BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049D18

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             224   1e-67   Prunus persica
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          222   6e-67   Sesamum indicum [beniseed]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    222   8e-67   Nicotiana tomentosiformis
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    219   6e-66   Nicotiana tomentosiformis
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    219   9e-66   Nicotiana sylvestris
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               218   2e-65   Vitis vinifera
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          218   3e-65   Solanum tuberosum [potatoes]
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             218   3e-65   Prunus persica
ref|XP_007223091.1|  hypothetical protein PRUPE_ppa007032mg             216   4e-65   
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    217   6e-65   Nicotiana sylvestris
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          217   6e-65   Sesamum indicum [beniseed]
ref|XP_002516727.1|  uv excision repair protein rad23, putative         216   1e-64   Ricinus communis
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          216   2e-64   
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         216   3e-64   Jatropha curcas
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        216   3e-64   Nicotiana tabacum [American tobacco]
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               215   5e-64   Nicotiana sylvestris
gb|KJB80004.1|  hypothetical protein B456_013G076900                    215   6e-64   Gossypium raimondii
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             214   6e-64   Prunus persica
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          214   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               214   2e-63   
gb|KJB80005.1|  hypothetical protein B456_013G076900                    213   4e-63   Gossypium raimondii
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               212   6e-63   Prunus mume [ume]
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    209   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          208   2e-61   
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    208   2e-61   Populus euphratica
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    207   4e-61   Populus euphratica
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          206   1e-60   Amborella trichopoda
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    205   3e-60   Populus euphratica
ref|XP_002305813.1|  ubiquitin family protein                           203   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    203   2e-59   Populus euphratica
ref|XP_006383464.1|  ubiquitin family protein                           202   3e-59   
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          202   4e-59   
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    201   2e-58   Populus euphratica
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          200   3e-58   Pyrus x bretschneideri [bai li]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               197   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    197   3e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          192   8e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58121.1|  BnaCnng32650D                                          192   2e-55   Brassica napus [oilseed rape]
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                196   4e-55   
ref|NP_001130219.1|  uncharacterized protein LOC100191313               186   1e-54   
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    190   2e-54   Setaria italica
tpg|DAA61375.1|  TPA: hypothetical protein ZEAMMB73_350633              189   2e-54   
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             188   9e-54   Capsella rubella
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    187   3e-53   
gb|KDO46130.1|  hypothetical protein CISIN_1g0198171mg                  182   8e-53   Citrus sinensis [apfelsine]
ref|XP_004956777.1|  PREDICTED: probable DNA repair protein RAD23...    187   1e-52   
gb|KDO46129.1|  hypothetical protein CISIN_1g0198171mg                  182   2e-52   Citrus sinensis [apfelsine]
gb|KJB69953.1|  hypothetical protein B456_011G053200                    182   6e-52   Gossypium raimondii
gb|KJB69952.1|  hypothetical protein B456_011G053200                    181   2e-51   Gossypium raimondii
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    182   3e-51   Cucumis melo [Oriental melon]
gb|KDO69966.1|  hypothetical protein CISIN_1g0163871mg                  179   3e-51   Citrus sinensis [apfelsine]
gb|KJB69954.1|  hypothetical protein B456_011G053200                    179   6e-51   Gossypium raimondii
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               180   6e-51   Gossypium arboreum [tree cotton]
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             180   8e-51   Phaseolus vulgaris [French bean]
ref|NP_001240038.1|  uncharacterized protein LOC100819019               179   1e-50   Glycine max [soybeans]
gb|ACU20959.1|  unknown                                                 179   1e-50   Glycine max [soybeans]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    179   2e-50   Glycine max [soybeans]
gb|KJB34920.1|  hypothetical protein B456_006G091100                    179   2e-50   Gossypium raimondii
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               179   3e-50   Gossypium arboreum [tree cotton]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    178   4e-50   Camelina sativa [gold-of-pleasure]
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  177   1e-49   Citrus sinensis [apfelsine]
ref|NP_001149553.1|  LOC100283179                                       177   1e-49   Zea mays [maize]
gb|EMT27109.1|  Putative DNA repair protein RAD23                       178   2e-49   
gb|AAB65841.1|  osRAD23                                                 176   8e-49   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063134.1|  Os09g0407200                                       175   1e-48   
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          174   1e-48   Pyrus x bretschneideri [bai li]
gb|ACH72675.1|  RAD23                                                   175   1e-48   Pinus sylvestris var. mongolica
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               172   5e-48   Tarenaya hassleriana [spider flower]
gb|ABK24371.1|  unknown                                                 173   5e-48   Picea sitchensis
gb|KJB67005.1|  hypothetical protein B456_010G170000                    172   1e-47   Gossypium raimondii
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             170   5e-47   Arabidopsis lyrata subsp. lyrata
ref|NP_974181.1|  ubiquitin receptor RAD23b                             169   1e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76389.1|  RAD23-like protein                                     169   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850982.1|  ubiquitin receptor RAD23b                             169   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565216.2|  ubiquitin receptor RAD23b                             168   4e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76390.1|  RAD23-like protein                                     167   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     169   8e-46   Glycine soja [wild soybean]
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    167   8e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    167   8e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      158   1e-42   Brassica rapa
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             155   4e-41   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    149   3e-39   Cucumis melo [Oriental melon]
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    142   4e-36   Nicotiana sylvestris
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    141   4e-36   Nicotiana sylvestris
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    141   5e-36   Nicotiana tomentosiformis
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    141   5e-36   
ref|XP_009597821.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    134   1e-35   Nicotiana tomentosiformis
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    140   1e-35   Solanum lycopersicum
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    140   1e-35   Solanum lycopersicum
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    140   1e-35   Solanum lycopersicum
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          140   1e-35   
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               140   1e-35   Solanum lycopersicum
gb|KDO58999.1|  hypothetical protein CISIN_1g014118mg                   137   4e-35   Citrus sinensis [apfelsine]
emb|CDP19777.1|  unnamed protein product                                138   9e-35   Coffea canephora [robusta coffee]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          138   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               138   1e-34   Camelina sativa [gold-of-pleasure]
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   137   1e-34   Citrus sinensis [apfelsine]
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    137   2e-34   Vitis vinifera
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    137   2e-34   Vitis vinifera
emb|CDX74251.1|  BnaA03g27960D                                          137   2e-34   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               137   2e-34   Brassica rapa
gb|ACJ83348.1|  unknown                                                 131   2e-34   Medicago truncatula
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    136   4e-34   Citrus sinensis [apfelsine]
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    137   4e-34   Arabis alpina [alpine rockcress]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   136   4e-34   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   136   4e-34   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   136   4e-34   Citrus sinensis [apfelsine]
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    136   4e-34   Citrus sinensis [apfelsine]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    137   4e-34   Arabis alpina [alpine rockcress]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   136   4e-34   Citrus sinensis [apfelsine]
emb|CDX91998.1|  BnaC03g33000D                                          136   5e-34   
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          136   5e-34   
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             136   6e-34   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             136   6e-34   
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             135   6e-34   Citrus clementina [clementine]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          136   7e-34   Camelina sativa [gold-of-pleasure]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                136   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_008361862.1|  PREDICTED: ubiquitin receptor RAD23c-like          127   7e-34   
ref|XP_009597820.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    133   9e-34   Nicotiana tomentosiformis
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   135   9e-34   Citrus sinensis [apfelsine]
ref|NP_974211.1|  UV excision repair protein RAD23C                     133   9e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ABB02636.1|  RAD23-like                                              135   1e-33   Solanum tuberosum [potatoes]
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   135   1e-33   Citrus sinensis [apfelsine]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               134   2e-33   Solanum tuberosum [potatoes]
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             134   2e-33   Eutrema salsugineum [saltwater cress]
gb|ACU18469.1|  unknown                                                 128   4e-33   Glycine max [soybeans]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          134   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             134   5e-33   Capsella rubella
gb|ABD96960.1|  hypothetical protein                                    133   6e-33   Tarenaya spinosa
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    133   6e-33   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    133   7e-33   
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                132   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    132   1e-32   
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          132   1e-32   Cucumis melo [Oriental melon]
ref|NP_186903.1|  UV excision repair protein RAD23C                     132   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       132   1e-32   Cucumis sativus [cucumbers]
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          132   1e-32   Tarenaya hassleriana [spider flower]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  132   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240201.1|  uncharacterized protein LOC100809066               132   2e-32   Glycine max [soybeans]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                131   2e-32   Erythranthe guttata [common monkey flower]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                131   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    131   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                131   3e-32   Morus notabilis
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    131   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   5e-32   Glycine max [soybeans]
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    130   5e-32   Cicer arietinum [garbanzo]
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    130   5e-32   
