PREDICTED: lysosomal beta glucosidase-like         169   3e-45   Phoenix dactylifera
ref|XP_004981768.1|  PREDICTED: lysosomal beta glucosidase-like i...    170   3e-45   
gb|EYU39163.1|  hypothetical protein MIMGU_mgv1a020896mg                167   3e-45   Erythranthe guttata [common monkey flower]
ref|XP_006445675.1|  hypothetical protein CICLE_v10017853mg             169   3e-45   Citrus clementina [clementine]
ref|XP_010558244.1|  PREDICTED: lysosomal beta glucosidase              169   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_009126493.1|  PREDICTED: lysosomal beta glucosidase-like         169   4e-45   Brassica rapa
ref|NP_190289.1|  glycosyl hydrolase family protein                     169   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391778.1|  PREDICTED: lysosomal beta glucosidase-like         171   4e-45   
gb|KHN14336.1|  Lysosomal beta glucosidase                              169   4e-45   Glycine soja [wild soybean]
ref|XP_010454410.1|  PREDICTED: lysosomal beta glucosidase-like         166   4e-45   
ref|XP_009395659.1|  PREDICTED: lysosomal beta glucosidase-like         169   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB35517.1|  hypothetical protein B456_006G118100                    166   5e-45   Gossypium raimondii
ref|XP_011094168.1|  PREDICTED: lysosomal beta glucosidase-like         169   5e-45   
ref|XP_006650588.1|  PREDICTED: lysosomal beta glucosidase-like         169   6e-45   
ref|XP_006400664.1|  hypothetical protein EUTSA_v10012963mg             169   6e-45   Eutrema salsugineum [saltwater cress]
ref|XP_006398941.1|  hypothetical protein EUTSA_v10012900mg             169   6e-45   Eutrema salsugineum [saltwater cress]
gb|KJB35515.1|  hypothetical protein B456_006G118100                    166   6e-45   Gossypium raimondii
emb|CAA07070.1|  beta-D-glucosidase                                     169   7e-45   Tropaeolum majus
ref|XP_006848113.1|  hypothetical protein AMTR_s00029p00216320          168   8e-45   Amborella trichopoda
ref|XP_003601350.1|  Beta-D-glucosidase                                 168   8e-45   Medicago truncatula
ref|XP_002319151.2|  beta-D-glucan exohydrolase family protein          168   8e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006379440.1|  hypothetical protein POPTR_0008s01410g             168   8e-45   
ref|XP_006290328.1|  hypothetical protein CARUB_v10016857mg             168   8e-45   Capsella rubella
ref|XP_003545548.1|  PREDICTED: lysosomal beta glucosidase-like         168   9e-45   Glycine max [soybeans]
ref|NP_680141.2|  Glycosyl hydrolase family protein                     168   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120747.1|  PREDICTED: lysosomal beta glucosidase-like         168   9e-45   Brassica rapa
ref|XP_006575593.1|  PREDICTED: lysosomal beta glucosidase-like i...    167   9e-45   
ref|XP_010067089.1|  PREDICTED: lysosomal beta glucosidase              168   9e-45   
ref|XP_007147489.1|  hypothetical protein PHAVU_006G128800g             168   9e-45   Phaseolus vulgaris [French bean]
dbj|BAD13764.1|  exo-1,3-beta-glucanase                                 168   9e-45   Lilium longiflorum [Easter lily]
ref|XP_006424024.1|  hypothetical protein CICLE_v10028018mg             168   1e-44   Citrus clementina [clementine]
ref|XP_008230928.1|  PREDICTED: lysosomal beta glucosidase-like         159   1e-44   
ref|XP_004137360.1|  PREDICTED: lysosomal beta glucosidase-like         168   1e-44   Cucumis sativus [cucumbers]
ref|XP_006487803.1|  PREDICTED: lysosomal beta glucosidase-like i...    168   1e-44   Citrus sinensis [apfelsine]
gb|KDO54375.1|  hypothetical protein CISIN_1g006872mg                   168   1e-44   Citrus sinensis [apfelsine]
gb|KEH25594.1|  beta-D-glucoside glucohydrolase                         168   1e-44   Medicago truncatula
ref|XP_003546253.1|  PREDICTED: lysosomal beta glucosidase-like i...    168   1e-44   
ref|NP_001051277.1|  Os03g0749500                                       168   1e-44   
ref|XP_008453517.1|  PREDICTED: lysosomal beta glucosidase-like         168   1e-44   Cucumis melo [Oriental melon]
ref|XP_006287219.1|  hypothetical protein CARUB_v10000396mg             168   1e-44   Capsella rubella
ref|XP_002871119.1|  glycosyl hydrolase family 3 protein                168   1e-44   
gb|AAL58976.1|AC091811_25  putative exohydrolase                        168   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009368634.1|  PREDICTED: lysosomal beta glucosidase-like         167   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_006575592.1|  PREDICTED: lysosomal beta glucosidase-like i...    167   1e-44   
gb|KDP34274.1|  hypothetical protein JCGZ_12843                         167   2e-44   Jatropha curcas
emb|CDY09090.1|  BnaA02g05160D                                          167   2e-44   Brassica napus [oilseed rape]
emb|CBI39076.3|  unnamed protein product                                167   2e-44   Vitis vinifera
ref|XP_004300933.2|  PREDICTED: lysosomal beta glucosidase-like i...    167   2e-44   Fragaria vesca subsp. vesca
ref|XP_002325849.2|  beta-D-glucan exohydrolase family protein          167   2e-44   
gb|ABK95015.1|  unknown                                                 167   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011464064.1|  PREDICTED: lysosomal beta glucosidase-like i...    167   2e-44   Fragaria vesca subsp. vesca
gb|KHN38459.1|  Lysosomal beta glucosidase                              167   2e-44   Glycine soja [wild soybean]
ref|XP_006371173.1|  hypothetical protein POPTR_0019s05340g             167   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_003519468.1|  PREDICTED: lysosomal beta glucosidase-like i...    167   2e-44   Glycine max [soybeans]
ref|XP_010917877.1|  PREDICTED: lysosomal beta glucosidase-like i...    166   2e-44   
ref|XP_010653212.1|  PREDICTED: lysosomal beta glucosidase-like i...    167   3e-44   Vitis vinifera
ref|XP_008231858.1|  PREDICTED: lysosomal beta glucosidase isofor...    167   3e-44   Prunus mume [ume]
emb|CDY11314.1|  BnaA03g01500D                                          167   3e-44   Brassica napus [oilseed rape]
ref|XP_002266470.2|  PREDICTED: lysosomal beta glucosidase-like i...    167   3e-44   Vitis vinifera
ref|XP_009130844.1|  PREDICTED: lysosomal beta glucosidase-like         167   3e-44   Brassica rapa
ref|XP_011094175.1|  PREDICTED: lysosomal beta glucosidase-like         167   3e-44   
ref|XP_007010543.1|  Glycosyl hydrolase family protein isoform 2        167   3e-44   
gb|KHN22996.1|  Lysosomal beta glucosidase                              167   3e-44   Glycine soja [wild soybean]
ref|XP_008231857.1|  PREDICTED: lysosomal beta glucosidase isofor...    167   3e-44   Prunus mume [ume]
ref|XP_007010542.1|  Glycosyl hydrolase family protein isoform 1        167   3e-44   
gb|KEH25595.1|  beta-D-glucoside glucohydrolase                         167   3e-44   Medicago truncatula
ref|XP_010917875.1|  PREDICTED: lysosomal beta glucosidase-like i...    166   4e-44   Elaeis guineensis
emb|CDX80926.1|  BnaC03g01800D                                          167   4e-44   
ref|XP_008355265.1|  PREDICTED: lysosomal beta glucosidase-like         166   4e-44   
emb|CDX99071.1|  BnaA06g17620D                                          167   4e-44   
ref|XP_010088030.1|  Lysosomal beta glucosidase                         166   4e-44   
gb|KHG17515.1|  gluA                                                    160   4e-44   Gossypium arboreum [tree cotton]
ref|XP_009804819.1|  PREDICTED: lysosomal beta glucosidase-like         166   4e-44   Nicotiana sylvestris
ref|XP_010535771.1|  PREDICTED: lysosomal beta glucosidase-like         166   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_006651822.1|  PREDICTED: lysosomal beta glucosidase-like         166   4e-44   
gb|KJB55533.1|  hypothetical protein B456_009G081100                    166   4e-44   Gossypium raimondii
gb|KHG30203.1|  Lysosomal beta glucosidase                              166   4e-44   Gossypium arboreum [tree cotton]
ref|XP_009342674.1|  PREDICTED: lysosomal beta glucosidase-like         166   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_006644778.1|  PREDICTED: lysosomal beta glucosidase-like         166   5e-44   Oryza brachyantha
ref|XP_008672748.1|  PREDICTED: uncharacterized protein LOC100280...    165   5e-44   
ref|XP_002514453.1|  Periplasmic beta-glucosidase precursor, puta...    166   5e-44   
ref|XP_002313632.1|  beta-D-glucan exohydrolase family protein          166   5e-44   
gb|KHN45535.1|  Lysosomal beta glucosidase                              166   5e-44   Glycine soja [wild soybean]
ref|XP_002466456.1|  hypothetical protein SORBIDRAFT_01g008050          166   5e-44   Sorghum bicolor [broomcorn]
ref|NP_001051274.1|  Os03g0749100                                       166   5e-44   
gb|KEH25596.1|  beta-D-glucoside glucohydrolase                         166   5e-44   Medicago truncatula
ref|XP_008385601.1|  PREDICTED: lysosomal beta glucosidase-like         166   5e-44   
ref|XP_010103976.1|  Lysosomal beta glucosidase                         166   6e-44   
ref|XP_004141202.1|  PREDICTED: lysosomal beta glucosidase-like         166   6e-44   
gb|EYU26866.1|  hypothetical protein MIMGU_mgv1a002476mg                166   6e-44   Erythranthe guttata [common monkey flower]
ref|XP_006379343.1|  hypothetical protein POPTR_0009s15590g             166   6e-44   Populus trichocarpa [western balsam poplar]
gb|KJB44566.1|  hypothetical protein B456_007G260100                    166   6e-44   Gossypium raimondii
gb|EAY91867.1|  hypothetical protein OsI_13514                          166   6e-44   Oryza sativa Indica Group [Indian rice]
gb|EYU18175.1|  hypothetical protein MIMGU_mgv1a002782mg                166   7e-44   Erythranthe guttata [common monkey flower]
ref|XP_011032947.1|  PREDICTED: lysosomal beta glucosidase              166   7e-44   Populus euphratica
ref|XP_011021458.1|  PREDICTED: lysosomal beta glucosidase-like         166   8e-44   Populus euphratica
ref|XP_004228467.1|  PREDICTED: lysosomal beta glucosidase-like i...    166   8e-44   Solanum lycopersicum
gb|KJB35516.1|  hypothetical protein B456_006G118100                    166   8e-44   Gossypium raimondii
ref|XP_007151483.1|  hypothetical protein PHAVU_004G050500g             166   8e-44   Phaseolus vulgaris [French bean]
ref|XP_003535075.1|  PREDICTED: lysosomal beta glucosidase-like i...    166   9e-44   Glycine max [soybeans]
gb|AAQ17461.1|  beta-D-glucosidase                                      165   9e-44   Gossypium hirsutum [American cotton]
ref|XP_004981774.1|  PREDICTED: lysosomal beta glucosidase-like i...    165   1e-43   
ref|WP_043183408.1|  beta-glucosidase                                   166   1e-43   Streptomyces sp. NRRL F-5123
tpg|DAA51364.1|  TPA: hypothetical protein ZEAMMB73_928187              164   1e-43   
ref|XP_008648088.1|  PREDICTED: LOC541703 isoform X2                    165   1e-43   
gb|AFW78104.1|  hypothetical protein ZEAMMB73_709532                    164   1e-43   
ref|XP_004489688.1|  PREDICTED: lysosomal beta glucosidase-like         165   1e-43   
ref|XP_003535890.1|  PREDICTED: lysosomal beta glucosidase              165   1e-43   
ref|XP_008648090.1|  PREDICTED: LOC541703 isoform X1                    165   1e-43   
ref|XP_001781708.1|  predicted protein                                  165   1e-43   
ref|XP_007141605.1|  hypothetical protein PHAVU_008G210100g             165   1e-43   Phaseolus vulgaris [French bean]
tpg|DAA51354.1|  TPA: exhydrolase II                                    165   1e-43   
gb|KGN59736.1|  hypothetical protein Csa_3G842090                       165   1e-43   Cucumis sativus [cucumbers]
gb|KJB80773.1|  hypothetical protein B456_013G114800                    162   1e-43   Gossypium raimondii
tpg|DAA51353.1|  TPA: exhydrolase II                                    165   1e-43   
gb|AIO11756.1|  beta-glucosidase                                        165   1e-43   Glycine max [soybeans]
ref|XP_011087395.1|  PREDICTED: lysosomal beta glucosidase-like         165   1e-43   Sesamum indicum [beniseed]
ref|XP_010423523.1|  PREDICTED: lysosomal beta glucosidase-like i...    165   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003559555.1|  PREDICTED: lysosomal beta glucosidase-like         164   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_011089012.1|  PREDICTED: lysosomal beta glucosidase-like         165   2e-43   
gb|EMS62631.1|  Lysosomal beta glucosidase                              163   2e-43   Triticum urartu
ref|XP_004490576.1|  PREDICTED: lysosomal beta glucosidase-like         164   2e-43   Cicer arietinum [garbanzo]
ref|XP_007220111.1|  hypothetical protein PRUPE_ppa021476mg             156   2e-43   
ref|XP_006289165.1|  hypothetical protein CARUB_v10002603mg             164   2e-43   
emb|CDM84404.1|  unnamed protein product                                165   2e-43   
ref|NP_001104913.1|  LOC541703 precursor                                164   2e-43   
ref|XP_002311926.2|  beta-D-glucan exohydrolase family protein          164   2e-43   
ref|XP_010423522.1|  PREDICTED: lysosomal beta glucosidase-like i...    165   2e-43   
ref|XP_010423524.1|  PREDICTED: lysosomal beta glucosidase-like i...    164   2e-43   
gb|KHN20835.1|  Lysosomal beta glucosidase                              164   2e-43   
ref|XP_003551104.1|  PREDICTED: lysosomal beta glucosidase-like         164   2e-43   
gb|EMS60525.1|  Lysosomal beta glucosidase                              164   2e-43   
ref|XP_006367581.1|  PREDICTED: lysosomal beta glucosidase-like         164   3e-43   
ref|XP_010313473.1|  PREDICTED: lysosomal beta glucosidase isofor...    164   3e-43   
ref|XP_004306422.2|  PREDICTED: lysosomal beta glucosidase-like         164   3e-43   
gb|EMT23539.1|  Lysosomal beta glucosidase                              164   3e-43   
ref|XP_009614218.1|  PREDICTED: lysosomal beta glucosidase-like         164   3e-43   
ref|XP_004251206.1|  PREDICTED: lysosomal beta glucosidase isofor...    164   3e-43   
ref|XP_004502135.1|  PREDICTED: lysosomal beta glucosidase-like         164   3e-43   
ref|XP_008672746.1|  PREDICTED: uncharacterized protein LOC100280...    164   3e-43   
tpg|DAA57426.1|  TPA: hypothetical protein ZEAMMB73_853432              164   3e-43   
ref|XP_010313472.1|  PREDICTED: lysosomal beta glucosidase isofor...    164   3e-43   
ref|WP_034592783.1|  beta-glucosidase                                   164   3e-43   
ref|XP_011032946.1|  PREDICTED: lysosomal beta glucosidase-like         164   3e-43   
ref|XP_006445672.1|  hypothetical protein CICLE_v10014537mg             162   3e-43   
ref|XP_010677827.1|  PREDICTED: lysosomal beta glucosidase-like         164   3e-43   
ref|NP_001145784.1|  hypothetical protein                               164   3e-43   
ref|XP_004295138.1|  PREDICTED: lysosomal beta glucosidase-like         164   3e-43   
ref|XP_009394272.1|  PREDICTED: lysosomal beta glucosidase-like         164   4e-43   
ref|XP_004172932.1|  PREDICTED: lysosomal beta glucosidase-like         159   4e-43   
gb|EPS62891.1|  hypothetical protein M569_11897                         163   4e-43   
ref|XP_002523937.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    163   5e-43   
gb|KJB44572.1|  hypothetical protein B456_007G260000                    163   5e-43   
ref|WP_033173156.1|  beta-glucosidase                                   164   6e-43   
gb|EMT13488.1|  Lysosomal beta glucosidase                              163   6e-43   
ref|XP_010266636.1|  PREDICTED: lysosomal beta glucosidase-like         163   6e-43   
gb|KEH25597.1|  beta-D-glucoside glucohydrolase                         163   6e-43   
gb|KJB80778.1|  hypothetical protein B456_013G114800                    162   6e-43   
ref|XP_003569924.1|  PREDICTED: lysosomal beta glucosidase-like         163   6e-43   
ref|XP_002987109.1|  hypothetical protein SELMODRAFT_125622             163   6e-43   
ref|XP_002262992.1|  PREDICTED: lysosomal beta glucosidase              163   7e-43   
ref|XP_008375543.1|  PREDICTED: lysosomal beta glucosidase              163   7e-43   
ref|XP_004489701.1|  PREDICTED: lysosomal beta glucosidase-like         163   7e-43   
ref|XP_004489700.1|  PREDICTED: lysosomal beta glucosidase-like         163   7e-43   
ref|XP_006479136.1|  PREDICTED: lysosomal beta glucosidase-like         163   7e-43   
ref|XP_007146739.1|  hypothetical protein PHAVU_006G065600g             162   8e-43   
gb|AEP33563.1|  b-1,4-glucanase                                         162   8e-43   
ref|XP_002456420.1|  hypothetical protein SORBIDRAFT_03g035970          163   8e-43   
ref|XP_006443452.1|  hypothetical protein CICLE_v10019305mg             162   8e-43   
ref|XP_002985402.1|  hypothetical protein SELMODRAFT_157260             162   8e-43   
ref|XP_010535769.1|  PREDICTED: lysosomal beta glucosidase-like         162   9e-43   
gb|KDO54374.1|  hypothetical protein CISIN_1g038523mg                   162   9e-43   
ref|XP_010043470.1|  PREDICTED: lysosomal beta glucosidase-like         162   9e-43   
ref|XP_003594509.1|  Beta-D-glucosidase                                 162   9e-43   
ref|XP_008644501.1|  PREDICTED: lysosomal beta glucosidase-like i...    162   9e-43   
ref|XP_003615587.1|  Beta-D-glucan exohydrolase-like protein            162   9e-43   
ref|XP_008644502.1|  PREDICTED: lysosomal beta glucosidase-like i...    162   1e-42   
ref|XP_008464959.1|  PREDICTED: lysosomal beta glucosidase-like         162   1e-42   
ref|NP_001044387.1|  Os01g0771900                                       162   1e-42   
ref|XP_006361124.1|  PREDICTED: lysosomal beta glucosidase-like         162   1e-42   
ref|XP_002525724.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    162   1e-42   
ref|XP_003559563.1|  PREDICTED: lysosomal beta glucosidase-like         162   1e-42   
ref|XP_004141128.1|  PREDICTED: lysosomal beta glucosidase-like         162   1e-42   
ref|XP_003559419.1|  PREDICTED: lysosomal beta glucosidase-like         162   1e-42   
gb|EEE55456.1|  hypothetical protein OsJ_03617                          162   1e-42   
ref|XP_006445671.1|  hypothetical protein CICLE_v10014537mg             162   1e-42   
ref|NP_001051275.1|  Os03g0749300                                       162   1e-42   
gb|EYU18174.1|  hypothetical protein MIMGU_mgv1a002879mg                162   1e-42   
ref|XP_008464960.1|  PREDICTED: lysosomal beta glucosidase-like         162   1e-42   
ref|XP_010420942.1|  PREDICTED: lysosomal beta glucosidase-like         162   1e-42   
ref|XP_008777967.1|  PREDICTED: lysosomal beta glucosidase-like i...    162   1e-42   
ref|XP_008777968.1|  PREDICTED: lysosomal beta glucosidase-like i...    162   2e-42   
ref|XP_010104681.1|  Lysosomal beta glucosidase                         162   2e-42   
gb|KHG09998.1|  Lysosomal beta glucosidase                              162   2e-42   
ref|XP_004241371.1|  PREDICTED: lysosomal beta glucosidase-like         162   2e-42   
gb|KJB60360.1|  hypothetical protein B456_009G301800                    162   2e-42   
ref|XP_004961905.1|  PREDICTED: lysosomal beta glucosidase-like i...    162   2e-42   
ref|XP_010917928.1|  PREDICTED: uncharacterized protein LOC105042425    165   2e-42   
ref|XP_010550691.1|  PREDICTED: lysosomal beta glucosidase-like         162   2e-42   
emb|CBI24412.3|  unnamed protein product                                160   2e-42   
gb|AEP33566.1|  b-1,4-glucanase                                         161   2e-42   
ref|XP_006487879.1|  PREDICTED: lysosomal beta glucosidase-like         161   2e-42   
ref|XP_007030059.1|  Glycosyl hydrolase family protein                  164   2e-42   
ref|NP_001130296.1|  exoglucanase1 precursor                            161   2e-42   
gb|AAF79936.1|  exoglucanase precursor                                  161   2e-42   
gb|ADZ16108.1|  endo-alpha-1,4-glucanase                                161   2e-42   
gb|AAZ15705.1|  endo-alpha-1,4-glucanase                                161   2e-42   
ref|XP_010279030.1|  PREDICTED: lysosomal beta glucosidase-like         161   2e-42   
ref|XP_004970125.1|  PREDICTED: lysosomal beta glucosidase-like         162   2e-42   
ref|XP_008664722.1|  PREDICTED: exoglucanase1 isoform X2                161   2e-42   
ref|XP_010685489.1|  PREDICTED: lysosomal beta glucosidase-like         161   2e-42   
gb|AEP33574.1|  b-1,4-glucanase                                         161   2e-42   
gb|AEP33568.1|  b-1,4-glucanase                                         161   2e-42   
gb|KHG06450.1|  gluA                                                    161   2e-42   
gb|AEP33579.1|  b-1,4-glucanase                                         161   2e-42   
gb|AEP33565.1|  b-1,4-glucanase                                         161   2e-42   
gb|KJB60361.1|  hypothetical protein B456_009G301800                    161   2e-42   
ref|XP_010696623.1|  PREDICTED: lysosomal beta glucosidase-like         161   2e-42   
gb|AEP33577.1|  b-1,4-glucanase                                         161   2e-42   
gb|AFS50097.1|  beta-D-glucan exohydolase                               161   2e-42   
gb|AEP33582.1|  b-1,4-glucanase                                         161   2e-42   
gb|AEP33567.1|  b-1,4-glucanase                                         161   2e-42   
gb|AEP33560.1|  b-1,4-glucanase                                         161   3e-42   
ref|WP_034590455.1|  beta-glucosidase                                   161   3e-42   
gb|ADZ16110.1|  endo-alpha-1,4-glucanase                                161   3e-42   
ref|XP_007218946.1|  hypothetical protein PRUPE_ppa002559mg             161   3e-42   
ref|XP_009396473.1|  PREDICTED: lysosomal beta glucosidase-like         161   3e-42   
gb|KHN03708.1|  Lysosomal beta glucosidase                              161   3e-42   
ref|XP_009619848.1|  PREDICTED: lysosomal beta glucosidase-like         161   3e-42   
gb|AEP33562.1|  b-1,4-glucanase                                         161   3e-42   
ref|NP_001105671.1|  beta-glucanase precursor                           161   3e-42   
ref|XP_011077752.1|  PREDICTED: lysosomal beta glucosidase-like         161   3e-42   
ref|XP_006404419.1|  hypothetical protein EUTSA_v10010219mg             161   3e-42   
gb|KJB55773.1|  hypothetical protein B456_009G093600                    161   3e-42   
gb|EEC71555.1|  hypothetical protein OsI_03907                          164   3e-42   
emb|CDP15624.1|  unnamed protein product                                161   3e-42   
ref|XP_010054740.1|  PREDICTED: lysosomal beta glucosidase-like         161   3e-42   
ref|XP_009801866.1|  PREDICTED: lysosomal beta glucosidase-like i...    161   3e-42   
ref|XP_009760946.1|  PREDICTED: lysosomal beta glucosidase-like         161   3e-42   
ref|XP_003519089.1|  PREDICTED: lysosomal beta glucosidase-like         161   3e-42   
ref|XP_009417082.1|  PREDICTED: lysosomal beta glucosidase-like         161   4e-42   
ref|XP_009801863.1|  PREDICTED: lysosomal beta glucosidase-like i...    161   4e-42   
ref|WP_036936960.1|  beta-glucosidase                                   160   4e-42   
ref|XP_010313613.1|  PREDICTED: lysosomal beta glucosidase-like         160   4e-42   
ref|XP_006340297.1|  PREDICTED: lysosomal beta glucosidase-like         160   4e-42   
ref|XP_006347719.1|  PREDICTED: lysosomal beta glucosidase-like i...    160   5e-42   
ref|XP_009400035.1|  PREDICTED: lysosomal beta glucosidase-like         160   5e-42   
ref|XP_008649670.1|  PREDICTED: lysosomal beta glucosidase-like         160   5e-42   
gb|EMS53505.1|  Lysosomal beta glucosidase                              160   5e-42   
ref|XP_006347720.1|  PREDICTED: lysosomal beta glucosidase-like i...    160   5e-42   
gb|AEP33561.1|  b-1,4-glucanase                                         160   6e-42   
ref|XP_009799725.1|  PREDICTED: lysosomal beta glucosidase-like         160   6e-42   
gb|KHG23007.1|  Lysosomal beta glucosidase                              163   6e-42   
ref|XP_002278363.1|  PREDICTED: lysosomal beta glucosidase-like         160   6e-42   
ref|XP_010034246.1|  PREDICTED: lysosomal beta glucosidase-like         160   7e-42   
ref|XP_010031608.1|  PREDICTED: lysosomal beta glucosidase-like         160   7e-42   
gb|KCW50975.1|  hypothetical protein EUGRSUZ_J00604                     160   7e-42   
gb|EYU38726.1|  hypothetical protein MIMGU_mgv1a002845mg                160   7e-42   
ref|XP_004961906.1|  PREDICTED: lysosomal beta glucosidase-like i...    160   7e-42   
ref|XP_006840240.1|  hypothetical protein AMTR_s01542p00001140          157   7e-42   
ref|XP_004142603.1|  PREDICTED: lysosomal beta glucosidase-like         160   8e-42   
ref|XP_004171886.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    160   8e-42   
ref|XP_009595457.1|  PREDICTED: lysosomal beta glucosidase-like i...    160   9e-42   
ref|XP_009620993.1|  PREDICTED: lysosomal beta glucosidase-like         160   9e-42   
emb|CDP15622.1|  unnamed protein product                                160   9e-42   
gb|KHG17513.1|  gluA                                                    159   9e-42   
ref|XP_009595456.1|  PREDICTED: lysosomal beta glucosidase-like i...    160   9e-42   
ref|XP_009786310.1|  PREDICTED: lysosomal beta glucosidase-like         159   1e-41   
ref|XP_004230073.1|  PREDICTED: lysosomal beta glucosidase              160   1e-41   
ref|XP_006424026.1|  hypothetical protein CICLE_v10030270mg             159   1e-41   
dbj|BAA33065.1|  beta-D-glucan exohydrolase                             159   1e-41   
ref|XP_008443733.1|  PREDICTED: lysosomal beta glucosidase-like         159   1e-41   
gb|AES98538.2|  glycoside hydrolase family 3 protein                    159   1e-41   
ref|XP_010034245.1|  PREDICTED: lysosomal beta glucosidase-like         159   1e-41   
ref|XP_003615580.1|  Beta-D-xylosidase                                  159   1e-41   
gb|AAS97960.1|  cell wall beta-glucosidase                              159   1e-41   
ref|XP_008359198.1|  PREDICTED: lysosomal beta glucosidase-like         152   1e-41   
ref|XP_010541670.1|  PREDICTED: lysosomal beta glucosidase-like         159   1e-41   
ref|XP_010031611.1|  PREDICTED: lysosomal beta glucosidase-like         159   1e-41   
gb|AAM13694.1|  beta-D-glucan exohydrolase                              159   1e-41   
ref|XP_002523935.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    159   1e-41   
gb|KDP39682.1|  hypothetical protein JCGZ_02702                         159   1e-41   
gb|EYU25636.1|  hypothetical protein MIMGU_mgv1a002814mg                159   2e-41   
gb|AAC49170.1|  beta-D-glucan exohydrolase, isoenzyme ExoII             159   2e-41   
ref|XP_008344505.1|  PREDICTED: lysosomal beta glucosidase-like         156   2e-41   
ref|XP_009609160.1|  PREDICTED: lysosomal beta glucosidase-like i...    159   2e-41   
ref|XP_007015578.1|  Glycosyl hydrolase family protein isoform 1        159   2e-41   
ref|XP_007015579.1|  Glycosyl hydrolase family protein isoform 2        159   2e-41   
ref|XP_009609159.1|  PREDICTED: lysosomal beta glucosidase-like i...    159   2e-41   
gb|KGN66708.1|  hypothetical protein Csa_1G661750                       159   2e-41   
ref|XP_006848112.1|  hypothetical protein AMTR_s00029p00215880          155   2e-41   
ref|XP_009418960.1|  PREDICTED: lysosomal beta glucosidase-like         159   2e-41   
ref|XP_007208190.1|  hypothetical protein PRUPE_ppa020836mg             158   3e-41   
ref|XP_007145577.1|  hypothetical protein PHAVU_007G250300g             158   3e-41   
ref|XP_002271545.1|  PREDICTED: lysosomal beta glucosidase              158   3e-41   
ref|XP_004952004.1|  PREDICTED: lysosomal beta glucosidase-like         158   3e-41   
ref|XP_007207411.1|  hypothetical protein PRUPE_ppa014605mg             158   3e-41   
gb|KJB16249.1|  hypothetical protein B456_002G219500                    158   3e-41   
ref|XP_006361126.1|  PREDICTED: lysosomal beta glucosidase-like i...    157   4e-41   
ref|XP_010917869.1|  PREDICTED: lysosomal beta glucosidase-like i...    157   5e-41   
ref|XP_010917874.1|  PREDICTED: lysosomal beta glucosidase-like i...    157   5e-41   
gb|EMT32143.1|  Lysosomal beta glucosidase                              157   6e-41   
ref|XP_007161964.1|  hypothetical protein PHAVU_001G112600g             157   6e-41   
gb|AEP33580.1|  b-1,4-glucanase                                         157   7e-41   
gb|EWM10300.1|  beta-glucosidase                                        158   7e-41   
ref|XP_011094172.1|  PREDICTED: lysosomal beta glucosidase-like i...    157   7e-41   
ref|XP_010034248.1|  PREDICTED: lysosomal beta glucosidase-like         157   8e-41   
ref|XP_011089216.1|  PREDICTED: uncharacterized protein LOC105170243    160   8e-41   
ref|WP_043714740.1|  beta-glucosidase                                   158   8e-41   
gb|AFW66698.1|  hypothetical protein ZEAMMB73_778261                    157   8e-41   
ref|XP_010034247.1|  PREDICTED: lysosomal beta glucosidase-like         157   8e-41   
emb|CBI24415.3|  unnamed protein product                                150   8e-41   
ref|XP_006361125.1|  PREDICTED: lysosomal beta glucosidase-like         157   9e-41   
ref|XP_009131828.1|  PREDICTED: lysosomal beta glucosidase              157   9e-41   
gb|KDP39683.1|  hypothetical protein JCGZ_02703                         157   1e-40   
ref|WP_040657263.1|  beta-glucosidase                                   156   1e-40   
ref|WP_027322862.1|  hypothetical protein                               156   1e-40   
ref|XP_008230855.1|  PREDICTED: lysosomal beta glucosidase-like         156   1e-40   
ref|WP_037969115.1|  beta-glucosidase                                   156   1e-40   
ref|XP_008245228.1|  PREDICTED: lysosomal beta glucosidase-like         156   1e-40   
ref|XP_008245226.1|  PREDICTED: lysosomal beta glucosidase-like         156   1e-40   
gb|EMT13490.1|  Lysosomal beta glucosidase                              157   1e-40   
ref|XP_002451477.1|  hypothetical protein SORBIDRAFT_04g002580          156   1e-40   
ref|XP_008679990.1|  PREDICTED: lysosomal beta glucosidase-like i...    156   2e-40   
ref|XP_008679988.1|  PREDICTED: lysosomal beta glucosidase-like i...    156   2e-40   
ref|XP_009588263.1|  PREDICTED: lysosomal beta glucosidase-like         156   2e-40   
ref|WP_041832255.1|  beta-glucosidase                                   156   2e-40   
dbj|BAJ97943.1|  predicted protein                                      149   2e-40   
gb|AFW66696.1|  hypothetical protein ZEAMMB73_778261                    156   2e-40   
gb|AGL16753.1|  beta-glucosidase                                        156   2e-40   
ref|XP_004954723.1|  PREDICTED: lysosomal beta glucosidase-like         156   2e-40   
ref|WP_011875061.1|  beta-glucosidase                                   156   2e-40   
ref|XP_010495552.1|  PREDICTED: lysosomal beta glucosidase-like         155   2e-40   
ref|XP_004493184.1|  PREDICTED: lysosomal beta glucosidase-like i...    156   2e-40   
gb|EPS64616.1|  hypothetical protein M569_10162                         155   2e-40   
ref|XP_010553801.1|  PREDICTED: lysosomal beta glucosidase-like         155   2e-40   
dbj|BAK02950.1|  predicted protein                                      155   2e-40   
gb|KEH23536.1|  beta-D-glucoside glucohydrolase                         155   3e-40   
ref|XP_003624652.1|  Periplasmic beta-glucosidase                       155   3e-40   
ref|XP_010679080.1|  PREDICTED: lysosomal beta glucosidase-like         155   3e-40   
ref|XP_008230844.1|  PREDICTED: uncharacterized protein LOC103330075    158   3e-40   
ref|XP_004241372.1|  PREDICTED: lysosomal beta glucosidase-like         155   3e-40   
ref|XP_001777176.1|  predicted protein                                  155   3e-40   



>ref|XP_011080690.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=599

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+DPNAP+E RVKDLLSRMTL EKIGQM QI+R+VATP+AI D F+GSILSGGGSKP 
Sbjct  3    CIYKDPNAPIEARVKDLLSRMTLLEKIGQMTQIERSVATPAAIKDRFIGSILSGGGSKPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADMIDGFQKAALETRLG PIIYG DA+HGNNNVYG T+FPH IGLGATR
Sbjct  63   ENAKSADWADMIDGFQKAALETRLGSPIIYGTDAVHGNNNVYGTTIFPHNIGLGATR  119



>gb|EPS66750.1| hypothetical protein M569_08026, partial [Genlisea aurea]
Length=445

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY+ PNAP+E RV+DLLSRMTL EKIGQM QI+R+VATPSAI D F+G++LSGGGS P 
Sbjct  3    CVYKLPNAPIEARVRDLLSRMTLLEKIGQMTQIERSVATPSAIRDRFIGNVLSGGGSSPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADMIDGFQKAALETRLGIPIIYG DA+HGN NVYGAT+FPH +GLGATR
Sbjct  63   ENAKSADWADMIDGFQKAALETRLGIPIIYGTDAVHGNGNVYGATIFPHNVGLGATR  119



>emb|CDP09157.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY+DPNAPVE RVKDLLSRMTL+EKIGQM QI+R+VATP A+ + F+GS+LSGGGSKP 
Sbjct  3    CVYKDPNAPVEARVKDLLSRMTLEEKIGQMTQIERSVATPDAVKNRFIGSVLSGGGSKPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            + A S +WADMIDGFQK A+E+RLGIPI YG+DA+HGNNNVYG T+FPH IGLGATR
Sbjct  63   EKANSADWADMIDGFQKGAVESRLGIPIFYGVDAVHGNNNVYGTTIFPHNIGLGATR  119



>ref|XP_009603386.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=602

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY+DPNAPVE+RVKD+LSRMTL+EKIGQM QI+RAVA PS I D ++GS+LSGGGS+P 
Sbjct  3    CVYKDPNAPVEERVKDVLSRMTLEEKIGQMTQIERAVANPSVIRDRYIGSVLSGGGSRPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADMID FQK A+ETRLGIPI YG DAIHGNNNV+GAT+FPH IGLGATR
Sbjct  63   ENADSSDWADMIDEFQKGAVETRLGIPIFYGTDAIHGNNNVWGATIFPHNIGLGATR  119



>ref|XP_004294237.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=626

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            E  E   C+YR+PN P+E RVKDLLSRMTLKEK+GQM QI+R VATPSAI D+ +GS+LS
Sbjct  2    ETAEDLNCIYRNPNEPIEARVKDLLSRMTLKEKVGQMTQIERRVATPSAIKDFHIGSVLS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             GGS P +NA S +WADM+DGFQ++A+ETRL IP++YGIDA+HGNNNVYGAT+FPH +GL
Sbjct  62   AGGSGPFENAVSADWADMVDGFQRSAMETRLRIPMVYGIDAVHGNNNVYGATIFPHNVGL  121

Query  503  GATR  514
            GATR
Sbjct  122  GATR  125



>ref|XP_007016180.1| Glycosyl hydrolase family protein isoform 6 [Theobroma cacao]
 gb|EOY33799.1| Glycosyl hydrolase family protein isoform 6 [Theobroma cacao]
Length=472

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++PNAP+EDRVKDLLSRMTL+EKIGQM QI+R VA PSA+ D+ +GSILS GGS P 
Sbjct  3    CVYKNPNAPIEDRVKDLLSRMTLQEKIGQMTQIERRVADPSALKDFSIGSILSAGGSGPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADM+D FQ+AALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GLGATR
Sbjct  63   ENALSSDWADMVDRFQQAALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGLGATR  119



>ref|XP_007016175.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY33794.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=606

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++PNAP+EDRVKDLLSRMTL+EKIGQM QI+R VA PSA+ D+ +GSILS GGS P 
Sbjct  3    CVYKNPNAPIEDRVKDLLSRMTLQEKIGQMTQIERRVADPSALKDFSIGSILSAGGSGPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADM+D FQ+AALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GLGATR
Sbjct  63   ENALSSDWADMVDRFQQAALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGLGATR  119



>ref|XP_007016177.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
 gb|EOY33796.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
Length=607

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++PNAP+EDRVKDLLSRMTL+EKIGQM QI+R VA PSA+ D+ +GSILS GGS P 
Sbjct  3    CVYKNPNAPIEDRVKDLLSRMTLQEKIGQMTQIERRVADPSALKDFSIGSILSAGGSGPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADM+D FQ+AALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GLGATR
Sbjct  63   ENALSSDWADMVDRFQQAALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGLGATR  119



>ref|NP_190284.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 emb|CAB61946.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AAL32794.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AAM13345.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AAM13073.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AAP37725.1| At3g47000 [Arabidopsis thaliana]
 gb|AEE78230.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=608

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E + CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R VA+PSA TD+F+GS+L+ G
Sbjct  3    VEESSCVYKNGDAPVEARVKDLLSRMTLPEKIGQMTQIERRVASPSAFTDFFIGSVLNAG  62

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH IGLGA
Sbjct  63   GSVPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIGLGA  122

Query  509  TR  514
            TR
Sbjct  123  TR  124



>ref|XP_007207129.1| hypothetical protein PRUPE_ppa003012mg [Prunus persica]
 gb|EMJ08328.1| hypothetical protein PRUPE_ppa003012mg [Prunus persica]
Length=612

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            +K++   C+YR+PN PVE RVKDLLSRMTLKEK+GQM QI+R V+TP AI D+ +GS+LS
Sbjct  2    DKVKDFNCIYRNPNEPVEARVKDLLSRMTLKEKVGQMTQIERRVSTPDAIRDFSIGSVLS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             GGS P + A S +WADM+DGFQ++ALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GL
Sbjct  62   AGGSVPFEKALSSDWADMVDGFQRSALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGL  121

Query  503  GATR  514
            GATR
Sbjct  122  GATR  125



>ref|XP_008366241.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Malus 
domestica]
Length=457

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            +K+    C+YR+PN P+E RVKDLLSRMTL+EK GQM QI+R V+TP AI D+ +GSILS
Sbjct  2    DKVNDLNCIYRNPNEPIEARVKDLLSRMTLREKAGQMTQIERQVSTPEAIRDFSIGSILS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             GGS P +NA S++W DM+DGFQ++ALE RLGIP+IYGIDA+HGNN+VYGAT+FPH +GL
Sbjct  62   AGGSVPFENALSKDWXDMVDGFQRSALENRLGIPMIYGIDAVHGNNSVYGATIFPHNVGL  121

Query  503  GATR  514
            GA+R
Sbjct  122  GASR  125



>ref|XP_009794314.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=598

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY+DPNAPVE+RVKDLLSRMTL+EKIGQM QI+RAVA  SAI D  +GS+LSGGGS+P 
Sbjct  3    CVYKDPNAPVEERVKDLLSRMTLEEKIGQMTQIERAVANHSAIRDGCIGSVLSGGGSRPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WA+MID FQK A+ETRLGIPI YG DAIHGNNNV+GAT+FPH IGLGATR
Sbjct  63   ENAESSDWANMIDEFQKGAVETRLGIPIFYGTDAIHGNNNVWGATIFPHNIGLGATR  119



>ref|XP_010426157.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=611

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E + CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R VA+P+AITD+F+GS+L+ GG
Sbjct  5    EESSCVYKNQDAPVEARVKDLLSRMTLPEKIGQMTQIERTVASPAAITDFFIGSVLNAGG  64

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I LGAT
Sbjct  65   SAPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNISLGAT  124

Query  512  R  514
            R
Sbjct  125  R  125



>ref|XP_008220446.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=612

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            +K++   C+YR+PN P+E RVKDLLSRMTLKEK+GQM QI+R V+TP AI D+ +GS+LS
Sbjct  2    DKVKDFNCIYRNPNEPIEARVKDLLSRMTLKEKVGQMTQIERRVSTPDAIRDFSIGSVLS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             GGS P + A S +WADM+DGFQ++ALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GL
Sbjct  62   AGGSVPFEKALSSDWADMVDGFQRSALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGL  121

Query  503  GATR  514
            GATR
Sbjct  122  GATR  125



>ref|XP_006404423.1| hypothetical protein EUTSA_v10010212mg [Eutrema salsugineum]
 gb|ESQ45876.1| hypothetical protein EUTSA_v10010212mg [Eutrema salsugineum]
Length=613

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            + + CVY++P+APVE RV+DLLS MTL EKIGQM QI+R VA+P+AITD+F+GS+L+ GG
Sbjct  4    KESSCVYKNPDAPVEARVQDLLSHMTLPEKIGQMTQIERTVASPAAITDFFIGSVLNAGG  63

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH IGLGAT
Sbjct  64   SVPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIGLGAT  123

Query  512  R  514
            R
Sbjct  124  R  124



>ref|XP_009149938.1| PREDICTED: lysosomal beta glucosidase [Brassica rapa]
Length=609

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MAE  +S+ CVY++P+APVE RV+DLLSRMTL+EKIGQM QI+R+VA+   +TDYF+GS+
Sbjct  1    MAETTDSS-CVYKNPDAPVEARVQDLLSRMTLQEKIGQMTQIERSVASHDVLTDYFIGSV  59

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
             SG GS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGAT+FPH I
Sbjct  60   QSGAGSWPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATIFPHNI  119

Query  497  GLGATR  514
            GLGATR
Sbjct  120  GLGATR  125



>emb|CDX99072.1| BnaA06g17630D [Brassica napus]
Length=609

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MAE  +S+ CVY++P+APVE RV+DLLSRMTL+EKIGQM QI+R+VA+   +TDYF+GS+
Sbjct  1    MAETTDSS-CVYKNPDAPVEARVQDLLSRMTLQEKIGQMTQIERSVASHDVLTDYFIGSV  59

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
             SG GS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGAT+FPH I
Sbjct  60   QSGAGSWPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATIFPHNI  119

Query  497  GLGATR  514
            GLGATR
Sbjct  120  GLGATR  125



>gb|KEH34189.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=620

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  131  RRMAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLG  310
            +R  +  E+   +Y++PN P+E R+KDLLSRMTL EKIGQMIQI+R VATPS I D  +G
Sbjct  9    QRTPKSKEAMDSLYKNPNEPIEARIKDLLSRMTLNEKIGQMIQIERTVATPSVIKDLSIG  68

Query  311  SILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPH  490
            SILS GGS P DNA S +WADM+DG+QK+ALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH
Sbjct  69   SILSSGGSTPFDNALSSDWADMVDGYQKSALESRLGIPLIYGIDAVHGNNSVYGATIFPH  128

Query  491  FIGLGATR  514
             +GLGATR
Sbjct  129  NVGLGATR  136



>ref|XP_006293189.1| hypothetical protein CARUB_v10019506mg [Capsella rubella]
 gb|EOA26087.1| hypothetical protein CARUB_v10019506mg [Capsella rubella]
Length=615

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P+APVE RVKDLLSRMTL EKIGQM QI+R V T   ITDYF+GS+L+GGGS P 
Sbjct  8    CVYKNPDAPVEARVKDLLSRMTLPEKIGQMTQIERIVTTHPVITDYFIGSVLNGGGSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A + +WADMIDG+Q AAL +RLGIPIIYGIDA+HGNNNVYGAT+FPH IGLGATR
Sbjct  68   EDAKTSDWADMIDGYQNAALASRLGIPIIYGIDAVHGNNNVYGATIFPHNIGLGATR  124