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    130   6e-32   
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    131   6e-32   
gb|KEH44233.1|  RAD23 UV excision repair family protein                 130   6e-32   Medicago truncatula
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    131   6e-32   Glycine max [soybeans]
ref|NP_001242098.1|  uncharacterized protein LOC100813881               130   6e-32   
gb|ACU18529.1|  unknown                                                 130   6e-32   Glycine max [soybeans]
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    131   6e-32   
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    131   6e-32   
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    130   6e-32   
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    130   6e-32   Phoenix dactylifera
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   6e-32   Phoenix dactylifera
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    131   7e-32   
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     130   1e-31   Glycine soja [wild soybean]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   2e-31   
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             129   2e-31   
emb|CDP02781.1|  unnamed protein product                                128   3e-31   Coffea canephora [robusta coffee]
ref|XP_006437672.1|  hypothetical protein CICLE_v10031777mg             125   3e-31   
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          128   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    128   3e-31   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    128   3e-31   Fragaria vesca subsp. vesca
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   6e-31   Elaeis guineensis
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          127   6e-31   Phoenix dactylifera
ref|XP_006437673.1|  hypothetical protein CICLE_v10031777mg             126   6e-31   
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   6e-31   Elaeis guineensis
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               127   7e-31   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     127   7e-31   Glycine soja [wild soybean]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             127   7e-31   Phaseolus vulgaris [French bean]
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   8e-31   Elaeis guineensis
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   8e-31   Elaeis guineensis
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg             125   1e-30   
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    126   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   2e-30   Citrus sinensis [apfelsine]
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             125   3e-30   Citrus clementina [clementine]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         125   3e-30   Ricinus communis
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   4e-30   Elaeis guineensis
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    124   7e-30   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    124   7e-30   Populus euphratica
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             124   1e-29   Phaseolus vulgaris [French bean]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          124   1e-29   
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   1e-29   
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   2e-29   
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             123   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   2e-29   Phoenix dactylifera
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   2e-29   Phoenix dactylifera
gb|KJB80001.1|  hypothetical protein B456_013G076800                    121   4e-29   Gossypium raimondii
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          122   7e-29   Elaeis guineensis
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    121   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    121   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    121   9e-29   Populus euphratica
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    121   9e-29   Populus euphratica
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    121   1e-28   Populus euphratica
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    121   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    121   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB79998.1|  hypothetical protein B456_013G076800                    121   1e-28   Gossypium raimondii
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             121   1e-28   
gb|KJB80000.1|  hypothetical protein B456_013G076800                    121   1e-28   Gossypium raimondii
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          120   1e-28   Populus euphratica
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    120   2e-28   
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             119   2e-28   
gb|EPS71284.1|  hypothetical protein M569_03474                         120   3e-28   Genlisea aurea
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          120   3e-28   
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    119   5e-28   
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA72741.1|  RAD23, isoform I                                       119   7e-28   Daucus carota [carrots]
gb|KJB79994.1|  hypothetical protein B456_013G076500                    119   8e-28   Gossypium raimondii
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    118   9e-28   Glycine max [soybeans]
gb|KJB79995.1|  hypothetical protein B456_013G076600                    118   1e-27   Gossypium raimondii
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Populus euphratica
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          118   1e-27   Fragaria vesca subsp. vesca
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    117   2e-27   Cicer arietinum [garbanzo]
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          118   2e-27   Oryza brachyantha
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   2e-27   Populus euphratica
gb|AFK37901.1|  unknown                                                 114   2e-27   Medicago truncatula
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             116   5e-27   
ref|NP_001057334.1|  Os06g0264300                                       116   6e-27   
gb|EAZ00429.1|  hypothetical protein OsI_22453                          116   6e-27   Oryza sativa Indica Group [Indian rice]
gb|KJB79996.1|  hypothetical protein B456_013G076600                    115   7e-27   Gossypium raimondii
gb|ACN40029.1|  unknown                                                 115   1e-26   Picea sitchensis
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    115   1e-26   Arabis alpina [alpine rockcress]
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               115   1e-26   Brassica rapa
emb|CDX67404.1|  BnaA07g14440D                                          115   2e-26   
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   2e-26   Camelina sativa [gold-of-pleasure]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 114   2e-26   Medicago truncatula
gb|KCW86330.1|  hypothetical protein EUGRSUZ_B03019                     114   2e-26   Eucalyptus grandis [rose gum]
gb|AFK37577.1|  unknown                                                 114   2e-26   Lotus japonicus
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    114   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    114   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002444556.1|  hypothetical protein SORBIDRAFT_07g023746          110   3e-26   
emb|CDY01661.1|  BnaC04g30910D                                          114   4e-26   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               114   5e-26   Brassica rapa
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          114   5e-26   Brachypodium distachyon [annual false brome]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             113   7e-26   
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          113   7e-26   Eucalyptus grandis [rose gum]
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             113   7e-26   
emb|CDX74522.1|  BnaA04g08670D                                          113   9e-26   
dbj|BAC76395.1|  RAD23-like protein                                     112   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    112   2e-25   
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             112   2e-25   Eutrema salsugineum [saltwater cress]
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       112   2e-25   Cucumis sativus [cucumbers]
ref|NP_198663.1|  ubiquitin receptor RAD23d                             112   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59766.1|  unknown protein                                         112   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       111   3e-25   Brachypodium distachyon [annual false brome]
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    111   3e-25   
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               111   5e-25   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAC76393.1|  RAD23-like protein                                     110   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EMS50196.1|  putative DNA repair protein RAD23                       112   8e-25   Triticum urartu
gb|EMS61794.1|  putative DNA repair protein RAD23                       110   1e-24   Triticum urartu
gb|KDO46132.1|  hypothetical protein CISIN_1g0198171mg                  107   1e-24   Citrus sinensis [apfelsine]
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    109   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    109   2e-24   Setaria italica
dbj|BAJ97496.1|  predicted protein                                      109   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            108   2e-24   
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          109   2e-24   Cucumis melo [Oriental melon]
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    109   2e-24   Cucumis sativus [cucumbers]
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    108   2e-24   Populus euphratica
dbj|BAJ98767.1|  predicted protein                                      109   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                109   2e-24   
gb|EAZ07072.1|  hypothetical protein OsI_29318                          109   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_002303970.1|  DNA repair protein RAD23                           108   2e-24   
ref|NP_001061854.1|  Os08g0430200                                       109   2e-24   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             108   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          108   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    108   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          108   3e-24   Citrus sinensis [apfelsine]
ref|XP_002512770.1|  uv excision repair protein rad23, putative         108   4e-24   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...    108   4e-24   
ref|XP_007024819.1|  Rad23 UV excision repair protein family isof...    107   4e-24   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              108   5e-24   
gb|ACG32894.1|  DNA repair protein RAD23                                108   5e-24   
ref|NP_001149140.1|  LOC100282762                                       108   5e-24   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          107   6e-24   
gb|KDO46131.1|  hypothetical protein CISIN_1g0198171mg                  106   7e-24   
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    107   9e-24   
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    107   9e-24   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    107   9e-24   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    107   9e-24   
ref|XP_001763027.1|  predicted protein                                  107   1e-23   
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    107   1e-23   
gb|ACF79443.1|  unknown                                                 107   1e-23   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 107   1e-23   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               107   1e-23   
gb|ACN26781.1|  unknown                                                 106   1e-23   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110          106   2e-23   
ref|NP_001172955.1|  Os02g0465112                                       100   2e-23   
dbj|BAD19842.1|  RAD23 protein-like                                     101   2e-23   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    106   2e-23   
ref|XP_006427691.1|  hypothetical protein CICLE_v100258681mg            100   2e-23   
gb|EEC73129.1|  hypothetical protein OsI_07141                          104   2e-23   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              106   2e-23   
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    106   2e-23   
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    106   3e-23   
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    105   3e-23   
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    105   3e-23   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      105   3e-23   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               105   3e-23   
emb|CDO98260.1|  unnamed protein product                                105   3e-23   
gb|KJB34921.1|  hypothetical protein B456_006G091100                    105   4e-23   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    105   4e-23   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               105   4e-23   
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               105   5e-23   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    105   5e-23   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     105   5e-23   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    105   5e-23   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              105   5e-23   