>ref|XP_010426159.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=609

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P+APVE RV DLLSRMTL EKIGQM QI+R V T   ITDYF+GS+L+GGGS P 
Sbjct  8    CVYKNPDAPVEARVMDLLSRMTLPEKIGQMTQIERVVTTHPVITDYFIGSVLNGGGSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A + +WADMIDG+Q AAL TRLGIPIIYGIDA+HGNNNVYGAT+FPH IGLGATR
Sbjct  68   EDALTSDWADMIDGYQNAALATRLGIPIIYGIDAVHGNNNVYGATIFPHNIGLGATR  124



>ref|XP_004241177.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=598

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+DPNA +E+RVKDLLS+MT++EKIGQM QI+RAVA PSAI D  +GS+LSGGGS+P 
Sbjct  3    CIYKDPNAAIEERVKDLLSKMTVEEKIGQMTQIERAVANPSAIRDRCIGSVLSGGGSRPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WA+MIDGFQK A+E+RLGIPI YG DAIHGNNNV+GAT+FPH IGLGATR
Sbjct  63   ENAESGDWANMIDGFQKGAVESRLGIPIFYGTDAIHGNNNVWGATIFPHNIGLGATR  119



>ref|XP_010515030.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=609

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P+APVE RVKDLLSRMTL EK GQM QI+R V T   ITDYF+GS+L+GGGS P 
Sbjct  8    CVYKNPDAPVEARVKDLLSRMTLPEKFGQMTQIERVVTTHPVITDYFIGSVLNGGGSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A + +WADMIDG+Q AAL +RLGIPIIYGIDA+HGNNNVYGAT+FPH IGLGATR
Sbjct  68   EDALTSDWADMIDGYQNAALASRLGIPIIYGIDAVHGNNNVYGATIFPHNIGLGATR  124



>gb|EYU45973.1| hypothetical protein MIMGU_mgv1a003210mg [Erythranthe guttata]
Length=600

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 101/118 (86%), Gaps = 1/118 (1%)
 Frame = +2

Query  164  CV-YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKP  340
            CV Y+  NAP+E RVKDLLSRMTL EKIGQM QI+R+VATPS I D F+GS+LSGGGSKP
Sbjct  3    CVIYKTLNAPIEARVKDLLSRMTLLEKIGQMTQIERSVATPSVIKDRFIGSVLSGGGSKP  62

Query  341  SDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             +NA S +WADMIDG QK ALETRLGIPIIYG DA+HGNNNVYG T+FPH IGLGATR
Sbjct  63   FENAKSADWADMIDGLQKGALETRLGIPIIYGTDAVHGNNNVYGTTIFPHNIGLGATR  120



>gb|KFK34020.1| hypothetical protein AALP_AA5G091600 [Arabis alpina]
Length=608

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P+APVE RVKDLLSR+TL EKIGQM QI+R VA+P+AITD F+GSIL+ GGS P 
Sbjct  8    CVYQNPDAPVEARVKDLLSRLTLPEKIGQMTQIERTVASPTAITDSFIGSILNSGGSAPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I LGATR
Sbjct  68   EDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIALGATR  124



>ref|XP_008366240.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Malus 
domestica]
Length=612

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            +K+    C+YR+PN P+E RVKDLLSRMTL+EK GQM QI+R V+TP AI D+ +GSILS
Sbjct  2    DKVNDLNCIYRNPNEPIEARVKDLLSRMTLREKAGQMTQIERQVSTPEAIRDFSIGSILS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             GGS P +NA S++W DM+DGFQ++ALE RLGIP+IYGIDA+HGNN+VYGAT+FPH +GL
Sbjct  62   AGGSVPFENALSKDWXDMVDGFQRSALENRLGIPMIYGIDAVHGNNSVYGATIFPHNVGL  121

Query  503  GATR  514
            GA+R
Sbjct  122  GASR  125



>ref|XP_009149942.1| PREDICTED: lysosomal beta glucosidase [Brassica rapa]
Length=608

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY+ P+APVE RVKDLLSRMTL EKIGQM QI+R VA+P+AI D+F+GS+L+ GGS P 
Sbjct  8    CVYQTPDAPVEARVKDLLSRMTLPEKIGQMTQIERTVASPAAIRDFFIGSVLNSGGSAPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I LGATR
Sbjct  68   EDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIALGATR  124



>ref|XP_006350824.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=598

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+DPNA +E+RVKDLLS+MT++EKIGQ+ QI+RAVA PSAI D  +GS+LSGGGS+P 
Sbjct  3    CIYKDPNAAIEERVKDLLSKMTVEEKIGQITQIERAVANPSAIRDRCIGSVLSGGGSRPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WA+MIDGFQK A+E+RLGIPI YG DAIHGNNNV+GAT+FPH IGLGATR
Sbjct  63   ENAESADWANMIDGFQKGAVESRLGIPIFYGTDAIHGNNNVWGATIFPHNIGLGATR  119



>gb|AFM39013.1| glycosyl hydrolase [Sinapis alba]
Length=609

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E   CVY++P+APVE RVKDLLSRMTL EKIGQM QI+R VA+P+AI D+F+GS+L+ GG
Sbjct  5    EEEPCVYQNPDAPVEARVKDLLSRMTLPEKIGQMTQIERRVASPAAIRDFFIGSVLNAGG  64

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P ++A S +WADMIDGFQ++AL +RLGIP+IYG DA+HGNNNVYGATVFPH I LGAT
Sbjct  65   SAPFEDAKSSDWADMIDGFQQSALASRLGIPLIYGTDAVHGNNNVYGATVFPHNIALGAT  124

Query  512  R  514
            R
Sbjct  125  R  125



>ref|XP_006290760.1| hypothetical protein CARUB_v10016864mg [Capsella rubella]
 gb|EOA23658.1| hypothetical protein CARUB_v10016864mg [Capsella rubella]
Length=609

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            M  K ES+ CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R VA+P AITD F+GS+
Sbjct  1    MVVKDESS-CVYKNRDAPVEARVKDLLSRMTLPEKIGQMTQIERNVASPVAITDSFIGSV  59

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            L+ GGS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I
Sbjct  60   LNAGGSAPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNI  119

Query  497  GLGATR  514
            GLGATR
Sbjct  120  GLGATR  125



>emb|CDX99078.1| BnaA06g17690D [Brassica napus]
Length=608

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY+ P+APVE RVKDLLSRMTL EKIGQM QI+R VA+P+AI D+F+GS+L+ GGS P 
Sbjct  8    CVYQTPDAPVEARVKDLLSRMTLPEKIGQMTQIERTVASPAAIRDFFIGSVLNSGGSAPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I LGATR
Sbjct  68   EDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIALGATR  124



>ref|XP_006404420.1| hypothetical protein EUTSA_v10010213mg [Eutrema salsugineum]
 gb|ESQ45873.1| hypothetical protein EUTSA_v10010213mg [Eutrema salsugineum]
Length=612

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P+APVE RV+DLLSRMTL EKIGQM QI+R VA+P+AITD+F+GS+L+  GS P 
Sbjct  8    CVYKNPDAPVEARVQDLLSRMTLPEKIGQMTQIERTVASPAAITDFFIGSVLNAAGSWPL  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A   +WADMIDGFQ++AL +RLGIPIIYGIDA+HGNN+VYGATVFPH IGLGATR
Sbjct  68   EDARPSDWADMIDGFQRSALASRLGIPIIYGIDAVHGNNDVYGATVFPHNIGLGATR  124



>ref|XP_002525596.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF36714.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=603

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+DPN+PVEDRVKDL+SRMTLKEKI QM QI+R  A+P  + D+ +GS+LS GGS P 
Sbjct  4    CIYKDPNSPVEDRVKDLISRMTLKEKIAQMTQIERRAASPHYLRDFGVGSLLSVGGSTPF  63

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADMIDG+QK ALE+RLGIPI+YGIDA+HGNNNVYGAT+FPH +GLGATR
Sbjct  64   ENALSSDWADMIDGYQKLALESRLGIPIMYGIDAVHGNNNVYGATIFPHNVGLGATR  120



>ref|XP_002877538.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53797.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=596

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R V T   ITDYF+GS+L+GGGS P 
Sbjct  8    CVYKNQDAPVEARVKDLLSRMTLPEKIGQMTQIERVVTTYPVITDYFIGSVLNGGGSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A + +WADMIDG+Q AAL +RLGIPIIYGIDA+HGNNNVYGAT+FPH IGLGATR
Sbjct  68   EDAKTSDWADMIDGYQNAALASRLGIPIIYGIDAVHGNNNVYGATIFPHNIGLGATR  124



>ref|XP_011080849.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Sesamum 
indicum]
Length=606

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+D +AP+E R++DLLSRMTL+EKIGQM QI+R+VATPSAI D  +GSILS GGS P 
Sbjct  3    CIYKDSSAPIEARIQDLLSRMTLQEKIGQMTQIERSVATPSAIKDLCVGSILSVGGSGPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WA M+D FQKAALE+RLGIP++YGIDA+HGNNNVYGAT+FPH IGLGATR
Sbjct  63   ENAKSSDWAAMVDSFQKAALESRLGIPLLYGIDAVHGNNNVYGATIFPHNIGLGATR  119



>ref|XP_010535411.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Tarenaya 
hassleriana]
Length=606

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y++PNA VE RV+DLLSRMTLKEKIGQ+ QI+R V +PS IT+Y +GS+LSGGGS P 
Sbjct  9    CIYKNPNAEVELRVRDLLSRMTLKEKIGQITQIERRVTSPSVITNYCVGSVLSGGGSPPC  68

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            + A S  WADMIDGFQKAALETRL IPII+GIDA+HGNNNV GAT+FPH IGLGATR
Sbjct  69   EGAESSHWADMIDGFQKAALETRLRIPIIFGIDAVHGNNNVVGATIFPHNIGLGATR  125



>ref|XP_008457398.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Cucumis 
melo]
Length=617

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +2

Query  116  VRIGRRRMAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAIT  295
            ++IG+ +  E    + C+YR+  A +EDR+KDLLSRM+L+EKIGQM QI+R+V TPSA+T
Sbjct  4    MKIGKGKEMEG--KSDCLYRNAGAAIEDRIKDLLSRMSLREKIGQMTQIERSVVTPSALT  61

Query  296  DYFLGSILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGA  475
            D  +GS+L+GGGS P D A S +WADM+DGFQ  AL++RLGIPIIYGIDA+HGNNNVYGA
Sbjct  62   DLAIGSVLNGGGSLPFDKALSSDWADMVDGFQSLALQSRLGIPIIYGIDAVHGNNNVYGA  121

Query  476  TVFPHFIGLGATR  514
            T+FPH +GLGATR
Sbjct  122  TIFPHNVGLGATR  134



>ref|XP_002877536.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53795.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=609

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E + CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R VA+ +A TD+F+GS+L+ GG
Sbjct  5    EESSCVYKNQDAPVEVRVKDLLSRMTLPEKIGQMTQIERRVASHAAFTDFFIGSVLNAGG  64

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH IGLGAT
Sbjct  65   SVPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIGLGAT  124

Query  512  R  514
            R
Sbjct  125  R  125



>emb|CDX86119.1| BnaC03g56340D [Brassica napus]
Length=608

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MAE  +S+ CVY++P+APVE RV+DLLSRMTL+EKIGQ+ QI+R+VA+   +TDYF+GS+
Sbjct  1    MAETTDSS-CVYKNPDAPVEARVQDLLSRMTLQEKIGQVTQIERSVASHDVLTDYFIGSV  59

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
             SG GS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGAT+FPH I
Sbjct  60   QSGAGSWPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATIFPHNI  119

Query  497  GLGATR  514
             LGATR
Sbjct  120  SLGATR  125



>ref|XP_004296697.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=618

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            E +E   C+YR+PN  +E RVKDLLSRMTLKEK+GQM QI+R VATP AI D  +GSI+S
Sbjct  2    ETVEELNCIYRNPNESIEARVKDLLSRMTLKEKVGQMTQIEREVATPFAIKDLSIGSIIS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
            G GS+P   A S +WADM+DGFQ+ ALETRL IP+IYGIDA+HGNN+VYGAT+FPH +GL
Sbjct  62   GAGSEPFKKALSADWADMVDGFQRCALETRLRIPLIYGIDAVHGNNSVYGATIFPHNVGL  121

Query  503  GATR  514
            GATR
Sbjct  122  GATR  125



>ref|XP_009337307.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=612

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            +K+    C+YR+PN P+E RVKDLL+RMTL+EK GQM QI+R V+TP AI D+ +GSILS
Sbjct  2    DKVNDLNCIYRNPNEPIEARVKDLLARMTLREKAGQMSQIERRVSTPEAIRDFSIGSILS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             G S P +N  S++WADM+DGFQ++ALE RLGIP+IYGIDA+HGNNNVYGAT+FPH +GL
Sbjct  62   SGDSVPFENELSKDWADMVDGFQRSALENRLGIPMIYGIDAVHGNNNVYGATIFPHNVGL  121

Query  503  GATR  514
            GA+R
Sbjct  122  GASR  125



>ref|XP_009346879.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009346880.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009346881.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Pyrus 
x bretschneideri]
Length=612

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            +K+    C+YR+PN P+E RVKDLL RMTL+EK GQM QI+R V+TP AI D  +GSILS
Sbjct  2    DKVNDLNCIYRNPNEPIEARVKDLLPRMTLREKAGQMTQIERRVSTPEAIRDLSIGSILS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             GGS P +NA S++WADM+DGFQ++ALE+RLGIP+IYGIDA+HGNN VYGAT+FPH +GL
Sbjct  62   SGGSVPFENALSKDWADMVDGFQRSALESRLGIPMIYGIDAVHGNNCVYGATIFPHNVGL  121

Query  503  GATR  514
            GA+R
Sbjct  122  GASR  125



>ref|XP_010503321.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=613

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P+APVE RV DLLSRMTL EK GQM QI+R V T   ITDYF+GS+L+GGGS P 
Sbjct  8    CVYKNPDAPVEARVMDLLSRMTLPEKFGQMTQIERVVTTHPVITDYFIGSVLNGGGSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A + +WADMIDG+Q AAL TRLGIPIIYGIDA+HGNNNVY AT+FPH IGLGATR
Sbjct  68   EDALTSDWADMIDGYQNAALATRLGIPIIYGIDAVHGNNNVYEATIFPHNIGLGATR  124



>ref|XP_010650935.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=608

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+DPN P+E R+KDLLSRMTLKEK GQM QI+R VATPS + D  +GSILS GGS P 
Sbjct  3    CIYKDPNQPIEARIKDLLSRMTLKEKAGQMTQIERRVATPSVLKDLSIGSILSAGGSGPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            D A S +WADM+DGFQ++ALE+RLGIP++YGIDA+HGNN++YGAT+FPH +GLGATR
Sbjct  63   DKALSADWADMVDGFQQSALESRLGIPLLYGIDAVHGNNSIYGATIFPHNVGLGATR  119



>gb|KFK34021.1| hypothetical protein AALP_AA5G091700 [Arabis alpina]
Length=615

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  146  KIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSG  325
            + E + CVY +P+APVE RVKDLLSRMTL EKIGQM QI+R VA+P  I D F+GSI SG
Sbjct  3    ETEESSCVYTNPHAPVEARVKDLLSRMTLPEKIGQMTQIERTVASPQLIVDSFIGSIQSG  62

Query  326  GGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLG  505
             GS P ++A S +WADMIDGFQ +AL +RLGIPIIYG DA+HGNNNVYGAT+FPH IGLG
Sbjct  63   AGSWPFEDAKSSDWADMIDGFQCSALASRLGIPIIYGTDAVHGNNNVYGATIFPHNIGLG  122

Query  506  ATR  514
            ATR
Sbjct  123  ATR  125



>ref|NP_001190024.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AEE78236.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=644

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R V TP  ITD F+GS+L+GGGS P 
Sbjct  8    CVYKNKDAPVEARVKDLLSRMTLPEKIGQMTQIERVVTTPPVITDNFIGSVLNGGGSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRF  517
            ++A + +WADMIDG+Q AAL +RLGIPIIYGIDA+HGNNNVYGAT+FPH IGLGAT  
Sbjct  68   EDAKTSDWADMIDGYQNAALASRLGIPIIYGIDAVHGNNNVYGATIFPHNIGLGATSL  125



>ref|NP_190288.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 emb|CAB61950.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AEE78235.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=636

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R V TP  ITD F+GS+L+GGGS P 
Sbjct  8    CVYKNKDAPVEARVKDLLSRMTLPEKIGQMTQIERVVTTPPVITDNFIGSVLNGGGSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRF  517
            ++A + +WADMIDG+Q AAL +RLGIPIIYGIDA+HGNNNVYGAT+FPH IGLGAT  
Sbjct  68   EDAKTSDWADMIDGYQNAALASRLGIPIIYGIDAVHGNNNVYGATIFPHNIGLGATSL  125



>ref|XP_010256652.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  146  KIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSG  325
            K E   C+YR+ N PVE RV+DLLSRM L+EK+GQM QI+R+VA PSAI D  +GS+LSG
Sbjct  3    KTEEPQCIYRNSNEPVEVRVRDLLSRMMLREKLGQMTQIERSVANPSAIRDLCIGSVLSG  62

Query  326  GGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLG  505
            GGS P D A++ +WADM+D FQKAA+++RLG+PI+Y  DA+HG+NNVYGAT+FPH IGLG
Sbjct  63   GGSAPFDGASATDWADMVDSFQKAAIQSRLGVPILYATDAVHGHNNVYGATIFPHNIGLG  122

Query  506  ATRFDYF  526
            ATRF + 
Sbjct  123  ATRFHWL  129



>emb|CDX86116.1| BnaC03g56310D [Brassica napus]
Length=608

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY+ P+APVE RV+DLLSRMTL EKIGQM QI+R VA+P+AI D+F+GS+L+ GGS P 
Sbjct  8    CVYQTPDAPVEARVQDLLSRMTLPEKIGQMTQIERTVASPAAIRDFFIGSVLNAGGSAPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I LGAT
Sbjct  68   EDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIALGAT  123



>ref|XP_006425018.1| hypothetical protein CICLE_v10028048mg [Citrus clementina]
 ref|XP_006488483.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
 gb|ESR38258.1| hypothetical protein CICLE_v10028048mg [Citrus clementina]
Length=606

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +YR+PNA VEDR+KDLLSRMTLKEKIGQM QI+R VATPS + D  +GSILS GGS PS 
Sbjct  4    IYRNPNAHVEDRIKDLLSRMTLKEKIGQMTQIERGVATPSVLKDLSIGSILSSGGSMPSV  63

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            NA S  WADM+DGFQKAAL +RLGIP+IYGIDA+HGNN+VYGAT+FPH + LGATR
Sbjct  64   NALSAGWADMVDGFQKAALASRLGIPLIYGIDAVHGNNSVYGATIFPHNVNLGATR  119



>ref|XP_009346882.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=612

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  143  EKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILS  322
            +K+    C+YR+PN P+E RVKDLL RMTL+EK GQM QI+R V+TP AI D+ +GSILS
Sbjct  2    DKVNDLNCIYRNPNEPIEARVKDLLVRMTLREKAGQMSQIERRVSTPEAIRDFSIGSILS  61

Query  323  GGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGL  502
             G S P +N  S++WADM+DGFQ++ALE RLGIP+IYGIDA+HGNNNVYGAT+FPH +GL
Sbjct  62   SGDSVPFENELSKDWADMVDGFQRSALENRLGIPMIYGIDAVHGNNNVYGATIFPHNVGL  121

Query  503  GATR  514
            GA+R
Sbjct  122  GASR  125



>emb|CDX68425.1| BnaC01g25030D [Brassica napus]
Length=604

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            M  K ES  CVYR+P+APVE RV+DLLSRM+L EKIGQM QI+R V T + IT+ F+GS+
Sbjct  1    MESKEES--CVYRNPDAPVEARVQDLLSRMSLAEKIGQMTQIERVVTTRTVITNSFIGSV  58

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            L+GGGS P ++A   +WADMIDG+Q AAL +RLGIPIIYGIDA+HGNNNVYGAT+FPH I
Sbjct  59   LNGGGSWPFEDARPSDWADMIDGYQNAALASRLGIPIIYGIDAVHGNNNVYGATIFPHNI  118

Query  497  GLGATR  514
            GLGATR
Sbjct  119  GLGATR  124



>ref|XP_010043457.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW85472.1| hypothetical protein EUGRSUZ_B02276 [Eucalyptus grandis]
Length=617

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 8/129 (6%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E A CVY+DPNA +EDRV DLLSRMTL+EK+GQM QI+R VATPS ++   +GSILS GG
Sbjct  5    EDARCVYKDPNAAIEDRVNDLLSRMTLQEKVGQMTQIERRVATPSVLSGLSIGSILSAGG  64

Query  332  SKP--------SDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFP  487
            S P        S  A S +WADM+DGFQKAALE+RLGIP+IYGIDA+HGNN++YGAT+FP
Sbjct  65   SGPFGVIGSESSKQALSSDWADMVDGFQKAALESRLGIPLIYGIDAVHGNNSIYGATIFP  124

Query  488  HFIGLGATR  514
            H IGLGATR
Sbjct  125  HNIGLGATR  133



>ref|XP_002877537.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH53796.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
Length=606

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +2

Query  146  KIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSG  325
            + + + CVY++ +APVE RVKDLLSRMTL EKIGQM QI+R+VA+P  IT  F+GS+ SG
Sbjct  3    ETDDSSCVYKNRDAPVEARVKDLLSRMTLPEKIGQMTQIERSVASPQVITHSFIGSVQSG  62

Query  326  GGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLG  505
             GS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH IGLG
Sbjct  63   AGSWPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIGLG  122

Query  506  ATR  514
            ATR
Sbjct  123  ATR  125



>ref|XP_006849495.1| hypothetical protein AMTR_s00024p00127570 [Amborella trichopoda]
 gb|ERN11076.1| hypothetical protein AMTR_s00024p00127570 [Amborella trichopoda]
Length=160

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP AP+E+RV DLLSRMTL EKIGQM QIDR+ A P  +    +GS+LSGGGS P+ 
Sbjct  45   LYKDPKAPLEERVADLLSRMTLAEKIGQMTQIDRSTANPELLMRLNIGSVLSGGGSIPAP  104

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A+   WADMIDG Q AAL TRLGIPIIYGIDA+HG+NNVYGAT+FPH IGLGATR
Sbjct  105  KASPAMWADMIDGLQNAALATRLGIPIIYGIDAVHGHNNVYGATIFPHNIGLGATR  160



>gb|KHF98973.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=554

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C Y++PNAP+EDRVKDLLSRMTL+EKIGQM QI+R+VATP+ +  + +GSILS GGS P 
Sbjct  3    CTYKNPNAPIEDRVKDLLSRMTLQEKIGQMTQIERSVATPADLKSFSIGSILSAGGSVPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            + A   +WADM+D FQ+AALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +G+GATR
Sbjct  63   EKALPADWADMVDKFQQAALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGVGATR  119



>ref|NP_001190023.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AEE78232.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=608