ref|XP_003637291.1|  RAD23 protein                                      104   6e-23   
ref|XP_001780766.1|  predicted protein                                  104   7e-23   
emb|CBI25247.3|  unnamed protein product                                104   7e-23   
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               104   8e-23   
ref|XP_009605626.1|  PREDICTED: probable ubiquitin receptor RAD23a    99.8    8e-23   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    104   1e-22   
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    104   1e-22   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          103   1e-22   
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   1e-22   
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          103   1e-22   
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             103   1e-22   
ref|NP_001266655.1|  DNA repair protein RAD23                           103   2e-22   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         103   2e-22   
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             103   3e-22   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   3e-22   
ref|XP_002299163.1|  DNA repair protein RAD23                           102   3e-22   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   3e-22   
gb|ACJ84340.1|  unknown                                               98.2    3e-22   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    102   3e-22   
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   3e-22   
gb|EEE56950.1|  hypothetical protein OsJ_06656                          101   4e-22   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   4e-22   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg                102   4e-22   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   6e-22   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                102   6e-22   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   7e-22   
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   7e-22   
gb|AAF18513.1|AC010924_26  Contains similarity to gb|Y12014 RAD23...    100   8e-22   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   9e-22   
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   9e-22   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             101   1e-21   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   1e-21   
gb|EMT30328.1|  Putative DNA repair protein RAD23                       102   1e-21   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   1e-21   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   1e-21   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   1e-21   
gb|ABG89119.1|  Rad23-3Ai                                               100   2e-21   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          100   2e-21   
gb|ACF83232.1|  unknown                                               98.2    2e-21   
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   2e-21   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   2e-21   
emb|CAN62701.1|  hypothetical protein VITISV_007064                     100   2e-21   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   2e-21   
gb|AAF68123.1|AC010793_18  F20B17.8                                     100   3e-21   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein             99.8    4e-21   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b             99.8    4e-21   
dbj|BAC76391.1|  RAD23-like protein                                   99.8    4e-21   
ref|NP_173070.1|  DNA repair protein RAD23A                           99.8    4e-21   
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.0    5e-21   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a    99.4    5e-21   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a    99.4    5e-21   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg           99.4    5e-21   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg           99.4    5e-21   
gb|EPS72838.1|  hypothetical protein M569_01918                       99.0    5e-21   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...  99.4    5e-21   
ref|XP_001752113.1|  predicted protein                                94.0    6e-21   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b             99.4    6e-21   
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599           99.0    7e-21   
gb|AFW66284.1|  hypothetical protein ZEAMMB73_839350                  97.8    1e-20   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2               98.2    1e-20   
ref|NP_001148810.1|  LOC100282427                                     98.2    1e-20   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like        98.2    2e-20   
emb|CDX67983.1|  BnaA07g20230D                                        98.6    2e-20   
gb|EEC72612.1|  hypothetical protein OsI_06092                        97.4    3e-20   
ref|NP_001046083.1|  Os02g0179300                                     97.4    3e-20   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370        97.1    3e-20   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg           97.1    3e-20   
emb|CDX69473.1|  BnaA10g18220D                                        99.4    4e-20   
emb|CDX69474.1|  BnaA10g18230D                                        96.7    5e-20   
ref|XP_001775909.1|  predicted protein                                94.0    5e-20   
emb|CDX79333.1|  BnaC06g19700D                                        96.7    5e-20   
emb|CAA72742.1|  RAD23 protein, isoform II                            96.7    5e-20   
emb|CDY33351.1|  BnaC05g12320D                                        96.3    5e-20   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                   96.7    8e-20   
emb|CDX81753.1|  BnaC08g38480D                                        94.7    2e-19   
ref|XP_009121517.1|  PREDICTED: ubiquitin receptor RAD23c-like        94.7    2e-19   
ref|XP_003622299.1|  hypothetical protein MTR_7g032690                94.7    2e-19   
ref|XP_003622298.1|  hypothetical protein MTR_7g032690                95.1    2e-19   
dbj|BAK04690.1|  predicted protein                                    94.4    3e-19   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  94.4    3e-19   
emb|CDY35071.1|  BnaA06g10810D                                        93.6    5e-19   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a    93.6    5e-19   
gb|ABY66298.1|  RAD23-like protein                                    93.2    8e-19   
ref|XP_009121516.1|  PREDICTED: ubiquitin receptor RAD23c-like        92.8    9e-19   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like        92.8    9e-19   
gb|KFK25846.1|  hypothetical protein AALP_AA8G169700                  92.8    1e-18   
gb|ABN05900.1|  Ubiquitin                                             94.7    1e-18   
emb|CAC01850.1|  putative protein                                     89.4    1e-18   
ref|XP_006281616.1|  hypothetical protein CARUB_v10027742mg           87.4    2e-18   
ref|NP_197113.4|  uncharacterized protein                             89.4    3e-18   
ref|XP_005818125.1|  Rad23 nucleotide excision repair protein bin...  91.3    4e-18   
emb|CDY26494.1|  BnaC09g41740D                                        89.7    6e-18   
ref|XP_003622297.1|  hypothetical protein MTR_7g032690                92.4    8e-18   
emb|CEG67900.1|  Putative UV excision repair protein Rad23            89.7    1e-17   
emb|CDY26493.1|  BnaC09g41750D                                        88.6    3e-17   
ref|XP_003455006.1|  PREDICTED: UV excision repair protein RAD23 ...  87.8    6e-17   
ref|XP_005931261.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    1e-16   
ref|XP_004549657.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    1e-16   
ref|XP_006789078.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    1e-16   
ref|XP_010485077.1|  PREDICTED: uncharacterized protein LOC104763398  88.2    1e-16   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...  86.3    2e-16   
gb|ABY66299.1|  DNA repair protein RAD23                              85.5    3e-16   
ref|XP_010446048.1|  PREDICTED: uncharacterized protein LOC104728818  85.9    8e-16   
ref|XP_010236294.1|  PREDICTED: ubiquitin receptor RAD23b-like        83.6    9e-16   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                   85.5    1e-15   
ref|XP_009122868.1|  PREDICTED: ubiquitin receptor RAD23d-like        83.2    2e-15   
gb|ABC60029.1|  DNA repair protein                                    82.4    4e-15   
emb|CDY26496.1|  BnaC09g41720D                                        82.4    5e-15   
gb|EYU21790.1|  hypothetical protein MIMGU_mgv1a026286mg              80.1    5e-15   
gb|AFK43607.1|  unknown                                               80.5    6e-15   
ref|XP_004973490.1|  PREDICTED: probable DNA repair protein RAD23...  75.5    6e-14   
ref|XP_005646102.1|  UV excision repair protein Rad23                 79.3    7e-14   
ref|XP_002873756.1|  hypothetical protein ARALYDRAFT_326056           74.7    2e-13   
emb|CCA21947.1|  UV excision repair protein RAD23 putative            75.9    2e-12   
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein             72.4    3e-12   
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633            72.0    6e-12   
pdb|1P1A|A  Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hh...  68.2    1e-11   
pdb|1UEL|A  Chain A, Solution Structure Of Ubiquitin-Like Domain ...  67.8    2e-11   
gb|KIW97364.1|  UV excision repair protein Rad23                      72.0    2e-11   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...  70.9    5e-11   
ref|XP_006088115.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    9e-11   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    9e-11   
ref|XP_006088114.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    1e-10   
ref|XP_010755175.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    1e-10   
ref|XP_005989968.1|  PREDICTED: UV excision repair protein RAD23 ...  70.1    1e-10   
ref|XP_007499697.1|  PREDICTED: UV excision repair protein RAD23 ...  70.1    1e-10   
ref|XP_007499698.1|  PREDICTED: UV excision repair protein RAD23 ...  70.1    1e-10   
ref|XP_008054682.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    1e-10   
ref|XP_008586188.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    1e-10   
dbj|BAE39643.1|  unnamed protein product                              69.3    1e-10   
ref|XP_006882076.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    2e-10   
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140            67.8    2e-10   
ref|XP_001927901.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    2e-10   
ref|XP_011363293.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
gb|ETL78956.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETM32232.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETI31946.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETP29927.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETL25740.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETK72284.1|  UV excision repair protein Rad23                      69.7    2e-10   
ref|XP_004423355.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    2e-10   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...  69.7    2e-10   
ref|XP_008914834.1|  UV excision repair protein Rad23                 69.7    2e-10   
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|NP_002865.1|  UV excision repair protein RAD23 homolog B isof...  69.3    2e-10   
ref|XP_005362253.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
gb|AAV38508.1|  RAD23 homolog B (S. cerevisiae)                       69.3    2e-10   
gb|AAH68193.1|  Rad23b protein                                        69.3    2e-10   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
gb|AAH20973.1|  RAD23B protein                                        69.3    2e-10   
ref|NP_033037.2|  UV excision repair protein RAD23 homolog B          69.3    2e-10   
ref|XP_004581217.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    2e-10   
ref|XP_005581182.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|NP_001271836.1|  uncharacterized protein LOC101866175             69.3    2e-10   
ref|XP_007966681.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_009186620.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
dbj|BAD97199.1|  UV excision repair protein RAD23 homolog B variant   69.3    2e-10   
ref|XP_006985330.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_004677510.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
dbj|BAE25006.1|  unnamed protein product                              69.3    2e-10   
ref|XP_005076549.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|NP_001020446.1|  UV excision repair protein RAD23 homolog B       69.3    2e-10   
ref|NP_001248717.1|  UV excision repair protein RAD23 homolog B       68.9    2e-10   
emb|CAA63146.1|  MHR23B                                               69.3    2e-10   
dbj|BAG57014.1|  unnamed protein product                              68.9    2e-10   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_009186622.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_010387756.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_007950131.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_003470962.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
gb|AAX43553.1|  RAD23-like B                                          68.9    2e-10   
ref|XP_004848222.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    3e-10   
dbj|BAE34014.1|  unnamed protein product                              68.9    3e-10   
emb|CCI46099.1|  unnamed protein product                              69.7    3e-10   
ref|XP_004638157.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    3e-10   