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MAE  ES+  VY++ +APVE RVKDLLSRMTL EKIGQM QI+R+VA+P  IT+ F+GS+
Sbjct  1    MAETEESS-WVYKNRDAPVEARVKDLLSRMTLPEKIGQMTQIERSVASPQVITNSFIGSV  59

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
             SG GS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I
Sbjct  60   QSGAGSWPLEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNI  119

Query  497  GLGATR  514
            GLGATR
Sbjct  120  GLGATR  125



>gb|KJB83716.1| hypothetical protein B456_013G260700 [Gossypium raimondii]
Length=606

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C Y++PNAP+EDRVKDLLSRMTL+EKIGQM QI+R+VATP+ +  + +GSILS GGS P 
Sbjct  3    CTYKNPNAPIEDRVKDLLSRMTLQEKIGQMTQIERSVATPADLKSFSIGSILSAGGSVPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
              A   +WADM+D FQ+AALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GLGATR
Sbjct  63   QKALPADWADMVDKFQQAALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGLGATR  119



>ref|XP_009150614.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Brassica rapa]
Length=602

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            M  K ES  CVY++P+APVE RV+DLLSRM+L EKIGQM QI+R V T + IT+ F+GS+
Sbjct  1    MESKEES--CVYKNPDAPVEARVQDLLSRMSLAEKIGQMTQIERVVTTRTVITNSFIGSV  58

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            L+GGGS P ++A   +WADMIDG+Q AAL +RLGIPIIYGIDA+HGNNNVYGAT+FPH I
Sbjct  59   LNGGGSWPFEDARPSDWADMIDGYQNAALASRLGIPIIYGIDAVHGNNNVYGATIFPHNI  118

Query  497  GLGATR  514
            GLGATR
Sbjct  119  GLGATR  124



>ref|NP_190285.3| glycosyl hydrolase family protein [Arabidopsis thaliana]
 emb|CAB61947.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AEE78231.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=609

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MAE  ES+  VY++ +APVE RVKDLLSRMTL EKIGQM QI+R+VA+P  IT+ F+GS+
Sbjct  1    MAETEESS-WVYKNRDAPVEARVKDLLSRMTLPEKIGQMTQIERSVASPQVITNSFIGSV  59

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
             SG GS P ++A S +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNVYGATVFPH I
Sbjct  60   QSGAGSWPLEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNI  119

Query  497  GLGATR  514
            GLGATR
Sbjct  120  GLGATR  125



>gb|EPS66542.1| hypothetical protein M569_08231, partial [Genlisea aurea]
Length=401

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            YRDP+ P+E R+KDLLSRM+L EKIGQM+QI+R+VA+P  +  YF+GSILSGGGS P+  
Sbjct  30   YRDPSVPIEQRIKDLLSRMSLAEKIGQMVQIERSVASPEVMKKYFIGSILSGGGSAPAPR  89

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ +EW DM++ FQK AL TRLGIP++YGIDA+HG+N VYGAT+FPH IGLGATR
Sbjct  90   ASPQEWVDMVNNFQKGALSTRLGIPLLYGIDAVHGHNTVYGATIFPHNIGLGATR  144



>gb|KJB83715.1| hypothetical protein B456_013G260700 [Gossypium raimondii]
Length=632

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C Y++PNAP+EDRVKDLLSRMTL+EKIGQM QI+R+VATP+ +  + +GSILS GGS P 
Sbjct  3    CTYKNPNAPIEDRVKDLLSRMTLQEKIGQMTQIERSVATPADLKSFSIGSILSAGGSVPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
              A   +WADM+D FQ+AALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GLGATR
Sbjct  63   QKALPADWADMVDKFQQAALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGLGATR  119



>gb|KFK34022.1| hypothetical protein AALP_AA5G091800 [Arabis alpina]
Length=1174

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++PNAPVE RVKDLLSRMTL EKIGQM QI+R VA+P+ ITD F+GS+L+   S P 
Sbjct  8    CVYKNPNAPVEARVKDLLSRMTLPEKIGQMTQIERTVASPTVITDSFIGSVLNAADSWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A S +WADMIDGFQ++AL +RLGIPIIYGIDAIHGNN+VYG+T+FPH IGLGATR
Sbjct  68   EDAKSSDWADMIDGFQRSALASRLGIPIIYGIDAIHGNNDVYGSTIFPHNIGLGATR  124


 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 2/128 (2%)
 Frame = +2

Query  131  RRMAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLG  310
            ++M  K E   CVY++P+APVE RV+DLLSRMTL EK+GQM QI+R V T   IT+ F+G
Sbjct  559  KKMGGKEER--CVYKNPDAPVEARVQDLLSRMTLPEKVGQMTQIERVVTTHPVITELFIG  616

Query  311  SILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPH  490
            S+L+GGGS P ++A + +WADMIDG+Q AAL + LGIPIIYGIDA+HGNNNVYGAT+FPH
Sbjct  617  SVLNGGGSWPFEDAKTSDWADMIDGYQNAALASPLGIPIIYGIDAVHGNNNVYGATIFPH  676

Query  491  FIGLGATR  514
             IGLGATR
Sbjct  677  NIGLGATR  684



>gb|KHN26387.1| Lysosomal beta glucosidase [Glycine soja]
Length=601

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P   +E RVKDLLSRMTL+EKIGQM QI+R VAT SAI D  +GSILS GGS P 
Sbjct  3    CVYKNPEEQIEARVKDLLSRMTLREKIGQMTQIERTVATSSAIRDLSIGSILSSGGSAPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADM+DGFQK+AL++RLGIP+IYGIDA+HGNN+VYG T+FPH IGLGATR
Sbjct  63   ENALSSDWADMVDGFQKSALQSRLGIPLIYGIDAVHGNNSVYGTTIFPHNIGLGATR  119



>ref|XP_006591200.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=630

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++P   +E RVKDLLSRMTL+EKIGQM QI+R VAT SAI D  +GSILS GGS P 
Sbjct  32   CVYKNPEEQIEARVKDLLSRMTLREKIGQMTQIERTVATSSAIRDLSIGSILSSGGSAPF  91

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADM+DGFQK+AL++RLGIP+IYGIDA+HGNN+VYG T+FPH IGLGATR
Sbjct  92   ENALSSDWADMVDGFQKSALQSRLGIPLIYGIDAVHGNNSVYGTTIFPHNIGLGATR  148



>ref|XP_010256653.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Nelumbo 
nucifera]
Length=527

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  146  KIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSG  325
            K E   C+YR+ N PVE RV+DLLSRM L+EK+GQM QI+R+VA PSAI D  +GS+LSG
Sbjct  3    KTEEPQCIYRNSNEPVEVRVRDLLSRMMLREKLGQMTQIERSVANPSAIRDLCIGSVLSG  62

Query  326  GGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLG  505
            GGS P D A++ +WADM+D FQKAA+++RLG+PI+Y  DA+HG+NNVYGAT+FPH IGLG
Sbjct  63   GGSAPFDGASATDWADMVDSFQKAAIQSRLGVPILYATDAVHGHNNVYGATIFPHNIGLG  122

Query  506  ATR  514
            ATR
Sbjct  123  ATR  125



>ref|XP_011032150.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=609

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +ES+ C+Y+DPN+P+E RVKDLLSRMTLKEK+ QM QI+R+VATP  + D  +GS+++ G
Sbjct  1    MESSSCIYKDPNSPIEARVKDLLSRMTLKEKVAQMTQIERSVATPHYLQDLGIGSVMNVG  60

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P  NA S +WADM+D FQK AL++RLGIPI+YGIDA+HGNN VYG T+FPH +GLGA
Sbjct  61   GSAPFSNAKSSDWADMVDWFQKLALQSRLGIPIVYGIDAVHGNNGVYGTTIFPHNVGLGA  120

Query  509  TR  514
            TR
Sbjct  121  TR  122



>ref|XP_004150629.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN65789.1| hypothetical protein Csa_1G528540 [Cucumis sativus]
Length=611

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+YR+P A +EDR+KDLLSRM+L+EKIGQM QI+R+V TPSA+TD  +GS+LSGG + P 
Sbjct  7    CMYRNPGAAIEDRIKDLLSRMSLREKIGQMTQIERSVVTPSALTDLAVGSVLSGGDNPPF  66

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            D A S +WADM+DGFQ  AL++RLGIPIIYGIDA+HG++NVYGAT+FPH +GLGATR
Sbjct  67   DKAMSLDWADMVDGFQSLALQSRLGIPIIYGIDAVHGSSNVYGATIFPHNVGLGATR  123



>ref|XP_010256654.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Nelumbo 
nucifera]
Length=632

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  KIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSG  325
            K E   C+YR+ N PVE RV+DLLSRM L+EK+GQM QI+R+VA PSAI D  +GS+LSG
Sbjct  3    KTEEPQCIYRNSNEPVEVRVRDLLSRMMLREKLGQMTQIERSVANPSAIRDLCIGSVLSG  62

Query  326  GGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLG  505
            GGS P D A++ +WADM+D FQKAA+++RLG+PI+Y  DA+HG+NNVYGAT+FPH IGLG
Sbjct  63   GGSAPFDGASATDWADMVDSFQKAAIQSRLGVPILYATDAVHGHNNVYGATIFPHNIGLG  122

Query  506  ATRFD  520
            ATR +
Sbjct  123  ATRLN  127



>ref|XP_010686158.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
Length=980

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+YR+PNAP+E+R+KDLLSRMTL+EK+ QM QI+R VA+ SAI D  +GSILS GGS P 
Sbjct  377  CIYRNPNAPIEERIKDLLSRMTLQEKLAQMTQIERRVASSSAIKDLGIGSILSAGGSAPF  436

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            D A S +WADMIDGFQK A+++RL IPIIYG+DA+HGNNNVYGAT+FPH + LGATR
Sbjct  437  DKALSSDWADMIDGFQKLAMDSRLAIPIIYGVDAVHGNNNVYGATIFPHNVNLGATR  493


 Score =   182 bits (462),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVYR+PNAP+E+R+KDLLSRMTL+EK+ QM QI+R+VA+  AI D  +GSILS GGS P 
Sbjct  5    CVYRNPNAPIEERIKDLLSRMTLQEKLAQMTQIERSVASSFAIKDLGIGSILSAGGSAPF  64

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            D A S +WAD+IDGFQK A+++RL IPIIYG+DA+HGNNNVYGAT+FPH + LGATR
Sbjct  65   DKALSSDWADIIDGFQKLAMDSRLAIPIIYGVDAVHGNNNVYGATIFPHNVNLGATR  121



>ref|XP_004500232.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=603

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y++PN P+E RVKDLLSRMTL +KI QM QI+R VATPS I+   +GSILS GGS P +
Sbjct  4    IYKNPNEPIEARVKDLLSRMTLNDKIAQMTQIERTVATPSLISHLSIGSILSSGGSAPFE  63

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            NA S +WADM+DGFQK+ALE+RLGIP+IYGIDA+HGNN+VYGAT+FPH +GLGATR
Sbjct  64   NAMSSDWADMVDGFQKSALESRLGIPLIYGIDAVHGNNSVYGATIFPHNVGLGATR  119



>ref|XP_010256651.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nelumbo 
nucifera]
Length=606

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  146  KIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSG  325
            K E   C+YR+ N PVE RV+DLLSRM L+EK+GQM QI+R+VA PSAI D  +GS+LSG
Sbjct  3    KTEEPQCIYRNSNEPVEVRVRDLLSRMMLREKLGQMTQIERSVANPSAIRDLCIGSVLSG  62

Query  326  GGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLG  505
            GGS P D A++ +WADM+D FQKAA+++RLG+PI+Y  DA+HG+NNVYGAT+FPH IGLG
Sbjct  63   GGSAPFDGASATDWADMVDSFQKAAIQSRLGVPILYATDAVHGHNNVYGATIFPHNIGLG  122

Query  506  ATR  514
            ATR
Sbjct  123  ATR  125



>ref|XP_010541442.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=611

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +  A CVYR+ +APVE RVKDLLSRMTL EKIGQM QI+R VA+P+AI D  +GSIL+ G
Sbjct  2    VGEASCVYRNAHAPVEARVKDLLSRMTLPEKIGQMTQIERRVASPAAIRDLSIGSILNAG  61

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P ++A + +WADMIDGFQ++AL +RLGIPIIYG DA+HGNNNV+G+T+FPH IGLG+
Sbjct  62   GSAPCEDAKASDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVFGSTIFPHNIGLGS  121

Query  509  TR  514
            TR
Sbjct  122  TR  123



>gb|KFK26304.1| hypothetical protein AALP_AA8G230300 [Arabis alpina]
Length=173

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +2

Query  158  AGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSK  337
            A   Y+DP  P+E R+KDL+SRMTL+EKIGQM+Q++R  AT   I  YF+GS+ SGGGS 
Sbjct  28   ANAKYKDPKEPLEVRIKDLMSRMTLEEKIGQMVQVERVNATTQVIKHYFIGSVFSGGGSV  87

Query  338  PSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            P+ NA+ E W +M++ FQK AL TRLGIPIIYGIDA+HG+NN Y AT+FPH IGLG TR
Sbjct  88   PTPNASPEAWVNMVNDFQKTALSTRLGIPIIYGIDAVHGHNNAYNATIFPHNIGLGVTR  146



>ref|XP_009757149.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=628

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN P+  R+KDL+SRMTL+EKIGQMIQIDR VATP A+  Y++GS+LSGGGS P   
Sbjct  29   YKDPNKPLGRRIKDLMSRMTLEEKIGQMIQIDRTVATPEAMKKYYIGSVLSGGGSVPKKE  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W DMI+GFQK +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLG TR
Sbjct  89   ASAENWIDMINGFQKGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGVTR  143



>ref|XP_006344039.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=604

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            VY++P+A +E+RV+DLLSRMTL+EKIGQM QI+R+VATPS ITD  +GSILS GGS P +
Sbjct  4    VYKNPSALIEERVQDLLSRMTLEEKIGQMAQIERSVATPSVITDLSIGSILSVGGSAPFE  63

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +A SE WADM+D FQKAALE+RLGIP++YG+DAIHGNNNVYGAT+FP  +GLGATR
Sbjct  64   DAPSEAWADMVDRFQKAALESRLGIPLLYGVDAIHGNNNVYGATIFPQNVGLGATR  119



>ref|XP_009610986.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=628

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN P+  R+KDL+SRMTL+EKIGQMIQIDR VATP A+  Y++GS+LSGGGS P   
Sbjct  29   YKDPNKPLGRRIKDLMSRMTLEEKIGQMIQIDRTVATPDAMKKYYIGSVLSGGGSVPKKE  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W DMI+GFQK +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLG TR
Sbjct  89   ASAENWIDMINGFQKGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGVTR  143



>gb|KDP46532.1| hypothetical protein JCGZ_08504 [Jatropha curcas]
Length=608

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+DPNAPVE RVKDLLSRMTLKEK+ QM QI+R  A+P  + D  +GS+L+ GGS P 
Sbjct  5    CIYKDPNAPVEARVKDLLSRMTLKEKVAQMTQIERRFASPYYLKDLAVGSVLNVGGSGPF  64

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WADM+DGFQK AL++RLGIPIIYGIDA+HGNN VYG T+FPH +GLGATR
Sbjct  65   ENALSSDWADMVDGFQKLALDSRLGIPIIYGIDAVHGNNGVYGTTIFPHNVGLGATR  121



>ref|XP_002877539.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53798.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=613

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E + CVY++ +APVE RVKDLLSRMTL EKIGQM  I+R+VA+ + I D+ +GS+L+  G
Sbjct  5    EKSSCVYKNRDAPVEARVKDLLSRMTLPEKIGQMTLIERSVASEAVIRDFSIGSVLNAAG  64

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P ++A S  WADMIDGFQ++ALE+RLGIPIIYGIDAIHGNN+VYGAT+FPH IGLGAT
Sbjct  65   SWPFEDAKSSNWADMIDGFQRSALESRLGIPIIYGIDAIHGNNDVYGATIFPHNIGLGAT  124

Query  512  R  514
            R
Sbjct  125  R  125



>gb|KGN65790.1| hypothetical protein Csa_1G528550 [Cucumis sativus]
Length=609

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E+  CVY++ +AP+E R+KDLLSRMTL+EKIGQM QI+R VATPSA+ D+ +GS+L+ G
Sbjct  1    MEATDCVYKNSSAPIEVRIKDLLSRMTLREKIGQMTQIERTVATPSALGDFAIGSVLNAG  60

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P   A S +WADMID FQ  A+++RLGIPIIYG DA+HGNNNVYGAT+FPH +GLGA
Sbjct  61   GSAPFRGALSSDWADMIDRFQSWAIQSRLGIPIIYGSDAVHGNNNVYGATIFPHNVGLGA  120

Query  509  TR  514
            TR
Sbjct  121  TR  122



>emb|CDP09158.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y++P AP+E RV+DLLSRMTL+EK+GQM QI+R+VATPS + D  +GSI+S GGS P +
Sbjct  4    IYKNPTAPIEARVQDLLSRMTLEEKLGQMTQIERSVATPSVLKDRCIGSIMSVGGSGPIE  63

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A + +WADM+D FQKAALE+RLGIPI+YGIDA+HGNNNVYGAT+FPH +GLGATR
Sbjct  64   MALTSDWADMVDNFQKAALESRLGIPILYGIDAVHGNNNVYGATIFPHNVGLGATR  119



>ref|XP_004169524.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Cucumis sativus]
Length=609

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E+  CVY++ +AP+E R+KDLLSRMTL+EKIGQM QI+R VATPSA+ D+ +GS+L+ G
Sbjct  1    MEATDCVYKNSSAPIEVRIKDLLSRMTLREKIGQMTQIERTVATPSALGDFAIGSVLNAG  60

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P   A S +WADMID FQ  A+++RLGIPIIYG DA+HGNNNVYGAT+FPH +GLGA
Sbjct  61   GSAPFRGALSSDWADMIDRFQSWAIQSRLGIPIIYGSDAVHGNNNVYGATIFPHNVGLGA  120

Query  509  TR  514
            TR
Sbjct  121  TR  122



>ref|XP_004150625.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
Length=609

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E+  CVY++ +AP+E R+KDLLSRMTL+EKIGQM QI+R VATPSA+ D+ +GS+L+ G
Sbjct  1    MEATDCVYKNSSAPIEVRIKDLLSRMTLREKIGQMTQIERTVATPSALGDFAIGSVLNAG  60

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P   A S +WADMID FQ  A+++RLGIPIIYG DA+HGNNNVYGAT+FPH +GLGA
Sbjct  61   GSAPFRGALSSDWADMIDRFQSWAIQSRLGIPIIYGSDAVHGNNNVYGATIFPHNVGLGA  120

Query  509  TR  514
            TR
Sbjct  121  TR  122



>ref|XP_008457393.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Cucumis 
melo]
Length=612

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E+  C+Y++ +AP+E R+KDLLSRMTL+EKIGQM QI+R VATPSA+ D+ +GS+L+ G
Sbjct  1    MEATDCIYKNSSAPIEARIKDLLSRMTLREKIGQMTQIERTVATPSALGDFAIGSVLNSG  60

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P   A S +WADMID FQ  A+++RLGIPIIYG DA+HGNNNVYGAT+FPH +GLGA
Sbjct  61   GSAPFRGALSSDWADMIDRFQYWAIQSRLGIPIIYGSDAVHGNNNVYGATIFPHNVGLGA  120

Query  509  TR  514
            TR
Sbjct  121  TR  122



>emb|CDP22140.1| unnamed protein product [Coffea canephora]
Length=143

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  140  AEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSIL  319
            A K E+    Y+ P  P+  R+KDLLSRMTL+EKIGQM+QIDR++A+   +  Y++GS+L
Sbjct  19   AMKAEAEYLPYKGPKQPLNTRIKDLLSRMTLEEKIGQMVQIDRSIASREIMKKYYIGSVL  78

Query  320  SGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIG  499
            SGGGS P+  A+ E W DM++ FQK +L TRLGIP+IYGIDA+HG+N VY ATVFPH IG
Sbjct  79   SGGGSVPAKQASPETWVDMVNDFQKGSLSTRLGIPMIYGIDAVHGHNTVYKATVFPHNIG  138

Query  500  LGATR  514
            LGATR
Sbjct  139  LGATR  143



>gb|EYU45756.1| hypothetical protein MIMGU_mgv1a003116mg [Erythranthe guttata]
Length=607

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y+DPNA ++ R+KDL+S+M+L EKIGQM QI+R VATPSAI +  +GSILS GGS P 
Sbjct  3    CIYKDPNAAIDARLKDLISQMSLAEKIGQMTQIERTVATPSAIKNLSIGSILSVGGSGPF  62

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +NA S +WA M+D FQKAALE+RLGIP++YG DA+HGNNNVYGAT+FPH +GLGATR
Sbjct  63   ENAESADWAAMVDSFQKAALESRLGIPVLYGTDAVHGNNNVYGATIFPHNVGLGATR  119



>ref|XP_011016630.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
 ref|XP_011016631.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
 ref|XP_011016632.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=222

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  R+KDL+ RMTL+EKIGQM+QI+R VATP  +  YF+GS+LSGGGS P   
Sbjct  28   YKDPKMPVGARIKDLMKRMTLEEKIGQMVQIERTVATPDVMKQYFIGSVLSGGGSVPGPK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QKA+L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  88   ASAEAWVNLVNGIQKASLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  142



>ref|XP_008457394.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Cucumis 
melo]
Length=604

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E+  C+Y++ +AP+E R+KDLLSRMTL+EKIGQM QI+R VATPSA+ D+ +GS+L+ G
Sbjct  1    MEATDCIYKNSSAPIEARIKDLLSRMTLREKIGQMTQIERTVATPSALGDFAIGSVLNSG  60

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P   A S +WADMID FQ  A+++RLGIPIIYG DA+HGNNNVYGAT+FPH +GLGA
Sbjct  61   GSAPFRGALSSDWADMIDRFQYWAIQSRLGIPIIYGSDAVHGNNNVYGATIFPHNVGLGA  120

Query  509  TR  514
            TR
Sbjct  121  TR  122



>ref|XP_009395658.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=623

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PV  RVKDLL RMTL EKIGQM QI+R V+TP  + DYF+GSILSGGGS PS  
Sbjct  21   YKDPNQPVNVRVKDLLKRMTLAEKIGQMTQIEREVSTPQVLKDYFIGSILSGGGSVPSPR  80

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++++W DMI  FQK  L TRLGIP+IYGIDA+HGNNNVY AT+FPH IGLGATR
Sbjct  81   ASAKDWVDMIYKFQKVCLSTRLGIPMIYGIDAVHGNNNVYNATIFPHNIGLGATR  135



>gb|ADC55526.1| beta-D-glucan glucohydrolase precursor [synthetic construct]
Length=607

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  6    LYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  65

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQKA + TRLGIP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  66   GATAKEWQDMVDGFQKACMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  125



>pdb|1LQ2|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
 pdb|1X38|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
 pdb|1X39|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
Length=602

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  4    LYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  63

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQKA + TRLGIP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  64   GATAKEWQDMVDGFQKACMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  123