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 151/197 (77%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M+ K+KSSSGEGS +STATT      S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSSGEGSGASTATTTKAPQPSAPSAAPTATLTAPQAPIPTSA  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                       + A T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121  PPASVTTPAPVSSATTEVESDPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNP RA++YLYSG
Sbjct  181  RAAFNNPARAIDYLYSG  197



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDETTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+ M     +S  G+A+++A   + +   S ++        A +PAP  A
Sbjct  61   ENKVAENSFVVI-MLTKNKASSSGAATASAVASSTSQPVSNTSLPTQPVTAAPSPAPTVA  119

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                   +        A S DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  120  PLQSAPESAPVPAPTPASSTDVYGQAASNLVAGNNLEATVQQILDMGGGSWDRDTVVRAL  179

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLYSG
Sbjct  180  RAAYNNPERAVEYLYSG  196



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  437
            ENKVAEN+FVV+M++K K S+   SA+    + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLSKNKVSTSATSATQPTPSNTAQPATSTGQPTQTVTAPQATAASVAP  120

Query  438  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
              SAP     PA  P       DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+R
Sbjct  121  AQSAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            ALRAA+NNPERA+EYLYSG
Sbjct  181  ALRAAFNNPERAIEYLYSG  199



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 139/197 (71%), Gaps = 16/197 (8%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M+                +    A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------SKAQPATSTGQPTQTVTAPQATAASVAPAQ  104

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            SAP     PA  P       DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+RAL
Sbjct  105  SAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRAL  164

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERA+EYLYSG
Sbjct  165  RAAFNNPERAIEYLYSG  181



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  437
            ENKVAEN+FVV+M+AK K S+   SA+  A + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLAKNKVSTSATSAAQPAPSNTAQPATSTGQPTQTVTAPQATAASLAP  120

Query  438  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
              SAP     PA  P  +    DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+R
Sbjct  121  AQSAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            ALRAA+NNPERA+EYLYSG
Sbjct  181  ALRAAFNNPERAIEYLYSG  199



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE V G++VYPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN+VAE++FVV+M+  +K+    G AS+T+   T      +S+         +  APV A
Sbjct  61   ENQVAESSFVVIML--SKNKVSAGGASTTSAAPTSQAQPVSSSPPTSNQPSTAPQAPVVA  118

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
               V            +   D+YGQAASNLVAGNNLE  IQQILDMGGG+WDR+TVVRAL
Sbjct  119  LPEVIPEPAPAVAPSISSDSDIYGQAASNLVAGNNLEVTIQQILDMGGGSWDRDTVVRAL  178

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLYSG
Sbjct  179  RAAYNNPERAVEYLYSG  195



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 150/197 (76%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDATTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M++K K SS   S+   A + T  PA ST  +      P +  A   +
Sbjct  61   ENKVAENSFVVIMLSKNKVSSTGTSSIPAAPSNTAQPAGSTDQARQTITAPQATAALPQS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            ++    A+     A  +   DVY QAASNLVAG+NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  121  ASESAPASAPVPAAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAV+YLYSG
Sbjct  181  RAAFNNPERAVDYLYSG  197



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 148/197 (75%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M+ K+KSS GEGS +STAT       S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            S          + A      + YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121  SPASVTTPAPVSSATMEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNP RA++YLYSG
Sbjct  181  RAAFNNPARAIDYLYSG  197



>ref|XP_007223091.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24290.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=322

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 147/198 (74%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  264  ENKVAENNFVVVMMaktksss-gegsasstattktiapasstsastapapvpasapapvp  440
            ENKVAEN+FVV+M+ K+KSS      AS+   TK   P++ ++A T     P +      
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
            + A V   AP  +        + YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRA
Sbjct  121  SPASVTTPAPVSSATMDRVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            LRAA+NNP RA++YLYSG
Sbjct  181  LRAAFNNPARAIDYLYSG  198



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 137/197 (70%), Gaps = 16/197 (8%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M+                     A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------AKAQPATSTGQPTQTVTAPQATAASLAPAQ  104

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            SAP     PA  P  +    DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+RAL
Sbjct  105  SAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRAL  164

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERA+EYLYSG
Sbjct  165  RAAFNNPERAIEYLYSG  181



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            M+IFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQMLIHQGKVLKDATTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAE +FV V+M     +S  G+A+++A   +   + S + S       A  PAPV A
Sbjct  61   ENKVAEKSFV-VVMLTKNKASSSGAATASAAPSSKTQSVSDTPSPTQPVSAAPTPAPVAA  119

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                   +        A S DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RAL
Sbjct  120  PPQSAPESAPVPAPTPASSTDVYGQAASNLVAGSNLETTVQQILDMGGGSWDRETVIRAL  179

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLY+G
Sbjct  180  RAAYNNPERAVEYLYTG  196



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 147/197 (75%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEI+VKPEDTV DVK +IE  QG++VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+F+V+M+   +  S  G +++++   + A  +ST   +A  P   +    V A
Sbjct  61   ENKVAENSFIVIML-SKRKVSPSGGSTASSAPPSQAQPASTLPPSATQPSTTAQAPAVTA  119

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
              P   A   P   P +   D+YGQAASNLVAG+NLE  +QQILDMGGG+WDRETV RAL
Sbjct  120  ELPQSAAESTPVVNPVSSETDIYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVARAL  179

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  180  RAAFNNPERAVEYLYSG  196



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 143/197 (73%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M+     SS    + ++  T T AP  S SA+         AP P  A
Sbjct  61   ENKVAENSFVVIML-TKSKSSLGEGSGASTATITKAPQPSASAAPTVTLTAPQAPIPTSA  119

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                       + A T    + YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  120  LPASVTTPAPVSLATTEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  179

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNP RA++YLYSG
Sbjct  180  RAAFNNPARAIDYLYSG  196



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 152/197 (77%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+QGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIYQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVA+N+F+V+M++K+K SSG  SA+ST       PASS  +          APAP PA
Sbjct  61   ENKVADNSFIVIMLSKSKVSSGGTSAASTGPPSQAQPASSLPSHATQPSTTTEAPAPTPA  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
              P    +      P +   DVYGQAASNLVAGNNLE  IQQILDMGGG+W RETVVRAL
Sbjct  121  PPPSAAESIPAVANPVSSESDVYGQAASNLVAGNNLEATIQQILDMGGGSWTRETVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLYSG
Sbjct  181  RAAYNNPERAVEYLYSG  197



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  444  sapvpvaapaptpap--tagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
            + P   +  AP P P   +   DVY QAASNLVAG+ LE  +Q ILDMGGG+WDRETVVR
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVR  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            ALRAAYNNPERAV+YLYSG
Sbjct  181  ALRAAYNNPERAVDYLYSG  199



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  444  sapvpvaapaptpap--tagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
            + P   +  AP P P   +   DVY QAASNLVAG+ LE  +Q ILDMGGG+WDRETVVR
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVR  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            ALRAAYNNPERAV+YLYSG
Sbjct  181  ALRAAYNNPERAVDYLYSG  199



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             A     +     +      DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLYSG
Sbjct  178  RAAYNNPERAVEYLYSG  194



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 2/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPE+ VADVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVADVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN+VAEN+F+V+M+  TK+ +    ASST    T     +++ ++   PV + AP    A
Sbjct  61   ENQVAENSFIVIML--TKNKASPSGASSTKGAATSQAQPASTPTSTAPPVASPAPVRAVA  118

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             +   V  PA      +   DVYGQAASNLVAG NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  179  RAAFNNPERAVEYLYSG  195



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 143/197 (73%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEASKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+M+ K+ S  GEGS +STA T      S+ + +       + APA    
Sbjct  61   ENKVAENSFVVIMLTKSTSPPGEGSGASTAATTKAPQPSAHTGAPTATLTASPAPAAAST  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                         A T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121  LPASVATPAPVASATTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNP RA++YLYSG
Sbjct  181  RAAFNNPARAIDYLYSG  197



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 146/197 (74%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDTTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKVAEN+FVV+ M      S  G++S +A     A    ++           A A +P 
Sbjct  61   ENKVAENSFVVI-MLSKNKVSSTGTSSISAALSNTAQPDGSTDQARQTITTPQATAALPQ  119

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            SA      PAP PA  +   DVY QAASNLVAG+NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  120  SASESAPTPAPVPAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  179

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  180  RAAYNNPERAVDYLYSG  196



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 140/196 (71%), Gaps = 3/196 (2%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             A     +     +      DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  624  RAAYNNPERAVEYLYS  671
            RAAYNNPERAVEYLYS
Sbjct  178  RAAYNNPERAVEYLYS  193