>ref|XP_006445677.1| hypothetical protein CICLE_v100182712mg, partial [Citrus clementina]
 gb|ESR58917.1| hypothetical protein CICLE_v100182712mg, partial [Citrus clementina]
Length=278

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  PVE RVKDLLSRMTL EKIGQM QI+R  AT  A+ +YF+GS+LSGGGS PS 
Sbjct  2    IYKDPKQPVEVRVKDLLSRMTLAEKIGQMTQIERVNATFDAMKNYFIGSVLSGGGSVPSP  61

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            NA +++W DM++  Q+ A+ TRLGIP+IYG+DA+HG+NNVY AT+FPH +GLGATR
Sbjct  62   NATAQQWIDMVNDIQRGAMATRLGIPMIYGVDAVHGHNNVYKATIFPHNVGLGATR  117



>pdb|1EX1|A Chain A, Beta-D-Glucan Exohydrolase From Barley
 pdb|1IEX|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With 4i,4iii,4v-S-Trithiocellohexaose
 pdb|1IEW|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With 2-Deoxy-2-Fluoro-Alpha-D-Glucoside
 pdb|1IEV|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With Cyclohexitol
 pdb|1IEQ|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1
 pdb|1J8V|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase 
Isoenzyme Exo1 In Complex With 4'-Nitrophenyl 3i-Thiolaminaritrioside
Length=605

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  4    LYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  63

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQKA + TRLGIP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  64   GATAKEWQDMVDGFQKACMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  123



>dbj|BAK05680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=630

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  29   LYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  88

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQKA + TRLGIP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  89   GATAKEWQDMVDGFQKACMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  148



>ref|XP_006290765.1| hypothetical protein CARUB_v10016871mg [Capsella rubella]
 gb|EOA23663.1| hypothetical protein CARUB_v10016871mg [Capsella rubella]
Length=605

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            VY++ +APVE RVKDLL+RMTL EKIGQM QI+R+VA+P  I D F+GS+ SG GS P +
Sbjct  6    VYKNRDAPVEARVKDLLTRMTLPEKIGQMTQIERSVASPQVIKDSFIGSVQSGAGSWPFE  65

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +A S +WADMIDGFQ+ AL +RLGIPIIYG DA+HGNNNVYGATVFPH IGLGATR
Sbjct  66   DAKSSDWADMIDGFQRLALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIGLGATR  121



>gb|AAD23382.1|AF102868_1 beta-D-glucan exohydrolase isoenzyme ExoI [Hordeum vulgare subsp. 
vulgare]
Length=630

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  29   LYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  88

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQKA + TRLGIP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  89   GATAKEWQDMVDGFQKACMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  148



>dbj|BAJ96045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=655

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  54   LYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  113

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQKA + TRLGIP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  114  GATAKEWQDMVDGFQKACMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  173



>ref|XP_006495449.1| PREDICTED: lysosomal beta glucosidase-like, partial [Citrus sinensis]
Length=266

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  PVE RVKDLLSRMTL EKIGQM QI+R  AT  A+ +YF+GS+LSGGGS PS 
Sbjct  13   IYKDPKQPVEVRVKDLLSRMTLAEKIGQMTQIERVNATFDAMKNYFIGSVLSGGGSVPSP  72

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            NA +++W DM++  Q+ A+ TRLGIP+IYG+DA+HG+NNVY AT+FPH +GLGATR
Sbjct  73   NATAQQWIDMVNDIQRGAMATRLGIPMIYGVDAVHGHNNVYKATIFPHNVGLGATR  128



>ref|XP_004172885.1| PREDICTED: lysosomal beta glucosidase-like, partial [Cucumis 
sativus]
Length=221

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM+QI+RAVATP  + +YF+GS+LSGGGS P++ 
Sbjct  29   YKDPKQPLGARIKDLMGRMTLEEKIGQMVQIERAVATPDVMKNYFIGSVLSGGGSVPAEK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +M++  QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  89   ASAETWVNMVNEIQKGSLATRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  143



>gb|EMS53026.1| Lysosomal beta glucosidase [Triticum urartu]
Length=631

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   PVE RV DLL RMTL EK+GQM QI+R VATP  + D F+GS+LSGGG
Sbjct  24   EADHALYKDAAQPVEARVADLLGRMTLAEKVGQMTQIERLVATPEVLRDNFIGSLLSGGG  83

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P   A ++EWADM+DGFQ+A + TRLGIP+IYGIDA+HGNNNVYGAT+FPH +GLGAT
Sbjct  84   SVPRKGATAKEWADMVDGFQRACMSTRLGIPMIYGIDAVHGNNNVYGATIFPHNVGLGAT  143

Query  512  R  514
            R
Sbjct  144  R  144



>ref|XP_009622673.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=605

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            C+Y++ +AP+E RVKDLLSRMTL+EKIGQM QI+R VA PS I D  +GSILS GGS P 
Sbjct  4    CIYKNSSAPIEARVKDLLSRMTLQEKIGQMTQIERTVAAPSVIRDLSIGSILSVGGSAPF  63

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A SE WA+M+DGFQ AAL +RLGIP++YG+DAIHGNNNVYGAT+FP  +GLGATR
Sbjct  64   EDAPSEAWAEMVDGFQNAALGSRLGIPLLYGVDAIHGNNNVYGATIFPQNVGLGATR  120



>gb|EMT26942.1| Periplasmic beta-glucosidase [Aegilops tauschii]
Length=527

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  76   LYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  135

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQ+A + TRL IP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  136  GATAKEWQDMVDGFQRACMSTRLAIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  195



>ref|XP_008446716.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Cucumis melo]
Length=777

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 114/162 (70%), Gaps = 2/162 (1%)
 Frame = +2

Query  29   LQVKLPEIGIRTPFRILHGAKSKLTVTPAVRIGRRRMAEKIESAGCVYRDPNAPVEDRVK  208
            L  K  E G+ T  + +  AK  + V   + +G    A  +++    Y+DP  PV  RVK
Sbjct  104  LLWKWKECGLNTQAKKM--AKIFVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVK  161

Query  209  DLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDNAASEEWADMIDGF  388
            DLL RMTL+EKIGQM+QIDR+VA  + + DYF+GSILSGGGS P  +A +E+W DMI+ F
Sbjct  162  DLLGRMTLEEKIGQMVQIDRSVANATVMKDYFIGSILSGGGSVPLPDARAEDWVDMINDF  221

Query  389  QKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            QK +L +RLGIP+ YGIDA+HG+NNVY ATVFPH +GLGATR
Sbjct  222  QKGSLSSRLGIPMFYGIDAVHGHNNVYNATVFPHNVGLGATR  263


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLG  310
            Y DP  PV  RVKDLL  MTL+EKI QM QIDR+VA  +   + F+G
Sbjct  9    YEDPRQPVFVRVKDLLGPMTLEEKISQMAQIDRSVANATVTKNSFIG  55



>ref|XP_010493212.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=624

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R+VATP A+  YF+GS+LSGGGS PS+ 
Sbjct  26   YKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERSVATPEAMQKYFIGSVLSGGGSVPSEK  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++G QKAAL TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  86   ATPETWVNMVNGIQKAALSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  140



>dbj|BAJ97948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=638

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   PVE RV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGG
Sbjct  24   EADYALYKDAAQPVEARVADLLGRMTLAEKIGQMTQIERLVATPEVLRDNFIGSLLSGGG  83

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P   A  +EWADM+DGFQ+A + TRLGIP+IYGIDA+HGNNNVYGAT+FPH +GLGAT
Sbjct  84   SVPRKGATVKEWADMVDGFQRACMSTRLGIPMIYGIDAVHGNNNVYGATIFPHNVGLGAT  143

Query  512  R  514
            R
Sbjct  144  R  144



>ref|XP_002313393.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
 gb|EEE87348.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
Length=603

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 99/122 (81%), Gaps = 6/122 (5%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +ES+ C+Y+DPN+P+E RVKDLLSRMTLKEK+ QM QI+R+      + DY +GS+++ G
Sbjct  1    MESSSCIYKDPNSPIEARVKDLLSRMTLKEKVAQMTQIERS------LVDYLVGSVMNAG  54

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P  NA S +WADM+D FQK AL++RLGIPIIYGIDA+HGNN VYG T+FPH +GLGA
Sbjct  55   GSAPFPNAKSSDWADMVDWFQKLALQSRLGIPIIYGIDAVHGNNGVYGTTIFPHNVGLGA  114

Query  509  TR  514
            TR
Sbjct  115  TR  116



>gb|AFW67618.1| hypothetical protein ZEAMMB73_549956 [Zea mays]
Length=168

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+D +  VE RV+DLL+RMTL EK+GQM QI+R VA+P  + DY++GS+LSGGGS P   
Sbjct  27   YKDASKDVEVRVRDLLARMTLAEKVGQMTQIERLVASPQVLRDYYIGSLLSGGGSVPRKQ  86

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A + EW  M+  FQ+A L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLGATR
Sbjct  87   ATAAEWVAMVGDFQRACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGATR  141



>ref|XP_004236622.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
 ref|XP_010319196.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=631

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN P+  R+KDL+ RM+L+EKIGQMIQIDR  ATP  +  Y+LGS+LSGGGS P   
Sbjct  33   YKDPNKPLNRRIKDLMKRMSLEEKIGQMIQIDRTAATPEVMNKYYLGSVLSGGGSVPKKE  92

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W DMI+GFQK +L TRLGIP+IYGIDA+HGNNNVY AT+FPH + LG TR
Sbjct  93   ASAEDWIDMINGFQKGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVALGVTR  147



>emb|CDP21297.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  140  AEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSIL  319
            A K E+    Y+DP  P+  R+KDLLSRMTL+EKIGQM+QIDR+VA+   +  Y++GS+L
Sbjct  19   AMKAEAEYLPYKDPKQPINTRIKDLLSRMTLEEKIGQMVQIDRSVASGEIMKKYYIGSVL  78

Query  320  SGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIG  499
            SGGGS P+  A+ E W DM++ FQK +L TRLGIP+IYGIDA+HG+N VY ATVFPH IG
Sbjct  79   SGGGSVPAKQASPETWVDMVNDFQKGSLSTRLGIPMIYGIDAVHGHNTVYKATVFPHNIG  138

Query  500  LGATR  514
            LGATR
Sbjct  139  LGATR  143



>ref|XP_008344987.1| PREDICTED: lysosomal beta glucosidase-like, partial [Malus domestica]
Length=225

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL+ RMTL EKIGQM QI+R+VATP  +  YF+GS+LSGGGS+P+  
Sbjct  32   YKDPKQPLNARIRDLMKRMTLAEKIGQMTQIERSVATPDVMNKYFIGSVLSGGGSEPAPK  91

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  92   ASAEAWVNLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  146



>ref|XP_007206306.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
 gb|EMJ07505.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
Length=647

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+A   Y+DP  P+  R++DL+ RMTL+EKIGQM+QI+R+VATP A+T YF+GS+LSGGG
Sbjct  23   EAAYLKYKDPKQPLNVRIRDLMKRMTLEEKIGQMVQIERSVATPDAMTKYFIGSVLSGGG  82

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P+  A++E W ++++G QK +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLGAT
Sbjct  83   SVPAPKASAEAWVNLVNGIQKGSLSTRLGIPMIYGIDAVHGNNNVYNATIFPHNVGLGAT  142

Query  512  R  514
            R
Sbjct  143  R  143



>emb|CDP10536.1| unnamed protein product [Coffea canephora]
Length=176

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV+ RVKDL+SRMTL EKIGQM QIDR VA+   + +Y++GS+ +GG S   + 
Sbjct  58   YKDPKQPVDVRVKDLMSRMTLAEKIGQMSQIDRVVASAEVVRNYYIGSVFNGGESLLPNR  117

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W DM++ FQK AL TRLGIPIIYGIDAIHGNN+VYGATVFPH IGLGA R
Sbjct  118  ATPETWMDMVNEFQKGALSTRLGIPIIYGIDAIHGNNDVYGATVFPHNIGLGAAR  172



>ref|XP_007016181.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY33800.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=606

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +2

Query  146  KIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSG  325
            K+E   CVY++PNAP+EDR+K+L+S MTL+EKIGQM QI+  VATPS + D  +GS++SG
Sbjct  3    KLEEMSCVYKNPNAPIEDRIKNLVSGMTLQEKIGQMTQIELCVATPSDVRDLSIGSMISG  62

Query  326  GGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLG  505
            GG  P + A   +WAD +D FQ+AAL++RLGIP+IYGIDA+HGNN  YGAT+FPH IGLG
Sbjct  63   GGKPPLEKATPSDWADTLDRFQQAALDSRLGIPLIYGIDAVHGNNRFYGATIFPHNIGLG  122

Query  506  ATR  514
            ATR
Sbjct  123  ATR  125



>ref|XP_006350208.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=631

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN P+  R+KDL+ RMTL+EKIGQMIQIDR  ATP  +  Y+LGS+LSGGGS P   
Sbjct  33   YKDPNKPLNRRIKDLMKRMTLEEKIGQMIQIDRTAATPKVMNKYYLGSVLSGGGSVPKKE  92

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W DMI+GFQK +L TRLGIP+IYGIDA+HGNNNVY AT+FPH + LG  R
Sbjct  93   ASAEDWIDMINGFQKGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVALGVIR  147



>gb|EMS53504.1| Lysosomal beta glucosidase [Triticum urartu]
Length=651

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVEDRV DLL RMTL EKIGQM QI+R VATP  + D F+GS+LSGGGS P  
Sbjct  80   LYKDAAKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRK  139

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYF  526
             A ++EW DM+DGFQ+A + TRL IP+IYGIDA+HG NNVYGAT+FPH +GLGATR  Y 
Sbjct  140  GATAKEWQDMVDGFQRACMSTRLAIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYL  199



>ref|XP_008446717.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Cucumis melo]
Length=658

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   AKSKLTVTPAVRIGRRRMAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQID  265
            AK  + V   + +G    A  +++    Y+DP  PV  RVKDLL RMTL+EKIGQM+QID
Sbjct  2    AKIFVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVKDLLGRMTLEEKIGQMVQID  61

Query  266  RAVATPSAITDYFLGSILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDA  445
            R+VA  + + DYF+GSILSGGGS P  +A +E+W DMI+ FQK +L +RLGIP+ YGIDA
Sbjct  62   RSVANATVMKDYFIGSILSGGGSVPLPDARAEDWVDMINDFQKGSLSSRLGIPMFYGIDA  121

Query  446  IHGNNNVYGATVFPHFIGLGATR  514
            +HG+NNVY ATVFPH +GLGATR
Sbjct  122  VHGHNNVYNATVFPHNVGLGATR  144



>ref|XP_010456613.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=675

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGGGS PS+ 
Sbjct  26   YKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERSVATPEVMQKYFIGSVLSGGGSVPSEK  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++G QKAAL TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  86   ATPETWVNMVNGIQKAALSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  140



>gb|ACR35273.1| unknown [Zea mays]
Length=226

 Score =   166 bits (419),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+D +  VE RV+DLL+RMTL EK+GQM QI+R VA+P A+ DY++GS+LSGGGS P   
Sbjct  34   YQDASKDVEVRVRDLLARMTLAEKVGQMTQIERIVASPQALRDYYIGSLLSGGGSVPRKQ  93

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A + EW  M+  FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLGATR
Sbjct  94   ATAAEWVAMVSDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGATR  148



>ref|XP_010908052.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=660

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DPN PV  R+ DL+ RMTL EKIGQM QI+R VA+   + DYF+GS+LSGGGS P+ 
Sbjct  28   IYKDPNQPVNARIDDLVKRMTLAEKIGQMTQIERKVASAKVMKDYFIGSVLSGGGSVPAS  87

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A++E+W +M++ FQK +L TRLGIP+IYGIDA+HGNNNVYGAT+FPH IGLGATR
Sbjct  88   QASAEDWVNMVNEFQKGSLSTRLGIPMIYGIDAVHGNNNVYGATIFPHNIGLGATR  143



>ref|XP_010420941.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=676

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGGGS PS+ 
Sbjct  78   YKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERSVATPEVMQKYFIGSVLSGGGSVPSEK  137

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++G QKAAL TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  138  ATPETWVNMVNGIQKAALSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  192



>gb|EPS72736.1| hypothetical protein M569_02021, partial [Genlisea aurea]
Length=609

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D NAP+EDR++DLLS+MTL+EKIGQM QI+R VAT SAI D  +GSILS  G
Sbjct  1    EAMKSIYKDANAPIEDRIQDLLSKMTLQEKIGQMTQIERRVATASAIRDLAVGSILSFAG  60

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P +NA S +WA M++G+QK AL +RLGIP++YG DA+HGNNNVYGAT+FPH IGLGAT
Sbjct  61   SAPFENARSSDWASMVNGYQKLALGSRLGIPLLYGTDAVHGNNNVYGATIFPHNIGLGAT  120

Query  512  R  514
            R
Sbjct  121  R  121



>ref|XP_008230878.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=630

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+A   Y+DP  P+  R++DL+ RMTL+EKIGQM+QI+R+VATP A+  YF+GS+LSGGG
Sbjct  23   EAAYLKYKDPKQPLNVRIRDLMKRMTLEEKIGQMVQIERSVATPDAMNKYFIGSVLSGGG  82

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P+  A++E W ++++G QK +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLGAT
Sbjct  83   SVPAPKASAEAWVNLVNGIQKGSLSTRLGIPMIYGIDAVHGNNNVYNATIFPHNVGLGAT  142

Query  512  R  514
            R
Sbjct  143  R  143



>ref|XP_010229891.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Brachypodium 
distachyon]
Length=653

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            + AG +Y+DP  PVE RV DLL +MTL EKIGQM QI+R VATP  + +YF+GS+LSGGG
Sbjct  46   DYAGPLYKDPAQPVEARVADLLGKMTLAEKIGQMTQIERLVATPDVLRNYFVGSLLSGGG  105

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P   A + EW  M++ FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLGAT
Sbjct  106  SVPRKGATAAEWVAMVNDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGAT  165

Query  512  RFDYF  526
            R  Y 
Sbjct  166  RDPYL  170



>ref|XP_010923121.1| PREDICTED: lysosomal beta glucosidase-like [Elaeis guineensis]
Length=618

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MA ++E    +Y+DPN PVE RV+DLLSRMTL EK GQM QI+R+VA+P+A+T  F+GS+
Sbjct  11   MANEVEVV--LYKDPNQPVEARVRDLLSRMTLAEKAGQMAQIERSVASPAALTGRFIGSV  68

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            L+  GS P + A++EEWA+M+D  Q+ AL +RLGIPIIYG DA+HGNNN+YGAT+FPH +
Sbjct  69   LNACGSAPRERASAEEWAEMVDEMQRWALASRLGIPIIYGTDAVHGNNNLYGATIFPHNV  128

Query  497  GLGATR  514
            GLGATR
Sbjct  129  GLGATR  134



>ref|XP_003559552.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010229896.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010229899.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Brachypodium 
distachyon]
Length=630

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            + AG +Y+DP  PVE RV DLL +MTL EKIGQM QI+R VATP  + +YF+GS+LSGGG
Sbjct  23   DYAGPLYKDPAQPVEARVADLLGKMTLAEKIGQMTQIERLVATPDVLRNYFVGSLLSGGG  82

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P   A + EW  M++ FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLGAT
Sbjct  83   SVPRKGATAAEWVAMVNDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGAT  142

Query  512  RFDYF  526
            R  Y 
Sbjct  143  RDPYL  147



>ref|XP_006286473.1| hypothetical protein CARUB_v10000466mg [Capsella rubella]
 gb|EOA19371.1| hypothetical protein CARUB_v10000466mg [Capsella rubella]
Length=624

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGGGS PS+ 
Sbjct  26   YKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERSVATPEVMQKYFIGSVLSGGGSVPSEK  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++G QKA+L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  86   ATPETWVNMVNGIQKASLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  140



>ref|XP_010253611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104594813 
[Nelumbo nucifera]
Length=1760

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            +A    +A  +Y+DPNAPVE RV DLLSRM+L EKIGQM+QIDR++A+P  + D  +GS+
Sbjct  35   IAATTTTAPPLYKDPNAPVESRVSDLLSRMSLSEKIGQMVQIDRSLASPDVLRDLAIGSV  94

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            L+GG S P+ ++    WADMIDGFQKAAL TRLGIPI YGIDA+HG+NNV+GATVFPH I
Sbjct  95   LNGGDSAPAPDSTPAMWADMIDGFQKAALSTRLGIPIFYGIDAVHGHNNVFGATVFPHNI  154

Query  497  GLGAT  511
            GLGAT
Sbjct  155  GLGAT  159


 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  137   MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
             +A    +A  +Y+DPNAPVE RV DLLSRM+L EKIGQM QIDR++A+P  + D  +GS+
Sbjct  1100  IAATTTTAQPLYKDPNAPVESRVSDLLSRMSLSEKIGQMAQIDRSIASPDVLRDLAIGSV  1159

Query  317   LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
             L+GG +  + ++    WADMIDGFQKAAL TRLGIPI YG DA+HG+NNV+GATV PH I
Sbjct  1160  LNGGVTALAPDSTPAMWADMIDGFQKAALSTRLGIPIFYGTDAVHGHNNVFGATVXPHNI  1219

Query  497   GLGATR  514
              LGATR
Sbjct  1220  ILGATR  1225



>ref|XP_009412935.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=628

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PV+ R++DL+ RMTL EKIGQM QI+R VATP  + D+F+GS+LSGGGS P+  
Sbjct  28   YKDPNQPVKWRIRDLMQRMTLAEKIGQMTQIERKVATPQIMKDFFIGSVLSGGGSVPAPR  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W DMI+ FQ+ +L TRLGIP+IYGIDA+HGNNNVY AT+FPH IGLGATR
Sbjct  88   ASAEAWVDMINEFQRGSLSTRLGIPMIYGIDAVHGNNNVYNATMFPHNIGLGATR  142



>emb|CAN81230.1| hypothetical protein VITISV_033665 [Vitis vinifera]
Length=639

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 101/148 (68%), Gaps = 31/148 (21%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDY--------------  301
            C+Y+DPN P+E R+KDLLSRMTLKEK GQM QI+R VATPS + D               
Sbjct  3    CIYKDPNQPIEARIKDLLSRMTLKEKAGQMTQIERRVATPSVLKDLSIGTIHLIMQYALM  62

Query  302  -----------------FLGSILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPII  430
                             F GSILS GGS P D A S +WADM+DGFQK+ALE+RLGIP++
Sbjct  63   DCVLLCIFFIQLVVLILFSGSILSAGGSGPFDKALSADWADMVDGFQKSALESRLGIPLL  122

Query  431  YGIDAIHGNNNVYGATVFPHFIGLGATR  514
            YGIDA+HGNN++YGAT+FPH +GLGATR
Sbjct  123  YGIDAVHGNNSIYGATIFPHNVGLGATR  150



>ref|XP_006400663.1| hypothetical protein EUTSA_v10015493mg, partial [Eutrema salsugineum]
 gb|ESQ42116.1| hypothetical protein EUTSA_v10015493mg, partial [Eutrema salsugineum]
Length=176