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPE+ V+DVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVSDVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN+VAEN+F+VVM+  TK+ +    ASST    T     +++ ++   PV   AP    A
Sbjct  61   ENQVAENSFIVVML--TKNKASPSGASSTKGAATSQAQPASTPTSTTPPVATPAPVRAVA  118

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             +   V  PA      +   DVYGQAASNLVAG NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  624  RAAYNNPERAVEYLYS  671
            RAA+NNPERAVEYLYS
Sbjct  179  RAAFNNPERAVEYLYS  194



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 143/197 (73%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENK++EN F+V +M      S  G+++++A   + +  S   A+   +    + P P   
Sbjct  61   ENKISENGFIV-IMLSKSKVSSSGTSTASAPPASASQPSQAPAAPRVSAPTVAVPEPTSG  119

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             A     A A   AP     DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRAL
Sbjct  120  PATATATATATAAAPVLAQTDVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRAL  179

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLYSG
Sbjct  180  RAAYNNPERAVEYLYSG  196



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 144/197 (73%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +N VAEN+F+V+M+ K K+S    S+   A T    PAS+   S AP P   +    +  
Sbjct  61   QNNVAENSFIVIMLTKPKASPAGASSKQGAATSQAQPASTAPTSAAPPPAAPAPAPALLQ  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
              P P    A   APT    DVYGQAASNLVAG  LE  +QQILDMGGG+WDRETVVRAL
Sbjct  121  LLPQPXXQTAAVVAPTDSRSDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  181  RAAFNNPERAVEYLYSG  197



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 149/197 (76%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            E+KVAEN+F+VVM++K+K SSG  S ++ A      P SS  ++       A A  P   
Sbjct  61   ESKVAENSFIVVMLSKSKVSSGGPSTATAAPPTLAQPTSSLPSNVTQPSSTAQAAVPAAV  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                  ++PA   +  +   D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRAL
Sbjct  121  PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  181  RAAFNNPERAVEYLYSG  197



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E++F VVM++K+K SS   S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                   +            ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRAL
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  181  RAAFNNPERAVEYLYSG  197



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 149/199 (75%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKG+HFEIEV+P DTV+ VKK+IET+ G +VYPA+Q +LIHQGKVLKD TTL 
Sbjct  1    MKLFVKTLKGSHFEIEVEPSDTVSAVKKNIETIHGQDVYPAAQQLLIHQGKVLKDDTTLL  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKVAENNF+V+M+ KTK+ +G G++++++ T  + P SS+  +   +  PA   A    
Sbjct  61   DNKVAENNFLVIMLTKTKAPAGGGTSTTSSATAQVQPPSSSPPNPPTSAPPAQTAATPSP  120

Query  444  sapvpvaapaptpaptagsgD--VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
                              SGD  VYGQAASNLVAG+NLE AIQQILDMGGG+WDR+TVVR
Sbjct  121  PVAAAPTTVNQPATALLSSGDADVYGQAASNLVAGSNLEQAIQQILDMGGGSWDRDTVVR  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            ALRAAYNNPERAVEYLYSG
Sbjct  181  ALRAAYNNPERAVEYLYSG  199



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 145/197 (74%), Gaps = 12/197 (6%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E++F VVM+            S      ++    +  + T+ APVPA+A      
Sbjct  61   ENKVSESSFFVVML------------SKAPPASSLPSNVTQPSITSQAPVPAAAFCESCR  108

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                  ++PA   +  +   ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRAL
Sbjct  109  PQSAAESSPAVVTSALSLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRAL  168

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  169  RAAFNNPERAVEYLYSG  185



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 148/197 (75%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E++F VVM++K+K SSG  S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSGGPSTAPAAPASQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                   +            ++YGQAASNLVAG+NLE  IQ+ILDMGGG W+RETVVRAL
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQEILDMGGGDWNRETVVRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERA++YLYSG
Sbjct  181  RAAFNNPERAIDYLYSG  197



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 145/197 (74%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            E+KVAEN+F+VV M      S  G +++TA   +  P SS  ++       A A  P   
Sbjct  61   ESKVAENSFIVV-MLSKSKVSSGGPSTATAAPPSAQPTSSLPSNVTQPSSTAQAAVPAAV  119

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                  ++PA   +  +   D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRAL
Sbjct  120  PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  179

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  180  RAAFNNPERAVEYLYSG  196



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVA-DVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  260
            MK+FVKTLKGT+FEIEVKPEDTV  +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTL  60

Query  261  EENKVAENNFVVVMMaktksss-gegsasstattktiapasstsastapapvpasapapv  437
            +E+KVAEN+F+VVM++K+K SS G  +A++     +    S+ +A+           +  
Sbjct  61   DESKVAENSFIVVMLSKSKVSSGGPSTATAAPPNVSSGGPSTATAAPPTLVSAQPTSSLP  120

Query  438  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
                     + A  PA      D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVR
Sbjct  121  SNVTQPSSTSQAAVPAAAFSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVR  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            ALRAA+NNPERAVEYLYSG
Sbjct  181  ALRAAFNNPERAVEYLYSG  199



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  440
             NKVAEN+F V+++        GEGS +STA T      S+ + +         AP    
Sbjct  61   GNKVAENSFVVIMLTKSKSPPGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPXAAS  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
            A               T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRA
Sbjct  121  ALPAPVTTPAPVASPTTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            LRAA+NNP RA++YLYSG
Sbjct  181  LRAAFNNPARAIDYLYSG  198



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 147/198 (74%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  264  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  440
            ENKV+E++F VV++     SSSG  +A +   ++    +S  S  T P+    +      
Sbjct  61   ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
                   ++PA   +  +   ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRA
Sbjct  121  LPQSAAESSPAVVTSALSLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            LRAA+NNPERAVEYLYSG
Sbjct  181  LRAAFNNPERAVEYLYSG  198



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 138/198 (70%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  440
             NKVAEN+F V+++      + GEGS +STA T      S+ + +         APA   
Sbjct  61   GNKVAENSFVVIMLTKSKSPTGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPAAAS  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
            A               T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVV A
Sbjct  121  ALPASVTTPAPVASPTTNSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVCA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            LRAA+NNP RA++YLYSG
Sbjct  181  LRAAFNNPARAIDYLYSG  198



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK++VKTLKGT+FEIEVK E+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVYVKTLKGTNFEIEVKLEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +N VAEN+F+V+M+ K K+S    S+   A T    PA +   S AP P   +       
Sbjct  61   QNNVAENSFIVIMLTKPKASPAGASSKQGAATSQAQPAGTAPTSAAPPPAAPAPAPAPAP  120

Query  444  sapvpvaapaptpaptagsgD----VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETV  611
            +  V    PA   A      D    VYGQAASNLVAG  LE  +QQILDMGGG+WDRETV
Sbjct  121  APVVAEPQPAAQTAAVVAPTDSRSDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETV  180

Query  612  VRALRAAYNNPERAVEYLYSG  674
            VRALRAA+NNPERAVEYLYSG
Sbjct  181  VRALRAAFNNPERAVEYLYSG  201



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 139/197 (71%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN V EN+F+V+M+        +  AS +  +   APA S + S     V     +    
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQSQPAQTVATPQVSAPTV  112