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  140  AEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSIL  319
            A K   A   Y+DP  P+  R+K+L+S MTL+EKIGQM+Q++RA AT   I +YF+GS+L
Sbjct  22   ANKEPLANAKYKDPTEPLGVRIKNLMSHMTLEEKIGQMVQVERANATSEVIKNYFIGSVL  81

Query  320  SGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIG  499
            SGGGS P+  A  E W +M++  QKAAL TRLGIP+IYGIDA+HG+NN Y AT+FPH IG
Sbjct  82   SGGGSVPAPKATPEAWVNMVNEIQKAALSTRLGIPMIYGIDAVHGHNNAYNATIFPHNIG  141

Query  500  LGATR  514
            LG TR
Sbjct  142  LGVTR  146



>ref|XP_004135054.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN52155.1| hypothetical protein Csa_5G612840 [Cucumis sativus]
Length=658

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   AKSKLTVTPAVRIGRRRMAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQID  265
            AK  + V   + +G    A  +++    Y+DP  PV  RVKDLL RMTL+EKIGQM+QID
Sbjct  2    AKIFVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVKDLLGRMTLEEKIGQMVQID  61

Query  266  RAVATPSAITDYFLGSILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDA  445
            R+VA  + + DYF+GS+LSGGGS P  +A +E+W +MI+ FQK +L +RLGIP+ YGIDA
Sbjct  62   RSVANATVMKDYFIGSVLSGGGSVPLPDARAEDWVNMINDFQKGSLSSRLGIPMFYGIDA  121

Query  446  IHGNNNVYGATVFPHFIGLGATR  514
            +HG+NNVY ATVFPH +GLGATR
Sbjct  122  VHGHNNVYNATVFPHNVGLGATR  144



>ref|NP_001078254.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AEE78238.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=447

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            VY++  APVE RVKDLLSRMTL EKIGQM  I+R+VA+ + I D+ +GS+L+  G  P +
Sbjct  9    VYKNREAPVEARVKDLLSRMTLAEKIGQMTLIERSVASEAVIRDFSIGSVLNRAGGWPFE  68

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +A S  WADMIDGFQ++ALE+RLGIPIIYGIDA+HGNN+VYGAT+FPH IGLGATR
Sbjct  69   DAKSSNWADMIDGFQRSALESRLGIPIIYGIDAVHGNNDVYGATIFPHNIGLGATR  124



>gb|ABF98889.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
Length=404

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   PVE RV DLL+RMTL EKIGQM QI+R VA+P  + DYF+GS+LSGGG
Sbjct  22   EAQYVLYKDATKPVEARVTDLLARMTLAEKIGQMTQIERQVASPQVLKDYFIGSLLSGGG  81

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P   A + EW  M+  FQK +L TRLGIP+IYGIDA+HG+NNVYGAT+FPH + LGAT
Sbjct  82   SVPRKQATAAEWVSMVSDFQKGSLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVALGAT  141

Query  512  R  514
            R
Sbjct  142  R  142



>ref|XP_004159282.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Cucumis sativus]
Length=658

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  86   AKSKLTVTPAVRIGRRRMAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQID  265
            AK  + V   + +G    A  +++    Y+DP  PV  RVKDLL RMTL+EKIGQM+QID
Sbjct  2    AKIFVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVKDLLGRMTLEEKIGQMVQID  61

Query  266  RAVATPSAITDYFLGSILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDA  445
            R+VA  + + DYF+GS+LSGGGS P  +A +E+W +MI+ FQK +L +RLGIP+ YGIDA
Sbjct  62   RSVANATVMKDYFIGSVLSGGGSVPLPDARAEDWVNMINDFQKGSLSSRLGIPMFYGIDA  121

Query  446  IHGNNNVYGATVFPHFIGLGATR  514
            +HG+NNVY ATVFPH +GLGATR
Sbjct  122  VHGHNNVYNATVFPHNVGLGATR  144



>dbj|BAF00158.1| beta-D-glucan exohydrolase - like protein [Arabidopsis thaliana]
Length=457

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            VY++  APVE RVKDLLSRMTL EKIGQM  I+R+VA+ + I D+ +GS+L+  G  P +
Sbjct  19   VYKNREAPVEARVKDLLSRMTLAEKIGQMTLIERSVASEAVIRDFSIGSVLNRAGGWPFE  78

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +A S  WADMIDGFQ++ALE+RLGIPIIYGIDA+HGNN+VYGAT+FPH IGLGATR
Sbjct  79   DAKSSNWADMIDGFQRSALESRLGIPIIYGIDAVHGNNDVYGATIFPHNIGLGATR  134



>gb|EYU39164.1| hypothetical protein MIMGU_mgv1a019891mg, partial [Erythranthe 
guttata]
Length=369

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P++ RVKDL+ RMTL+EKIGQM QI+R VA+P  +  YF+GSI+SGGGS P+  
Sbjct  28   YKDPKQPLKVRVKDLMKRMTLEEKIGQMTQIEREVASPDIMKKYFIGSIVSGGGSVPAPR  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ EEW +M++GFQ  +L TRLGIP+IYGIDAIHG+NNVY AT+FPH +GLG TR
Sbjct  88   ASPEEWVNMVNGFQNGSLSTRLGIPMIYGIDAIHGHNNVYNATIFPHNVGLGVTR  142



>ref|XP_010452390.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=665

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV+DL  RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  26   LYKDPKQTVSDRVEDLFGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  85

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A ++ W DMI+G+QK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  86   EATAQNWVDMINGYQKGALVSRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  141



>ref|XP_008240500.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=636

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            YRDP  P+  R+KDL+SRMTL+EKIGQM+QIDR+VA+   +  YF+GSILSGGGS P+  
Sbjct  36   YRDPKQPLNSRIKDLVSRMTLEEKIGQMVQIDRSVASAEVMKKYFIGSILSGGGSVPAQK  95

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +M++ FQK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  96   ASAETWINMVNDFQKGSLSTRLGIPLIYGIDAVHGHNNVYKATIFPHNIGLGATR  150



>emb|CDP15627.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PV  RV+DLLSRMTL+EKIGQM QIDR +++   +  YF+GS+LSGGGS PS  
Sbjct  28   YKDPNRPVNVRVRDLLSRMTLEEKIGQMTQIDRKISSKEIMKKYFIGSVLSGGGSYPSPT  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +MI+ FQ+ AL TRLGIP+IYGIDAIHGNNNVY AT+FPH IGLG TR
Sbjct  88   ASAETWINMINEFQEGALSTRLGIPMIYGIDAIHGNNNVYNATIFPHNIGLGVTR  142



>ref|XP_010923122.1| PREDICTED: lysosomal beta glucosidase-like [Elaeis guineensis]
Length=612

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PVE RV+DLLSRMTL EK GQ+ QI+R++A+P+A+T  F+GS+L+ GGS P + 
Sbjct  10   YKDPNQPVEARVRDLLSRMTLAEKAGQVAQIERSIASPAALTGRFIGSVLNAGGSAPRER  69

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++EEWA+M+D  Q+ AL +RLGIPIIYG DA+HGNNN+YGAT+FPH +GLGATR
Sbjct  70   ASAEEWAEMVDEMQRWALASRLGIPIIYGTDAVHGNNNLYGATIFPHNVGLGATR  124



>ref|XP_007204092.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
 gb|EMJ05291.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
Length=623

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+SRMTL+EKIGQM+QIDR+VA+   +  YF+GSILSGGGS P+  
Sbjct  28   YKDPKQPLNSRIKDLVSRMTLEEKIGQMVQIDRSVASAEVMKKYFIGSILSGGGSVPAQK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +M++ FQK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  88   ASAETWINMVNDFQKGSLSTRLGIPLIYGIDAVHGHNNVYKATIFPHNIGLGATR  142



>ref|XP_004981777.1| PREDICTED: lysosomal beta glucosidase-like [Setaria italica]
Length=648

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+ +RV+DLLSRMTL+EKIGQM QI+RA AT   I  YF+GS+LSGGGS P++ 
Sbjct  43   YKDPKQPINERVQDLLSRMTLEEKIGQMSQIERANATTEVIEKYFIGSVLSGGGSVPAEK  102

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A +  W  MI   QKAAL+TRLGIPIIYGIDA+HGNNNVY AT+FPH IGLGATR
Sbjct  103  ATASVWQKMITAMQKAALKTRLGIPIIYGIDAVHGNNNVYNATIFPHNIGLGATR  157



>gb|AFW78103.1| hypothetical protein ZEAMMB73_707266 [Zea mays]
Length=213

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            VYRD   PVE+RV+DLL RMTL+EK  QM QI+R VATP A+T+   GS+L+ GGS P +
Sbjct  12   VYRDALTPVEERVRDLLGRMTLREKAAQMAQIERTVATPRALTELGAGSVLNAGGSMPCE  71

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A+  +WA M+DGFQ+ A+ +RLG+PI+YG DA+HG+NNVYGATVFPH +GLGA R
Sbjct  72   QASPADWAAMVDGFQRLAISSRLGVPILYGTDAVHGHNNVYGATVFPHNVGLGACR  127



>gb|KDO52251.1| hypothetical protein CISIN_1g036635mg, partial [Citrus sinensis]
Length=557

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  PVE RVKDLLSRMTL EKIGQM QI+R  AT  A+ +YF+GS+LSGGGS PS 
Sbjct  2    MYKDPKQPVEVRVKDLLSRMTLAEKIGQMTQIERVNATFDAMKNYFIGSVLSGGGSVPSP  61

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            NA +++W DM++  Q+ A+ TRLGIP+IYG+DA+HG+NNVY AT+FPH +GLGATR
Sbjct  62   NATAQQWIDMVNDIQRGAMATRLGIPMIYGVDAVHGHNNVYKATIFPHNVGLGATR  117



>ref|XP_006826369.1| hypothetical protein AMTR_s00004p00131000 [Amborella trichopoda]
 gb|ERM93606.1| hypothetical protein AMTR_s00004p00131000 [Amborella trichopoda]
Length=625

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            ESA   Y+DP AP++ R++DLL +MTL EKIGQM QIDR+VAT   + +Y +GS+LSGGG
Sbjct  22   ESATLTYKDPKAPLQSRIEDLLKQMTLAEKIGQMTQIDRSVATQDVMKNYSIGSVLSGGG  81

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P  NA  E+W +M++ FQK AL +RL IP+IYGIDA+HG+NNVYGAT+FPH IGLGAT
Sbjct  82   SIPKPNATVEDWVNMVNDFQKGALSSRLQIPMIYGIDAVHGHNNVYGATIFPHNIGLGAT  141

Query  512  R  514
            R
Sbjct  142  R  142



>ref|XP_008791332.1| PREDICTED: uncharacterized protein LOC103708265 [Phoenix dactylifera]
Length=384

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN P+  RV DL+ RMTL EKIGQM QI+R VA+   + DYF+GSILSGGGS P   
Sbjct  28   YKDPNQPLNVRVTDLMKRMTLPEKIGQMTQIERKVASAQVVKDYFIGSILSGGGSVPKPQ  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +M++ FQ+  L TRLGIP+IYG+DA+HG+NNVY AT+FPH IGLGATR
Sbjct  88   ASAEDWVNMVNDFQQGCLSTRLGIPMIYGVDAVHGHNNVYNATIFPHNIGLGATR  142



>ref|XP_010694376.1| PREDICTED: lysosomal beta glucosidase [Beta vulgaris subsp. vulgaris]
 ref|XP_010694377.1| PREDICTED: lysosomal beta glucosidase [Beta vulgaris subsp. vulgaris]
Length=657

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = +2

Query  98   LTVTPAVRIGRRRMAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVA  277
            L V   V +   R + + E+A  +Y+DPN     RVKDLL RMTL+EKIGQM QIDR +A
Sbjct  7    LLVVNIVLVCCSRTSAQTENA--LYKDPNQSPAARVKDLLGRMTLEEKIGQMTQIDRTMA  64

Query  278  TPSAITDYFLGSILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGN  457
            TP  +  Y +GS+LSGGGS P   A +++W +M+DGFQK+AL  RLGIP+IYGIDA+HG+
Sbjct  65   TPEVMKTYSIGSVLSGGGSTPLPQATAQDWMNMVDGFQKSALTNRLGIPMIYGIDAVHGH  124

Query  458  NNVYGATVFPHFIGLGATR  514
            NNVY AT+FPH +GLGATR
Sbjct  125  NNVYNATIFPHNVGLGATR  143



>ref|XP_002874025.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50284.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGGGS PS+ 
Sbjct  26   YKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERSVATPEVMKKYFIGSVLSGGGSVPSEK  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++  QKA+L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  86   ATPETWVNMVNEIQKASLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  140



>gb|EPS66822.1| hypothetical protein M569_07948 [Genlisea aurea]
Length=610

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            YRDP+ P+  RV DLL RMTL+EKIGQM QIDR+VA+P  +  YF+GS+LSGGGS P+  
Sbjct  11   YRDPDQPIGARVLDLLDRMTLEEKIGQMTQIDRSVASPEVMNRYFIGSLLSGGGSVPAPK  70

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ E W DM++GFQ  +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  71   ASPEAWIDMVNGFQNGSLSTRLGIPMIYGIDAVHGHNNVYRATIFPHNVGLGATR  125



>ref|NP_197595.2| glycosyl hydrolase family protein [Arabidopsis thaliana]
 ref|NP_851048.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AAL58902.1|AF462808_1 beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AAM13848.1| putative beta-D-glucan exohydrolase [Arabidopsis thaliana]
 gb|AAN13217.1| putative beta-D-glucan exohydrolase [Arabidopsis thaliana]
 gb|AED92910.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AED92911.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=624

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGGGS PS+ 
Sbjct  26   YKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERSVATPEVMKKYFIGSVLSGGGSVPSEK  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++  QKA+L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  86   ATPETWVNMVNEIQKASLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  140



>gb|KEH25593.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=622

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM+QIDR+VA+   +  Y++GSILSGGGS P   
Sbjct  28   YKDPKQPLNTRIKDLVDRMTLEEKIGQMVQIDRSVASADVMKKYYIGSILSGGGSVPKPE  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A +++W DMI+ FQK AL TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLGATR
Sbjct  88   ATAKDWVDMINEFQKGALSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGATR  142



>ref|XP_006485566.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
Length=637

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  PVE RVKDLLSRMTL EKIGQM QI+R  AT  A+ +YF+GS+LSGGGS PS 
Sbjct  31   IYKDPKQPVEVRVKDLLSRMTLAEKIGQMTQIERVNATFDAMKNYFIGSVLSGGGSVPSP  90

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            NA +++W DM++  Q+ A+ TRLGIP+IYG+DA+HG+NNVY AT+FPH +GLGATR
Sbjct  91   NATAQQWIDMVNDIQRGAMATRLGIPMIYGVDAVHGHNNVYKATIFPHNVGLGATR  146



>ref|XP_004173167.1| PREDICTED: lysosomal beta glucosidase-like, partial [Cucumis 
sativus]
Length=357

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDLL RMTL+EKIGQM+QI+RA A+   +  YF+GS+LSGGGS PS  
Sbjct  29   YKDPKQPLNVRIKDLLGRMTLEEKIGQMVQIERANASADVMKQYFIGSVLSGGGSAPSKQ  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++++W  M++  Q+AAL TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  89   ASAKDWVHMVNKIQEAALSTRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATR  143



>ref|XP_004981771.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Setaria 
italica]
 ref|XP_004981772.1| PREDICTED: lysosomal beta glucosidase-like isoform X5 [Setaria 
italica]
 ref|XP_004981773.1| PREDICTED: lysosomal beta glucosidase-like isoform X6 [Setaria 
italica]
Length=626

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PVEDRV+DLL RMTL EKIGQM QI+R VA+P  + D F+GS+LSGGGS P   
Sbjct  28   YKDPGLPVEDRVRDLLGRMTLAEKIGQMTQIERLVASPQVLKDNFIGSLLSGGGSVPRKG  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A + EW  MI  FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH + LGATR
Sbjct  88   ATAAEWMSMITDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVALGATR  142



>gb|AAR14129.1| exo-beta-glucanase [Lilium longiflorum]
Length=626

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP+  V+ R+KDL+ RMTL+EKIGQM QI+R VA+   + DYF+GS+LSGGGS P+ N
Sbjct  27   YKDPSRTVDTRIKDLMKRMTLEEKIGQMTQIERKVASAEVVKDYFIGSLLSGGGSVPAPN  86

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++++W DM++ FQK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  87   ASAQQWVDMVNEFQKGALATRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  141



>ref|XP_004981770.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Setaria 
italica]
Length=649

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PVEDRV+DLL RMTL EKIGQM QI+R VA+P  + D F+GS+LSGGGS P   
Sbjct  51   YKDPGLPVEDRVRDLLGRMTLAEKIGQMTQIERLVASPQVLKDNFIGSLLSGGGSVPRKG  110

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A + EW  MI  FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH + LGATR
Sbjct  111  ATAAEWMSMITDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVALGATR  165



>ref|XP_008363217.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=703

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  P   RV DLLSRMTL+EKIGQM+QIDR+VA+   +  YF+GS+LSGGGS P  
Sbjct  56   MYKDPTQPAAARVGDLLSRMTLEEKIGQMVQIDRSVASIDTMKTYFIGSVLSGGGSTPLP  115

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A++E+W +MI+GFQK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  116  EASAEDWVNMINGFQKGALSSRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  171



>ref|XP_004981769.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Setaria 
italica]
Length=669

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PVEDRV+DLL RMTL EKIGQM QI+R VA+P  + D F+GS+LSGGGS P   
Sbjct  71   YKDPGLPVEDRVRDLLGRMTLAEKIGQMTQIERLVASPQVLKDNFIGSLLSGGGSVPRKG  130

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A + EW  MI  FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH + LGATR
Sbjct  131  ATAAEWMSMITDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVALGATR  185



>ref|XP_008785418.1| PREDICTED: lysosomal beta glucosidase-like [Phoenix dactylifera]
Length=612

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MA ++E    VY+DP  PVE RV+DLLSRMTL EK GQM QI+R+VA+P+A+T   +GS+
Sbjct  1    MANEVEV--LVYKDPKQPVEARVRDLLSRMTLAEKAGQMAQIERSVASPAALTGRSIGSV  58

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            L+ GGS P   A++EEWADM+D  Q  AL +RLGIPIIYG DA+HGNNN+YGAT+FPH +
Sbjct  59   LNAGGSAPRKRASAEEWADMVDEMQSWALASRLGIPIIYGTDAVHGNNNLYGATIFPHNV  118

Query  497  GLGATR  514
            GLGATR
Sbjct  119  GLGATR  124



>ref|XP_004981768.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Setaria 
italica]
Length=674

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PVEDRV+DLL RMTL EKIGQM QI+R VA+P  + D F+GS+LSGGGS P   
Sbjct  76   YKDPGLPVEDRVRDLLGRMTLAEKIGQMTQIERLVASPQVLKDNFIGSLLSGGGSVPRKG  135

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A + EW  MI  FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH + LGATR
Sbjct  136  ATAAEWMSMITDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVALGATR  190



>gb|EYU39163.1| hypothetical protein MIMGU_mgv1a020896mg, partial [Erythranthe 
guttata]
Length=457

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM QI+R +ATP  + +YF+GS+LSGGGS P   
Sbjct  19   YKDPKQPLNSRIKDLMGRMTLEEKIGQMTQIERKIATPDVMKNYFIGSVLSGGGSVPGPK  78

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++EEW +M++G Q  +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  79   ASAEEWVNMVNGIQTGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGVTR  133



>ref|XP_006445675.1| hypothetical protein CICLE_v10017853mg [Citrus clementina]
 gb|ESR58915.1| hypothetical protein CICLE_v10017853mg [Citrus clementina]
Length=631

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  PVE RVKDLLSRMTL EKIGQM QI+R  AT  A+ +YF+GS+LSGGGS PS 
Sbjct  31   IYKDPKQPVEVRVKDLLSRMTLGEKIGQMTQIERVNATFDAMKNYFIGSVLSGGGSVPSP  90

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            NA +++W DM++  Q+ A+ TRLGIP+IYG+DA+HG+NNVY AT+FPH +GLGATR
Sbjct  91   NATAQQWIDMVNDIQRGAMATRLGIPMIYGVDAVHGHNNVYKATIFPHNVGLGATR  146



>ref|XP_010558244.1| PREDICTED: lysosomal beta glucosidase [Tarenaya hassleriana]
 ref|XP_010558245.1| PREDICTED: lysosomal beta glucosidase [Tarenaya hassleriana]
Length=664

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E    +++DP   VEDRV DLLSRMTL+EKIGQM+QIDR++A+ + + DY++GS+LSGG
Sbjct  21   VEGDYVLFKDPKREVEDRVADLLSRMTLEEKIGQMVQIDRSIASVNIMRDYYIGSVLSGG  80

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P   A ++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGA
Sbjct  81   GSAPLPEATAQSWVDMINDYQKGALSSRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGA  140

Query  509  TR  514
            TR
Sbjct  141  TR  142



>ref|XP_009126493.1| PREDICTED: lysosomal beta glucosidase-like [Brassica rapa]
Length=628

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +2

Query  155  SAGCV--YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            + GC   Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R VATP  +  YF+GS+LSGG
Sbjct  22   ATGCYLKYKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERTVATPEVMKKYFIGSVLSGG  81

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS PS  A  E W +M++  QKA+L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG 
Sbjct  82   GSVPSPKATPETWVNMVNEIQKASLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGV  141

Query  509  TR  514
            TR
Sbjct  142  TR  143



>ref|NP_190289.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 emb|CAB61951.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AEE78237.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=612

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            VY++  APVE RVKDLLSRMTL EKIGQM  I+R+VA+ + I D+ +GS+L+  G  P +
Sbjct  9    VYKNREAPVEARVKDLLSRMTLAEKIGQMTLIERSVASEAVIRDFSIGSVLNRAGGWPFE  68

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            +A S  WADMIDGFQ++ALE+RLGIPIIYGIDA+HGNN+VYGAT+FPH IGLGATR
Sbjct  69   DAKSSNWADMIDGFQRSALESRLGIPIIYGIDAVHGNNDVYGATIFPHNIGLGATR  124



>ref|XP_008391778.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=820

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDLLSRMTL+EKIGQM+QIDR+VA+   +  YF+GSILSGGGS P+  
Sbjct  220  YKDPKQPLNTRIKDLLSRMTLEEKIGQMVQIDRSVASSEVMKKYFIGSILSGGGSVPAQR  279

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ E W +M++ FQK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  280  ASPEAWINMVNDFQKGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGATR  334


 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDLLSRMTL+EKIGQM+QIDR+VA+P  +  +F+GSIL G  + P   
Sbjct  26   YKDPKQPLNSRIKDLLSRMTLEEKIGQMVQIDRSVASPEVMKKHFIGSILRGVVNVPPQK  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             ++E W +M++  QK +L TRLGIP I+GIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  86   DSAETWINMVNDLQKGSLSTRLGIPFIFGIDAVHGHNNVYKATIFPHNVGLGATR  140



>gb|KHN14336.1| Lysosomal beta glucosidase [Glycine soja]
Length=688

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  RV+DL+SRMTL+EKIGQM+QIDR+VA  + +   F+GS+LSGGGS+P   
Sbjct  31   YKDPKQPVPTRVRDLMSRMTLEEKIGQMVQIDRSVANANVMKTSFIGSVLSGGGSEPLPR  90

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFD  520
            A +E+W +MI+ FQK ALE+RLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR D
Sbjct  91   ATAEDWVNMINDFQKGALESRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGCTRQD  147



>ref|XP_010454410.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=400

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  140  AEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSIL  319
            A K+      Y++P  P+  R+K+L+SRMTL+EKIGQMIQ+ RA AT   I  YF+GS+ 
Sbjct  22   ANKVPLTNAKYKNPKEPLGVRIKNLMSRMTLEEKIGQMIQVKRANATAEVIKKYFIGSVF  81

Query  320  SGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIG  499
            SGGGS P  NA+ E W DM++  QK AL TRLGIPIIYGIDA+HG+NNVY AT+FPH IG
Sbjct  82   SGGGSVPKPNASPEAWVDMVNEIQKKALSTRLGIPIIYGIDAVHGHNNVYNATIFPHNIG  141

Query  500  LGATR  514
            LG TR
Sbjct  142  LGVTR  146



>ref|XP_009395659.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395660.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395661.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=624

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  140  AEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSIL  319
            A  I++    Y+DPN PV  RVKDL+ RMTL EKIGQM QI+R  A+P  + DY +GSIL
Sbjct  18   AATIQAEYMKYKDPNQPVNVRVKDLMKRMTLAEKIGQMTQIERKDASPQVLKDYLIGSIL  77

Query  320  SGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIG  499
            SGGGS P+  A++++W +MI+ +QKA L TRLGIP+IYGIDA+HG+NNVY AT+FPH +G
Sbjct  78   SGGGSVPAPQASAKDWVNMINEYQKACLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVG  137

Query  500  LGATR  514
            LGATR
Sbjct  138  LGATR  142



>gb|KJB35517.1| hypothetical protein B456_006G118100 [Gossypium raimondii]
Length=400

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+    Y+DP  P+  R+KDL+ RMTL EKIGQM QI+R VATP A+ +YF+GS+LSGGG
Sbjct  22   EATYVKYKDPKQPLGVRIKDLMRRMTLAEKIGQMTQIERTVATPDAMKNYFIGSVLSGGG  81

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P+  A  E W +M++  QKA+L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLG T
Sbjct  82   SVPAQKATPETWIEMVNTMQKASLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGVT  141

Query  512  R  514
            R
Sbjct  142  R  142



>ref|XP_011094168.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011094170.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011094171.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=627

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  P+  R+KDLL RM+L+EKIGQM+QI+RAVA+   +  Y++GS+LSGGGS P+ 
Sbjct  27   LYKDPKKPLNRRIKDLLRRMSLEEKIGQMVQIERAVASAEVMKKYYIGSVLSGGGSAPAP  86

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A+ + W DM++GFQK +L TRLGIP+IYGIDA+HG+N VYGATVFPH IGLGATR
Sbjct  87   RASPKAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGHNTVYGATVFPHNIGLGATR  142



>ref|XP_006650588.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=652

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   PVE RV DLL RMTL EKIGQM QI+R VA+P  + DYF+GS+LSGGGS P  
Sbjct  78   LYKDATKPVEARVSDLLGRMTLAEKIGQMTQIERQVASPQVLQDYFIGSLLSGGGSVPRK  137

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A + +W  M+  FQKA L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLGATR
Sbjct  138  QATAADWVTMVSDFQKACLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGATR  193



>ref|XP_006400664.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 ref|XP_006400665.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 ref|XP_006400666.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 gb|ESQ42117.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 gb|ESQ42118.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 gb|ESQ42119.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
Length=628

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGGGS P+  
Sbjct  29   YKDPKQPMGARIRDLMNRMTLQEKIGQMVQIERSVATPEVMKKYFIGSVLSGGGSVPAPK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++  QKAAL TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  89   ATPENWVNMVNEIQKAALSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  143



>ref|XP_006398941.1| hypothetical protein EUTSA_v10012900mg [Eutrema salsugineum]
 gb|ESQ40394.1| hypothetical protein EUTSA_v10012900mg [Eutrema salsugineum]
Length=666

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV DLL RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  28   LYKDPKQKVSDRVVDLLGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  87

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A ++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  88   EATAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  143



>gb|KJB35515.1| hypothetical protein B456_006G118100 [Gossypium raimondii]
Length=414

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+    Y+DP  P+  R+KDL+ RMTL EKIGQM QI+R VATP A+ +YF+GS+LSGGG
Sbjct  22   EATYVKYKDPKQPLGVRIKDLMRRMTLAEKIGQMTQIERTVATPDAMKNYFIGSVLSGGG  81

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P+  A  E W +M++  QKA+L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLG T
Sbjct  82   SVPAQKATPETWIEMVNTMQKASLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGVT  141

Query  512  R  514
            R
Sbjct  142  R  142



>emb|CAA07070.1| beta-D-glucosidase [Tropaeolum majus]
Length=654

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+SRMTL EKIGQM QI+R  ATP  I+ YF+GS+LSGGGS P+  
Sbjct  29   YKDPKKPLNVRIKDLMSRMTLAEKIGQMTQIERKEATPDVISKYFIGSVLSGGGSVPAPK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ E W D+++G QKAAL TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  89   ASPEAWVDLVNGMQKAALSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  143



>ref|XP_006848113.1| hypothetical protein AMTR_s00029p00216320 [Amborella trichopoda]
 gb|ERN09694.1| hypothetical protein AMTR_s00029p00216320 [Amborella trichopoda]
Length=605

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 5/126 (4%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MAEK      +Y+DP   +E+RVKDLL RMT+ EK+GQM QI+R+V T  A+ + F+GSI
Sbjct  1    MAEKP-----IYKDPQQAIEERVKDLLLRMTIAEKVGQMTQIERSVVTLDAMKNQFIGSI  55

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            L+ GGS P   A++EEWADM+DGFQ+ ALE+RL IP++YG DA+HG+NN YGAT+FPH I
Sbjct  56   LNAGGSTPRSGASAEEWADMVDGFQRWALESRLSIPVLYGTDAVHGHNNCYGATIFPHNI  115

Query  497  GLGATR  514
            GLGATR
Sbjct  116  GLGATR  121



>ref|XP_003601350.1| Beta-D-glucosidase [Medicago truncatula]
 gb|AES71601.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=627

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+SRMTL+EKIGQM Q++R+VATP A+T YF+GS+LSGGGS P++ 
Sbjct  28   YKDPKVPLNRRIKDLMSRMTLEEKIGQMTQLERSVATPEAMTKYFIGSVLSGGGSVPAEK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W  M++  Q AAL T LGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  88   ASAETWVKMVNQIQNAALSTPLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  142



>ref|XP_002319151.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE95074.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D   P+  R+KDL+SRMTL+EKIGQM QI+R VA+   + DYF+GS+LSGGGS PS 
Sbjct  26   IYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERNVASAEVMKDYFIGSVLSGGGSVPSK  85

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A++E W +M++ FQK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  86   QASAETWINMVNEFQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGATR  141



>ref|XP_006379440.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
 gb|ERP57237.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
Length=654

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  R+KDL+SRMTL+EKIGQM+QIDR  A+P  +  Y +GS+LSGGGS P  N
Sbjct  29   YKDPKQPVAVRIKDLMSRMTLEEKIGQMVQIDRLTASPDIMQTYCIGSVLSGGGSAPLPN  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +MI+GFQ  +L +RLGIP+IYGIDA+HG+NNV+ AT+FPH IGLGATR
Sbjct  89   ASAEDWVNMINGFQHGSLSSRLGIPMIYGIDAVHGHNNVFNATIFPHNIGLGATR  143



>ref|XP_006290328.1| hypothetical protein CARUB_v10016857mg [Capsella rubella]
 gb|EOA23226.1| hypothetical protein CARUB_v10016857mg [Capsella rubella]
Length=612

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  CVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPS  343
            CVY++ +APVE RVKDLLS+MTL EK+GQM  I+ +VA+ + I DY +G +L+  G+ P 
Sbjct  8    CVYKNRDAPVEARVKDLLSQMTLPEKVGQMTLIECSVASQAVIKDYSIGGLLNRAGNWPF  67

Query  344  DNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            ++A S  WADMIDGFQ++ALE+RLGIPIIYGIDA+HGNN+VYGAT+FPH IGLGATR
Sbjct  68   EDAKSSYWADMIDGFQRSALESRLGIPIIYGIDAVHGNNDVYGATIFPHNIGLGATR  124



>ref|XP_003545548.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=627

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDLL RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGGGS P  N
Sbjct  28   YKDPKRPLNVRIKDLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSGGGSVPETN  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W  M++G Q  +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  88   ASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGVTR  142



>ref|NP_680141.2| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 dbj|BAF01189.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90799.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=665

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV DL  RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  29   LYKDPKQTVSDRVADLFGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  88

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A+++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  89   EASAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  144



>ref|XP_009120747.1| PREDICTED: lysosomal beta glucosidase-like [Brassica rapa]
 ref|XP_009120748.1| PREDICTED: lysosomal beta glucosidase-like [Brassica rapa]
Length=626

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL++RMTL+EKIGQM+QI+R VATP  + +YF+GS+LSGGGS P+  
Sbjct  28   YKDPKQPLGARIRDLMNRMTLQEKIGQMVQIERTVATPDVMKNYFIGSVLSGGGSVPAPK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++  QKAAL TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  88   ATPEAWVNMVNEIQKAALSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  142



>ref|XP_006575593.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
Length=531

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+K+LL RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGG S P+ N
Sbjct  28   YKDPKQPLNVRIKNLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSGGESVPATN  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W  M++G Q  +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLG TR
Sbjct  88   ASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGVTR  142



>ref|XP_010067089.1| PREDICTED: lysosomal beta glucosidase [Eucalyptus grandis]
 ref|XP_010067090.1| PREDICTED: lysosomal beta glucosidase [Eucalyptus grandis]
 gb|KCW65161.1| hypothetical protein EUGRSUZ_G02657 [Eucalyptus grandis]
Length=669

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  RVKDLLSRMTL+EKIGQM QIDR VAT   +  Y +GS+LSGGGS P   
Sbjct  31   YKDPKQPVAARVKDLLSRMTLEEKIGQMTQIDRMVATDDFMKTYSIGSVLSGGGSTPLPE  90

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +MI+G+QK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  91   ASAEDWVNMINGYQKGALSSRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATR  145



>ref|XP_007147489.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
 gb|ESW19483.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
Length=661

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  R+KDL+SRMTL+EKIGQM+QIDR+VA    +   F+GS+LSGGGS+P   
Sbjct  31   YKDPKQPVATRIKDLMSRMTLEEKIGQMVQIDRSVANAKVMKTSFIGSVLSGGGSEPLPK  90

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A +E+W +MI+ FQK ALE+RLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  91   ATAEDWVNMINEFQKGALESRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGCTR  145



>dbj|BAD13764.1| exo-1,3-beta-glucanase [Lilium longiflorum]
Length=626

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN P+  R++DL+ RMTL+EKIGQM QI+R V +   + DYF+GS+LSGGGS P+  
Sbjct  27   YKDPNQPLGARIRDLMKRMTLEEKIGQMTQIERKVGSAKVVKDYFIGSLLSGGGSVPAPK  86

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A ++EW DM++ FQK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  87   ATAKEWVDMVNEFQKGALATRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATR  141



>ref|XP_006424024.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 ref|XP_006424025.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37264.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37265.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
Length=628

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            +A   E+    Y+DP  P+  R++DL+SRMTL EKIGQM QI+RAVATP  +  +F+GS+
Sbjct  17   LAAVTEATYIKYKDPKQPLGARIRDLMSRMTLAEKIGQMTQIERAVATPDVMKQFFIGSV  76

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+  A +E W +M++G QK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +
Sbjct  77   LSGGGSVPAPKATAETWVNMVNGLQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNV  136

Query  497  GLGATR  514
            GLG TR
Sbjct  137  GLGVTR  142



>ref|XP_008230928.1| PREDICTED: lysosomal beta glucosidase-like, partial [Prunus mume]
Length=203

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM+Q+DRA  T   + D+ LGS+LSGGGS P + 
Sbjct  11   YKDPKQPLNRRIKDLMGRMTLEEKIGQMMQLDRANVTAEIMRDFSLGSVLSGGGSVPREQ  70

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ ++W +M + FQK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  71   ASPQDWINMFNEFQKGALSSRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGATR  125



>ref|XP_004137360.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN63896.1| hypothetical protein Csa_1G025780 [Cucumis sativus]
Length=628

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM+QI+RAVATP  + +YF+GS+LSGGGS P++ 
Sbjct  29   YKDPKQPLGARIKDLMGRMTLEEKIGQMVQIERAVATPDVMKNYFIGSVLSGGGSVPAEK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +M++  QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  89   ASAETWVNMVNEIQKGSLATRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  143



>ref|XP_006487803.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487804.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Citrus 
sinensis]
Length=628

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            +A   E+    Y+DP  P+  R++DL+SRMTL EKIGQM QI+RAVATP  +  +F+GS+
Sbjct  17   LAAVTEATYIKYKDPKQPLGARIRDLMSRMTLAEKIGQMTQIERAVATPDVMKQFFIGSV  76

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+  A +E W +M++G QK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +
Sbjct  77   LSGGGSVPAPKATAETWVNMVNGLQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNV  136

Query  497  GLGATR  514
            GLG TR
Sbjct  137  GLGVTR  142



>gb|KDO54375.1| hypothetical protein CISIN_1g006872mg [Citrus sinensis]
Length=628

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            +A   E+    Y+DP  P+  R++DL+SRMTL EKIGQM QI+RAVATP  +  +F+GS+
Sbjct  17   LAAVTEATYIKYKDPKQPLGARIRDLMSRMTLAEKIGQMTQIERAVATPDVMKQFFIGSV  76

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+  A +E W +M++G QK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +
Sbjct  77   LSGGGSVPAPKATAETWVNMVNGLQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNV  136

Query  497  GLGATR  514
            GLG TR
Sbjct  137  GLGVTR  142



>gb|KEH25594.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=631

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+D   P+  R+KDLL RMTL+EKIGQM+QI+R VA+   + +YF+GS+LSGGGS P   
Sbjct  28   YKDSKQPLNTRIKDLLDRMTLEEKIGQMVQIERNVASAEVMNNYFIGSVLSGGGSVPKPK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A +++W DMI+ FQK AL TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLGATR
Sbjct  88   ATAKDWVDMINEFQKGALSTRLGIPMIYGIDAVHGNNNVYNATIFPHNVGLGATR  142



>ref|XP_003546253.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006597657.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=661

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  RV+DL+SRMTL+EKIGQM+QIDR+VA  + +   F+GS+LSGGGS+P   
Sbjct  31   YKDPKQPVPTRVRDLMSRMTLEEKIGQMVQIDRSVANANVMKTSFIGSVLSGGGSEPLPR  90

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A +E+W +MI+ FQK ALE+RLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  91   ATAEDWVNMINDFQKGALESRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGCTR  145



>ref|NP_001051277.1| Os03g0749500 [Oryza sativa Japonica Group]
 gb|ABF98887.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98888.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13191.1| Os03g0749500 [Oryza sativa Japonica Group]
 dbj|BAG93291.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   PVE RV DLL+RMTL EKIGQM QI+R VA+P  + DYF+GS+LSGGG
Sbjct  22   EAQYVLYKDATKPVEARVTDLLARMTLAEKIGQMTQIERQVASPQVLKDYFIGSLLSGGG  81

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P   A + EW  M+  FQK +L TRLGIP+IYGIDA+HG+NNVYGAT+FPH + LGAT
Sbjct  82   SVPRKQATAAEWVSMVSDFQKGSLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVALGAT  141

Query  512  R  514
            R
Sbjct  142  R  142



>ref|XP_008453517.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
 ref|XP_008453518.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM+QI+RAVATP  + +YF+GS+LSGGGS P++ 
Sbjct  29   YKDPKQPLGARIKDLMGRMTLEEKIGQMVQIERAVATPDVMKNYFIGSVLSGGGSVPAEK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +M++  QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  89   ASAETWVNMVNEIQKGSLATRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  143



>ref|XP_006287219.1| hypothetical protein CARUB_v10000396mg [Capsella rubella]
 gb|EOA20117.1| hypothetical protein CARUB_v10000396mg [Capsella rubella]
Length=669

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV DL  RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  30   LYKDPKQTVSDRVADLFGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  89

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A ++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  90   EATAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  145



>ref|XP_002871119.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47378.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV DL  RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  29   LYKDPKQAVSDRVADLFGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  88

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A ++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  89   EATAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  144



>gb|AAL58976.1|AC091811_25 putative exohydrolase [Oryza sativa Japonica Group]
 gb|EEC76181.1| hypothetical protein OsI_13516 [Oryza sativa Indica Group]
 gb|EEE59932.1| hypothetical protein OsJ_12578 [Oryza sativa Japonica Group]
Length=677

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   PVE RV DLL+RMTL EKIGQM QI+R VA+P  + DYF+GS+LSGGG
Sbjct  73   EAQYVLYKDATKPVEARVTDLLARMTLAEKIGQMTQIERQVASPQVLKDYFIGSLLSGGG  132

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S P   A + EW  M+  FQK +L TRLGIP+IYGIDA+HG+NNVYGAT+FPH + LGAT
Sbjct  133  SVPRKQATAAEWVSMVSDFQKGSLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVALGAT  192

Query  512  R  514
            R
Sbjct  193  R  193



>ref|XP_009368634.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL+ RMTL EKIGQM QI+R VATP  +T YF+GS+LSGGGS P+  
Sbjct  32   YKDPKQPLNARIRDLMKRMTLAEKIGQMTQIERTVATPDVMTKYFIGSVLSGGGSVPAPK  91

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  92   ASAETWINLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  146



>ref|XP_006575592.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=592

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+K+LL RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGG S P+ N
Sbjct  28   YKDPKQPLNVRIKNLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSGGESVPATN  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W  M++G Q  +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLG TR
Sbjct  88   ASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGVTR  142



>gb|KDP34274.1| hypothetical protein JCGZ_12843 [Jatropha curcas]
Length=660

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  RVKDL+SRMTL+EKI QM+QIDR +ATP  +  Y +GS+LSGGGS P   
Sbjct  26   YKDPEQPVGARVKDLISRMTLEEKIAQMVQIDRLIATPQLMKTYSIGSVLSGGGSAPLPE  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +MI+GFQ  +L +RLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  86   ASAEDWVNMINGFQNGSLSSRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATR  140



>emb|CDY09090.1| BnaA02g05160D [Brassica napus]
Length=634

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL+ RMTL+EKIGQM+QI+R VATP  +  YF+GS+LSGGGS PS  
Sbjct  29   YKDPKQPLGARIRDLMKRMTLQEKIGQMVQIERTVATPEVMKKYFIGSVLSGGGSVPSPK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  E W +M++  QKA+L TRLGIP+IYGIDA+HG+NNVYGAT+FPH +GLG TR
Sbjct  89   ATPETWVNMVNEIQKASLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGVTR  143



>emb|CBI39076.3| unnamed protein product [Vitis vinifera]
Length=635

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+SRMTL+EKIGQM+QIDR VA+   +  Y +GSILSGGGS P+  
Sbjct  28   YKDPKQPLNTRIKDLMSRMTLEEKIGQMVQIDRTVASAEVMKKYLIGSILSGGGSVPAKQ  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFDYFC  529
            A++E W +M++ FQK  L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR   F 
Sbjct  88   ASAETWIEMVNDFQKGCLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGATRQHSFD  147

Query  530  LNVD  541
              +D
Sbjct  148  KELD  151



>ref|XP_004300933.2| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=647

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            M    E+    Y+DPN P+  R+ DLLSRMTL+EKIGQM QIDR+VA+P  +  Y +GS+
Sbjct  36   MTMTAEAECMKYKDPNQPLNTRINDLLSRMTLEEKIGQMTQIDRSVASPEVMYKYKIGSV  95

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+ NA++E W  M++ FQ  +L TRL IP+IYGIDAIHG+NNVY AT+FPH +
Sbjct  96   LSGGGSVPAKNASAETWIRMVNDFQNGSLSTRLAIPLIYGIDAIHGHNNVYKATIFPHNV  155

Query  497  GLGATR  514
            GLGATR
Sbjct  156  GLGATR  161



>ref|XP_002325849.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEF00231.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=621

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   P+  R+KDL+SRMTL+EKIGQM QI+R VA+   + DYF+GS+LSGGG
Sbjct  20   EAEYMIYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERGVASAEVMKDYFIGSVLSGGG  79

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S PS  A++E W +M++  QK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGAT
Sbjct  80   SVPSKQASAETWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGAT  139

Query  512  R  514
            R
Sbjct  140  R  140



>gb|ABK95015.1| unknown [Populus trichocarpa]
Length=626

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   P+  R+KDL+SRMTL+EKIGQM QI+R VA+   + DYF+GS+LSGGG
Sbjct  20   EAEYMIYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERGVASAEVMKDYFIGSVLSGGG  79

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S PS  A++E W +M++  QK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGAT
Sbjct  80   SVPSKQASAETWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGAT  139

Query  512  R  514
            R
Sbjct  140  R  140



>ref|XP_011464064.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=632

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            M    E+    Y+DPN P+  R+ DLLSRMTL+EKIGQM QIDR+VA+P  +  Y +GS+
Sbjct  21   MTMTAEAECMKYKDPNQPLNTRINDLLSRMTLEEKIGQMTQIDRSVASPEVMYKYKIGSV  80

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+ NA++E W  M++ FQ  +L TRL IP+IYGIDAIHG+NNVY AT+FPH +
Sbjct  81   LSGGGSVPAKNASAETWIRMVNDFQNGSLSTRLAIPLIYGIDAIHGHNNVYKATIFPHNV  140

Query  497  GLGATR  514
            GLGATR
Sbjct  141  GLGATR  146



>gb|KHN38459.1| Lysosomal beta glucosidase [Glycine soja]
Length=644

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+K+LL RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGG S P+ N
Sbjct  28   YKDPKQPLNVRIKNLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSGGESVPATN  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W  M++G Q  +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLG TR
Sbjct  88   ASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGVTR  142



>ref|XP_006371173.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
 gb|ERP48970.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
Length=626

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  152  ESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGG  331
            E+   +Y+D   P+  R+KDL+SRMTL+EKIGQM QI+R VA+   + DYF+GS+LSGGG
Sbjct  20   EAEYMIYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERGVASAEVMKDYFIGSVLSGGG  79

Query  332  SKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGAT  511
            S PS  A++E W +M++  QK AL TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGAT
Sbjct  80   SVPSKQASAETWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGAT  139