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            S P P +  A   A  +   DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRAL
Sbjct  113  SVPEPTSVTAAPAAAASVQTDVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  173  RAAFNNPERAVEYLYSG  189



>ref|NP_001078680.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 gb|AED94322.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=332

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 134/197 (68%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN V EN+F+V+M+        +  AS +  +   APA S +     A    SAP     
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQPQTVATPQVSAPTASVP  112

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                  A  A      +   DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRAL
Sbjct  113  VPTSGTATAAAPATAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  173  RAAFNNPERAVEYLYSG  189



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN V EN+F+ V+M      S  G+++++A     +   +  A T   P  A+  A VP 
Sbjct  60   ENNVVENSFI-VIMLSKAKVSSSGASTASAPAPAPSATQAQPAQTVATPQVATPTASVPE  118

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             +       AP+ A  +   DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RAL
Sbjct  119  PSSGAATGAAPSAAAASTQTDVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRAL  178

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  179  RAAFNNPERAVEYLYSG  195



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 148/245 (60%), Gaps = 45/245 (18%)
 Frame = +3

Query  75   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  254
            ++ MKI VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD T
Sbjct  115  KKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQMLIHQGKVLKDVT  174

Query  255  TLEENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapap  434
            TLEENKV EN+F+V+M+ K K+S    S++S A T    P +++  +++     +  PA 
Sbjct  175  TLEENKVVENSFIVIMITKNKASPSGASSTSGAATSQAQPVTASPPASSTPSTTSETPAS  234

Query  435  vpasapvpvaapaptpaptagsgDVYGQAASNL---------------------------  533
            V                  +   DVYGQAASNL                           
Sbjct  235  VAPPPQSVPEPAPAAAPTASAELDVYGQAASNLVAGSNLEATVQQILDRNLFPNLLLQQL  294

Query  534  ------------------VAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVE  659
                              VAG+NLE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVE
Sbjct  295  LLLRDAELDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRDTVVRALRAAFNNPERAVE  354

Query  660  YLYSG  674
            YLYSG
Sbjct  355  YLYSG  359



>ref|NP_001130219.1| uncharacterized protein LOC100191313 [Zea mays]
 gb|ACF78374.1| unknown [Zea mays]
 tpg|DAA61377.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
 tpg|DAA61378.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=225

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 128/196 (65%), Gaps = 0/196 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  624  RAAYNNPERAVEYLYS  671
            RAAYNNPERAVEYLYS
Sbjct  181  RAAYNNPERAVEYLYS  196



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 134/198 (68%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapa-sstsastapapvpasapapvp  440
            EN+V ENNF+V+M+ + K+SS    A ++A          +T A   P    A AP    
Sbjct  61   ENQVLENNFLVIMLRQNKASSSAPPAKASANQAPPTQTVPATPAPQTPVAPAAPAPTVPV  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
            ++      A        +   D YGQAASNLVAG NLEG IQ IL+MGGGTWDR+TV+RA
Sbjct  121  SAPAPTATASPAPAVAVSTEADSYGQAASNLVAGGNLEGTIQSILEMGGGTWDRDTVLRA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            L+AAYNNPERAVEYLYSG
Sbjct  181  LQAAYNNPERAVEYLYSG  198



>tpg|DAA61375.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=339

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 129/197 (65%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLYSG
Sbjct  181  RAAYNNPERAVEYLYSG  197



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTL GT+FEIEVKP DTV++VKK+IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSEVKKAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  440
            EN V E +F V+++     SSSG  +AS+ A T T +   +  A T   P  ++    VP
Sbjct  60   ENNVVEKSFIVIMLSKTKVSSSGASTASAPAPTPTPSATQAQPAQTVATPQVSAPTVSVP  119

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
                    A AP  A  +   DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRA
Sbjct  120  EPTSGTATAAAPAAAAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRA  179

Query  621  LRAAYNNPERAVEYLYSG  674
            LRAA+NNPERAVEYLYSG
Sbjct  180  LRAAFNNPERAVEYLYSG  197



>ref|XP_008650775.1| PREDICTED: uncharacterized protein LOC100191313 isoform X1 [Zea 
mays]
 gb|ACF84200.1| unknown [Zea mays]
 gb|ACG34516.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA61376.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=386

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 129/197 (65%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAVEYLYSG
Sbjct  181  RAAYNNPERAVEYLYSG  197



>gb|KDO46130.1| hypothetical protein CISIN_1g0198171mg, partial [Citrus sinensis]
Length=260

 Score =   182 bits (462),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 137/197 (70%), Gaps = 3/197 (2%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKV+E+ F+VVM++K+K+    G++S+     T    + +S ST P       PAP P+
Sbjct  61   DNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                 V +        +   D YGQAASNLVAGN+LE  IQQI+DMGGGTWD+ETV RAL
Sbjct  121  IPASNVTSNVTAANANS---DTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRAL  177

Query  624  RAAYNNPERAVEYLYSG  674
            +AAYNNPERAV+YLYSG
Sbjct  178  QAAYNNPERAVDYLYSG  194



>ref|XP_004956777.1| PREDICTED: probable DNA repair protein RAD23-like isoform X1 
[Setaria italica]
Length=468

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 130/198 (66%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  264  ENKVAENNFVVV-MMaktksssgegsasstattktiapasstsastapapvpasapapvp  440
            EN+V ENNF+V+ +     SSS   + +S           +T A   P    A AP    
Sbjct  61   ENQVLENNFLVIMLRQNKASSSAPPAKASANQAPPTQTVPATPAPQTPVAPAAPAPTVPV  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
            ++      A        +   D YGQAASNLVAG NLEG IQ IL+MGGGTWDR+TV+RA
Sbjct  121  SAPAPTATASPAPAVAVSTEADSYGQAASNLVAGGNLEGTIQSILEMGGGTWDRDTVLRA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            L+AAYNNPERAVEYLYSG
Sbjct  181  LQAAYNNPERAVEYLYSG  198



>gb|KDO46129.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=274

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 137/197 (70%), Gaps = 3/197 (2%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKV+E+ F+VVM++K+K+    G++S+     T    + +S ST P       PAP P+
Sbjct  61   DNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                 V +        +   D YGQAASNLVAGN+LE  IQQI+DMGGGTWD+ETV RAL
Sbjct  121  IPASNVTSNVTAANANS---DTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRAL  177

Query  624  RAAYNNPERAVEYLYSG  674
            +AAYNNPERAV+YLYSG
Sbjct  178  QAAYNNPERAVDYLYSG  194



>gb|KJB69953.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=330

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 131/197 (66%), Gaps = 18/197 (9%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E+ F+VVM++K+KS    G++S+   + T +     SA ++ +     APA    
Sbjct  61   ENKVSEDGFLVVMLSKSKSLGSTGASSAQPASSTPSTTVPASAPSSNSTPATGAPAQASQ  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                                D Y QAASNLVAGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  121  QT------------------DTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  163  RAAYNNPERAVDYLYSG  179



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 131/197 (66%), Gaps = 18/197 (9%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E+ F+VVM++K+KS    G++S+   + T +     SA ++ +     APA    
Sbjct  61   ENKVSEDGFLVVMLSKSKSLGSTGASSAQPASSTPSTTVPASAPSSNSTPATGAPAQASQ  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                                D Y QAASNLVAGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  121  QT------------------DTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  163  RAAYNNPERAVDYLYSG  179