Query  512  R  514
            R
Sbjct  140  R  140



>ref|XP_003519468.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=627

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+K+LL RMTL+EKIGQM+QI+R+VATP  +  YF+GS+LSGG S P+ N
Sbjct  28   YKDPKQPLNVRIKNLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSGGESVPATN  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W  M++G Q  +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLG TR
Sbjct  88   ASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGVTR  142



>ref|XP_010917877.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Elaeis 
guineensis]
Length=566

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PV  RV+DL+ RMTL EKIGQM QI+R VA+   + D+F+GS+LSGGGS P   
Sbjct  28   YKDPNQPVNVRVRDLMKRMTLPEKIGQMTQIERQVASAQVVKDHFIGSLLSGGGSVPKPQ  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +M++ FQK  L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  88   ASAEDWVNMVNEFQKGCLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  142



>ref|XP_010653212.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Vitis 
vinifera]
Length=627

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+SRMTL+EKIGQM+QIDR VA+   +  Y +GSILSGGGS P+  
Sbjct  28   YKDPKQPLNTRIKDLMSRMTLEEKIGQMVQIDRTVASAEVMKKYLIGSILSGGGSVPAKQ  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +M++ FQK  L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  88   ASAETWIEMVNDFQKGCLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGATR  142



>ref|XP_008231858.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Prunus mume]
Length=658

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+D N PV  RV DLLSRMTL+EKIGQM+QIDR+VA    +  YF+GS+LSGGGS P   
Sbjct  30   YKDANQPVAARVGDLLSRMTLEEKIGQMVQIDRSVANVDTMRTYFIGSVLSGGGSAPLPE  89

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +MI+ FQK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  90   ASAEDWVNMINEFQKGALASRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  144



>emb|CDY11314.1| BnaA03g01500D [Brassica napus]
Length=662

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV DLL RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  27   LYKDPKQKVSDRVVDLLGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  86

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A ++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNV+ AT+FPH +GLGATR
Sbjct  87   EATAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHGHNNVFNATIFPHNVGLGATR  142



>ref|XP_002266470.2| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Vitis 
vinifera]
Length=676

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+SRMTL+EKIGQM+QIDR VA+   +  Y +GSILSGGGS P+  
Sbjct  77   YKDPKQPLNTRIKDLMSRMTLEEKIGQMVQIDRTVASAEVMKKYLIGSILSGGGSVPAKQ  136

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W +M++ FQK  L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  137  ASAETWIEMVNDFQKGCLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGATR  191



>ref|XP_009130844.1| PREDICTED: lysosomal beta glucosidase-like [Brassica rapa]
 ref|XP_009130845.1| PREDICTED: lysosomal beta glucosidase-like [Brassica rapa]
Length=663

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV DLL RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  28   LYKDPKQKVSDRVVDLLGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  87

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A ++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNV+ AT+FPH +GLGATR
Sbjct  88   EATAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHGHNNVFNATIFPHNVGLGATR  143



>ref|XP_011094175.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=632

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 103/145 (71%), Gaps = 3/145 (2%)
 Frame = +2

Query  89   KSKLTVTPAVRIGRRRMAEKIESAGC---VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQ  259
            + K+   PAV IG   +   I  A     +Y+DP  P+  RVKDLL RMTL+EKIGQM Q
Sbjct  3    RRKMAEAPAVFIGILVLCCWIAVANAEYKIYQDPKQPISKRVKDLLGRMTLEEKIGQMTQ  62

Query  260  IDRAVATPSAITDYFLGSILSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGI  439
            IDR VA+   +  Y++GSILSGGGS PS  A+ E W DM++G+QK +L TRL IP++YGI
Sbjct  63   IDRLVASAEVMEKYYIGSILSGGGSIPSPTASPETWVDMVNGYQKGSLSTRLKIPMLYGI  122

Query  440  DAIHGNNNVYGATVFPHFIGLGATR  514
            DA+HG+N VY AT+FPH +GLGATR
Sbjct  123  DAVHGHNAVYRATIFPHNVGLGATR  147



>ref|XP_007010543.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY19353.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=661

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PV  R+KDL+S+MTL EKIGQM+QIDR VAT   + DY +GS+LSGGGS P   
Sbjct  26   YKDPNQPVAARIKDLMSKMTLAEKIGQMVQIDRTVATEQILRDYSIGSVLSGGGSAPLPQ  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +MI+ +Q  +L +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  86   ASAEDWVNMINAYQNGSLASRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  140



>gb|KHN22996.1| Lysosomal beta glucosidase [Glycine soja]
Length=689

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP   V+ RV+DL+SRMTL EKIGQM+QIDR+VA  + +   F+GS+LSGGGS+P   
Sbjct  31   YKDPKQSVQTRVRDLMSRMTLDEKIGQMVQIDRSVANANVMKTSFIGSVLSGGGSEPLPR  90

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFD  520
            A +E+W +MI+ FQK ALE+RLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR D
Sbjct  91   ATAEDWVNMINDFQKGALESRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGCTRQD  147



>ref|XP_008231857.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Prunus mume]
Length=688

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+D N PV  RV DLLSRMTL+EKIGQM+QIDR+VA    +  YF+GS+LSGGGS P   
Sbjct  60   YKDANQPVAARVGDLLSRMTLEEKIGQMVQIDRSVANVDTMRTYFIGSVLSGGGSAPLPE  119

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +MI+ FQK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  120  ASAEDWVNMINEFQKGALASRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  174



>ref|XP_007010542.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY19352.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=662

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PV  R+KDL+S+MTL EKIGQM+QIDR VAT   + DY +GS+LSGGGS P   
Sbjct  26   YKDPNQPVAARIKDLMSKMTLAEKIGQMVQIDRTVATEQILRDYSIGSVLSGGGSAPLPQ  85

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +MI+ +Q  +L +RLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  86   ASAEDWVNMINAYQNGSLASRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  140



>gb|KEH25595.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=641

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+D   P+  R+KDL+ RMTL+EKIGQM+QI+R VA+   +  YF+GS+LSGGGS P   
Sbjct  29   YKDSKQPLNTRIKDLIDRMTLEEKIGQMVQIERGVASAEVMNKYFIGSVLSGGGSVPKPK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A +++W DMI+ FQK AL TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLGATR
Sbjct  89   ATAKDWVDMINEFQKGALSTRLGIPMIYGIDAVHGNNNVYNATIFPHNVGLGATR  143



>ref|XP_010917875.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917876.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=627

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DPN PV  RV+DL+ RMTL EKIGQM QI+R VA+   + D+F+GS+LSGGGS P   
Sbjct  28   YKDPNQPVNVRVRDLMKRMTLPEKIGQMTQIERQVASAQVVKDHFIGSLLSGGGSVPKPQ  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E+W +M++ FQK  L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  88   ASAEDWVNMVNEFQKGCLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  142



>emb|CDX80926.1| BnaC03g01800D [Brassica napus]
Length=663

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP   V DRV DLL RMTL+EKIGQM+QIDR+VAT + + DYF+GS+LSGGGS P  
Sbjct  28   LYKDPKQKVSDRVVDLLGRMTLEEKIGQMVQIDRSVATVNIMRDYFIGSVLSGGGSAPLP  87

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A ++ W DMI+ +QK AL +RLGIP+IYGIDA+HG+NNV+ AT+FPH +GLGATR
Sbjct  88   EATAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHGHNNVFNATIFPHNVGLGATR  143



>ref|XP_008355265.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL+ RMTL EKIGQM QI+R+VATP  +  YF+GS+LSGGGS+P+  
Sbjct  32   YKDPKQPLNARIRDLMKRMTLAEKIGQMTQIERSVATPDVMNKYFIGSVLSGGGSEPAPK  91

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  92   ASAEAWVNLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  146



>emb|CDX99071.1| BnaA06g17620D [Brassica napus]
Length=679

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +2

Query  140  AEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSIL  319
            A ++ +  CVY++PN  VEDR++DLL RMT++EKIGQM QI RAV++ + I D+F+G++ 
Sbjct  4    AGEVTAMDCVYKNPNEGVEDRIQDLLQRMTVEEKIGQMTQIHRAVSSAAIIKDFFIGNVC  63

Query  320  SGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIG  499
            +  G   + +A SE+WA+MIDGFQ AALETRL IPIIYG+DA+HGNN  YG T+F H IG
Sbjct  64   NSAGKSGNKDALSEDWAEMIDGFQTAALETRLAIPIIYGLDAVHGNNKFYGTTIFSHNIG  123

Query  500  LGATRFDY  523
            LGATR DY
Sbjct  124  LGATR-DY  130



>ref|XP_010088030.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB31249.1| Lysosomal beta glucosidase [Morus notabilis]
Length=634

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+SRMTL+EKIGQM+QIDR VA+   +  Y +GSILSGGGS P+  
Sbjct  30   YKDPKQPINIRIKDLISRMTLEEKIGQMVQIDRTVASFEVMKKYKIGSILSGGGSVPAKE  89

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ E W DM++ FQ+ +L TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLGATR
Sbjct  90   ASPEAWVDMVNDFQRGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGATR  144



>gb|KHG17515.1| gluA [Gossypium arboreum]
Length=281

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            +A   E+    Y+DP  PV  R++DL+SRMTL EKIGQM QI+R+VATP  +  YF+GS+
Sbjct  57   LAAVSEATYAKYKDPKQPVGVRIEDLMSRMTLAEKIGQMTQIERSVATPDVMKKYFIGSV  116

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+  A  E W  M++  QK +L TRL IP+IYGIDA+HG+NNVY AT+FPH +
Sbjct  117  LSGGGSVPAIKATPETWIKMVNTIQKGSLSTRLQIPMIYGIDAVHGHNNVYKATIFPHNV  176

Query  497  GLGATR--FDYFCLNV  538
            GLG TR    Y  L+V
Sbjct  177  GLGVTRKLLSYVVLSV  192



>ref|XP_009804819.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009804820.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=634

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+DP  P+  R++DL+SRMTL EKIGQM Q+DR + TP  + DY +GS+LSGGGS P  
Sbjct  30   LYKDPTKPLNIRIRDLMSRMTLAEKIGQMTQLDRRILTPKIMKDYGIGSVLSGGGSVPKP  89

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A + EW DM++ FQK AL TRLGIP+IYGIDA+HG+NNVY ATVFPH +GLGATR
Sbjct  90   EATAREWVDMVNEFQKGALSTRLGIPMIYGIDAVHGHNNVYKATVFPHNVGLGATR  145



>ref|XP_010535771.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=633

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            ++ K  S    Y+DP  P+  RVKDL+SRMTL+EKIGQM+QID +VA P  +T Y +GS+
Sbjct  20   VSAKQPSTNVKYKDPKQPLRTRVKDLMSRMTLEEKIGQMVQIDLSVAKPEVMTKYLIGSV  79

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+  A+ E W + ++  QKAAL TRLGIP+IYGIDA+HG+NNVY AT+FPH +
Sbjct  80   LSGGGSVPAQKASPETWVNAVNDIQKAALSTRLGIPMIYGIDAVHGHNNVYNATIFPHNV  139

Query  497  GLGATR  514
            GLG TR
Sbjct  140  GLGVTR  145



>ref|XP_006651822.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=647

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  RVKDLLSRMTL EKIGQM QI+R  AT   I+ YF+GS+LSGGGS P+  
Sbjct  27   YKDPKQPVSVRVKDLLSRMTLAEKIGQMTQIERENATAEQISKYFIGSVLSGGGSVPAPQ  86

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+ + WA M+D  QK AL TRLGIPIIYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  87   ASPQAWASMVDEMQKGALSTRLGIPIIYGIDAVHGHNNVYKATIFPHNVGLGATR  141



>gb|KJB55533.1| hypothetical protein B456_009G081100 [Gossypium raimondii]
Length=630

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y DP+ P+  R++DL+ RM+L EKIGQM+QIDR VATP  + DY +GSILSGGGS P   
Sbjct  29   YNDPSLPINKRIRDLMRRMSLDEKIGQMVQIDRKVATPEVMRDYKIGSILSGGGSVPHLQ  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  +EW +M++GFQ  +L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  89   ATPQEWLNMVNGFQNGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGATR  143



>gb|KHG30203.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=630

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y DP+ P+  R++DL+ RM+L EKIGQM+QIDR VATP  + DY +GSILSGGGS P   
Sbjct  29   YNDPSLPINKRIRDLMRRMSLDEKIGQMVQIDRKVATPEVMRDYKIGSILSGGGSVPHLQ  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A  +EW +M++GFQ  +L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  89   ATPQEWLNMVNGFQNGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGATR  143



>ref|XP_009342674.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342678.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342686.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL+ RMTL EKIGQM QI+R+VATP  +  YF+GS+LSGGGS+P+  
Sbjct  32   YKDPKQPLNARIRDLMKRMTLAEKIGQMTQIERSVATPDVMNKYFIGSVLSGGGSEPAPK  91

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLG TR
Sbjct  92   ASAEAWVNLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  146



>ref|XP_006644778.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=663

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
             A   +SA   Y+DP  P+  R+KDL+SRMTL EKIGQM QI+R VA+   + +YF+GS+
Sbjct  17   FASMADSAYMKYKDPKQPINTRIKDLISRMTLAEKIGQMTQIERGVASADVMKNYFIGSV  76

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P+  A    W +M++ FQ+ AL TRLGIP+IYGIDA+HGNNNVY AT+FPH I
Sbjct  77   LSGGGSVPAPQATPAMWVNMVNEFQRGALSTRLGIPMIYGIDAVHGNNNVYNATLFPHNI  136

Query  497  GLGATR  514
            GLGATR
Sbjct  137  GLGATR  142



>ref|XP_008672748.1| PREDICTED: uncharacterized protein LOC100280148 isoform X2 [Zea 
mays]
Length=496

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL+ RMTL EKIGQM QI+R VA+ + +  YF+GSILSGGGS PS  
Sbjct  45   YKDPKQPINSRIRDLIGRMTLAEKIGQMTQIERQVASANVMKQYFIGSILSGGGSVPSPQ  104

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A+   W +M++ FQK AL TRLGIP+IYGIDA+HGNNNVY AT+FPH IGLGATR
Sbjct  105  ASPAIWVNMVNEFQKGALSTRLGIPLIYGIDAVHGNNNVYNATLFPHNIGLGATR  159



>ref|XP_002514453.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF47949.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=648

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  IESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGG  328
            +E+    Y+DP  PV  RVKDL+ RMTL+EKI QM+QIDR +A+P  +  Y +GS+LSGG
Sbjct  19   VEAEYVKYKDPKQPVGARVKDLMKRMTLEEKIAQMVQIDRLIASPDILKTYSIGSVLSGG  78

Query  329  GSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGA  508
            GS P   A++E+W +MI+GFQ  +L +RLGIP+IYGIDA+HG+NNVY AT+FPH IGLGA
Sbjct  79   GSAPLHEASAEDWVNMINGFQNGSLSSRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGA  138

Query  509  TR  514
            TR
Sbjct  139  TR  140



>ref|XP_002313632.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE87587.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM+QI+R VATP  +  YF+GS+LSGGGS P   
Sbjct  28   YKDPKMPIGARIKDLMKRMTLEEKIGQMVQIERTVATPDVMKQYFIGSVLSGGGSVPGPK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QKA+L TRLGIP+IYGIDA+HG++NVY AT+FPH +GLG TR
Sbjct  88   ASAEAWVNLVNGIQKASLSTRLGIPMIYGIDAVHGHSNVYNATIFPHNVGLGVTR  142



>gb|KHN45535.1| Lysosomal beta glucosidase [Glycine soja]
Length=628

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP AP+  R+ DLL RM+L+EKIGQM QI+R+VATP  +  YF+GS+LSGGGS P+  
Sbjct  28   YKDPKAPLNVRISDLLKRMSLEEKIGQMTQIERSVATPDVMNKYFIGSVLSGGGSVPATK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATRFD  520
            A++  W  M++  QKAAL TRLGIP+IYGIDA+HG+NNVY ATVFPH +GLG TR D
Sbjct  88   ASAATWQQMVNQMQKAALSTRLGIPMIYGIDAVHGHNNVYNATVFPHNVGLGVTRQD  144



>ref|XP_002466456.1| hypothetical protein SORBIDRAFT_01g008050 [Sorghum bicolor]
 gb|EER93454.1| hypothetical protein SORBIDRAFT_01g008050 [Sorghum bicolor]
Length=636

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP   V DRV+DLLSRMTL+EKIGQM QI+RA AT   I  YF+GS+LSGGGS P++ 
Sbjct  31   YKDPKQSVNDRVQDLLSRMTLEEKIGQMSQIERANATTEVIEKYFVGSVLSGGGSVPAEK  90

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++  W  M+   QKAAL+TRLGIPIIYGIDA+HGNN+VY AT+FPH +GLGATR
Sbjct  91   ASASVWQKMVTKMQKAALKTRLGIPIIYGIDAVHGNNDVYNATIFPHNVGLGATR  145



>ref|NP_001051274.1| Os03g0749100 [Oryza sativa Japonica Group]
 gb|AAL58963.1|AC091811_12 unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF98881.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13188.1| Os03g0749100 [Oryza sativa Japonica Group]
 dbj|BAG92991.1| unnamed protein product [Oryza sativa Japonica Group]
Length=644

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+ +RV DLLSRMTL EKIGQM QI+RA AT + I  YF+GS+LSGGGS PS+ 
Sbjct  40   YKDPKKPIGERVDDLLSRMTLAEKIGQMSQIERANATSAVIEKYFVGSVLSGGGSVPSEK  99

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A ++EW  M+   QKAAL+TRLGIPIIYGIDA+HG+NNV+ AT+FPH +GLGATR
Sbjct  100  ATAKEWQQMVAKMQKAALKTRLGIPIIYGIDAVHGHNNVHNATIFPHNVGLGATR  154



>gb|KEH25596.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=685

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+D   P+  R+KDL+ RMTL+EKIGQM+QI+R VA+   +  YF+GS+LSGGGS P   
Sbjct  29   YKDSKQPLNTRIKDLIDRMTLEEKIGQMVQIERGVASAEVMNKYFIGSVLSGGGSVPKPK  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A +++W DMI+ FQK AL TRLGIP+IYGIDA+HGNNNVY AT+FPH +GLGATR
Sbjct  89   ATAKDWVDMINEFQKGALSTRLGIPMIYGIDAVHGNNNVYNATIFPHNVGLGATR  143



>ref|XP_008385601.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
 ref|XP_008359191.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R++DL+ +MTL EKIGQM QI+R VATP  +T YF+GS+LSGGGS P+  
Sbjct  32   YKDPKQPLNARIRDLMKQMTLAEKIGQMTQIERTVATPDVMTKYFIGSVLSGGGSVPAPK  91

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QK +L TRLGIP+IYGIDA+HG+NNVY AT+FPH +GLGATR
Sbjct  92   ASAETWINLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  146



>ref|XP_010103976.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB97679.1| Lysosomal beta glucosidase [Morus notabilis]
Length=669

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = +2

Query  137  MAEKIESAGCVYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSI  316
            MAE+IE     Y+DP  PV  RV+DLLSRMTL+EKIGQM QID++VA    +  Y +GS+
Sbjct  21   MAEEIEYMK--YKDPKQPVAVRVRDLLSRMTLEEKIGQMTQIDKSVANVLTLRTYSIGSV  78

Query  317  LSGGGSKPSDNAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFI  496
            LSGGGS P  +A++E+W +MI+ FQK AL +RLGIP+IYGIDA+HG+NNVY AT+FPH I
Sbjct  79   LSGGGSAPLPDASAEDWINMINEFQKGALSSRLGIPMIYGIDAVHGHNNVYNATIFPHNI  138

Query  497  GLGATR  514
            GLGATR
Sbjct  139  GLGATR  144



>ref|XP_004141202.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
Length=566

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDLL RMTL+EKIGQM+QI+RA A+   +  YF+GS+LSGGGS PS  
Sbjct  29   YKDPKQPLNVRIKDLLGRMTLEEKIGQMVQIERANASADVMKQYFIGSVLSGGGSAPSKQ  88

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++++W  M++  Q+AAL TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  89   ASAKDWVHMVNKIQEAALSTRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATR  143



>gb|EYU26866.1| hypothetical protein MIMGU_mgv1a002476mg [Erythranthe guttata]
Length=668

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  PV  RVKDL+ RMTL+EKIGQMIQIDR  ATP  +T  F+GS+LSGGGS P   
Sbjct  38   YKDPKQPVGVRVKDLIGRMTLQEKIGQMIQIDRIAATPHLMTKSFIGSLLSGGGSTPRPR  97

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++ +W +M++ FQK  L TRLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  98   ASAADWVNMVNDFQKGCLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATR  152



>ref|XP_006379343.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
 gb|ERP57140.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
Length=629

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+  R+KDL+ RMTL+EKIGQM+QI+R VATP  +  YF+GS+LSGGGS P   
Sbjct  28   YKDPKMPIGARIKDLMKRMTLEEKIGQMVQIERTVATPDVMKQYFIGSVLSGGGSVPGPK  87

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A++E W ++++G QKA+L TRLGIP+IYGIDA+HG++NVY AT+FPH +GLG TR
Sbjct  88   ASAEAWVNLVNGIQKASLSTRLGIPMIYGIDAVHGHSNVYNATIFPHNVGLGVTR  142



>gb|KJB44566.1| hypothetical protein B456_007G260100 [Gossypium raimondii]
 gb|KJB44567.1| hypothetical protein B456_007G260100 [Gossypium raimondii]
Length=632

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  167  VYRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSD  346
            +Y+D N P   R+KDL+ RMTL+EKIGQMIQI+R V++P  +  YF+GS+LSGGGS+P+ 
Sbjct  31   IYKDSNQPYNVRIKDLMGRMTLEEKIGQMIQIERNVSSPEVMRKYFIGSLLSGGGSEPTP  90

Query  347  NAASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
             A+ ++W DM++ FQK +L +RLGIP+IYGIDA+HG+NNVY AT+FPH IGLGATR
Sbjct  91   QASPKDWIDMVNEFQKGSLSSRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGATR  146



>gb|EAY91867.1| hypothetical protein OsI_13514 [Oryza sativa Indica Group]
 gb|EAZ28590.1| hypothetical protein OsJ_12576 [Oryza sativa Japonica Group]
Length=637

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  YRDPNAPVEDRVKDLLSRMTLKEKIGQMIQIDRAVATPSAITDYFLGSILSGGGSKPSDN  349
            Y+DP  P+ +RV DLLSRMTL EKIGQM QI+RA AT + I  YF+GS+LSGGGS PS+ 
Sbjct  33   YKDPKKPIGERVDDLLSRMTLAEKIGQMSQIERANATSAVIEKYFVGSVLSGGGSVPSEK  92

Query  350  AASEEWADMIDGFQKAALETRLGIPIIYGIDAIHGNNNVYGATVFPHFIGLGATR  514
            A ++EW  M+   QKAAL+TRLGIPIIYGIDA+HG+NNV+ AT+FPH +GLGATR
Sbjct  93   ATAKEWQQMVAKMQKAALKTRLGIPIIYGIDAVHGHNNVHNATIFPHNVGLGATR  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240