>ref|XP_008462953.1| PREDICTED: ubiquitin receptor RAD23b isoform X1 [Cucumis melo]
Length=387

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 135/201 (67%), Gaps = 4/201 (2%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+  DTV  VKK+IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQLTDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E  F+VVM++K+K+S+  G +S+             S++ A    P+  PAP   
Sbjct  61   ENKVSEEGFLVVMLSKSKTSASAGQSSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAP  120

Query  444  sapvpvaapaptpaptags----gDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETV  611
            +     A    T      +     D YGQAASNLVAGNNLE  +QQ++DMGGGTWDRETV
Sbjct  121  TQAPSSALKNTTSTSDRVTDNVQTDTYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETV  180

Query  612  VRALRAAYNNPERAVEYLYSG  674
            VRALRAAYNNPERAV+YLYSG
Sbjct  181  VRALRAAYNNPERAVDYLYSG  201



>gb|KDO69966.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=277

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +3

Query  150  VADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMMaktksssg  329
            V DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLEENKVAEN+FVV+M+ K K  +G
Sbjct  1    VFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLEENKVAENSFVVIMLTKNKRPTG  60

Query  330  egsasstattktiapasstsastapapvpasapapvpasapvpvaapaptpaptagsgD-  506
            EGS  STA TK    ++ T A+T       + P     +     A  + + +  + + + 
Sbjct  61   EGSTRSTAPTKAPQSSAPTPAATPATAPQTAVPISTEPTPAPTPAPASASVSSVSATSES  120

Query  507  -VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
             VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  121  GVYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  177



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 121/196 (62%), Gaps = 18/196 (9%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +           PA  +   D Y QAASNLVAGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  624  RAAYNNPERAVEYLYS  671
            RAAYNNPERAV+YLYS
Sbjct  163  RAAYNNPERAVDYLYS  178



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 122/197 (62%), Gaps = 18/197 (9%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ +KTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIIKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +           PA  +   + Y QAASNLVAGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTNTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  163  RAAYNNPERAVDYLYSG  179



>ref|XP_007135849.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
 gb|ESW07843.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
Length=371

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 130/197 (66%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKV+E+ F+VVM++K+K+S    + S    +   +  S+++ + A  P   +       
Sbjct  61   DNKVSEDGFLVVMLSKSKASGSAAAPSVQPASTPASTVSTSNTNPASDPPVQTQAVNNIT  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            S                   D YGQAASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  121  STTDAPTTNVSA--------DTYGQAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVTRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERA++YLYSG
Sbjct  173  RAAYNNPERAIDYLYSG  189



>ref|NP_001240038.1| uncharacterized protein LOC100819019 [Glycine max]
 gb|ACU24437.1| unknown [Glycine max]
Length=363

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 125/197 (63%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +     +  +     T  S D YG AASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERA++YLYSG
Sbjct  173  RAAYNNPERAIDYLYSG  189



>gb|ACU20959.1| unknown [Glycine max]
Length=363

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 125/197 (63%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +     +  +     T  S D YG AASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERA++YLYSG
Sbjct  173  RAAYNNPERAIDYLYSG  189



>ref|XP_003529480.1| PREDICTED: ubiquitin receptor RAD23b-like isoform 1 [Glycine 
max]
 gb|KHN39368.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=363

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 126/197 (64%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E+ F+VVM+          S +S +   +    +S  A+T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPATTVSMSNSTPPSDPPVQ  112

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +     +  +     T  S D YG AASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERA++YLYSG
Sbjct  173  RAAYNNPERAIDYLYSG  189



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 135/197 (69%), Gaps = 7/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKV+E+ F+VVM++K+KS    G++S+   +   +  +  S  T    VPA AP     
Sbjct  61   DNKVSEDGFLVVMLSKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEVPAQAPDSKSG  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            ++    A   P         D Y QAASNLVAG+NLE  IQQ++DMGGG+WD+ETV RAL
Sbjct  121  TSASDAATANPDT-------DTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRAL  173

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  174  RAAYNNPERAVDYLYSG  190



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 135/197 (69%), Gaps = 7/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKV+E+ F+VVM++K+KS    G++S+   +   +  +  S  T    +PA AP     
Sbjct  61   DNKVSEDGFLVVMLSKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEIPAQAPDSKSG  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            ++    A   P         D Y QAASNLVAG+NLE  IQQ++DMGGG+WD+ETV RAL
Sbjct  121  TSASDAATANPNT-------DTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRAL  173

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  174  RAAYNNPERAVDYLYSG  190



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
                 ENN V         S  + S S  +T    AP  S + S        SAP     
Sbjct  60   -----ENNVVENSFIVIMLSKTKPSPSGASTASAPAPTPSATQSQPAPTPQVSAPTVSVP  114

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                  A  A   A  +   DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRAL
Sbjct  115  EPTSVTATAAAPAAAASVQTDVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRAL  174

Query  624  RAAYNNPERAVEYLYSG  674
            RAA+NNPERAVEYLYSG
Sbjct  175  RAAFNNPERAVEYLYSG  191



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +3

Query  150  VADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMMaktksssg  329
            V DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLEENKVAEN+FVV+M+ K K  +G
Sbjct  1    VFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLEENKVAENSFVVIMLTKNKRPTG  60

Query  330  egsasstattktiapasstsastapapvpasapapvpasapvpvaapaptpaptagsgD-  506
            EGS  STA TK    ++ T A+T       + P     +     A  + + +  + + + 
Sbjct  61   EGSTRSTAPTKAPQSSAPTPAATPATAPQTAVPISTEPTPAPTPAPASASVSSVSATSES  120

Query  507  -VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
             VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  121  GVYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  177



>ref|NP_001149553.1| LOC100283179 [Zea mays]
 gb|ACF84553.1| unknown [Zea mays]
 gb|ACG35819.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA40041.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=390

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 127/197 (64%), Gaps = 0/197 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+ F+IEV+P D VA VKK IE +Q    YPA Q +LIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEPTDKVAAVKKVIENMQEQASYPADQQVLIHQGKVLSDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            EN+V ENNF+V+M+ + K SS    A +TA                 A   A AP    +
Sbjct  61   ENQVTENNFLVIMLRQNKGSSSAAPAKTTANQAPPTQTVPVVPPQTSAAPAAPAPIVPVS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +      A A      +   D YGQAASNLVAG+NLEG IQ IL+MGGG WDR+TV+RAL
Sbjct  121  ALAATATASAAPAVAVSTEADSYGQAASNLVAGSNLEGTIQSILEMGGGIWDRDTVLRAL  180

Query  624  RAAYNNPERAVEYLYSG  674
            R AYNNPERAVEYLYSG
Sbjct  181  RVAYNNPERAVEYLYSG  197



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 137/203 (67%), Gaps = 6/203 (3%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
             NKVAEN+F+V+M++K K+SS   S +S A      PA+  +   + A  P S      +
Sbjct  61   ANKVAENSFLVIMLSKPKASSSGASTASKAPASQSQPATPPAPVASAARSPPSQAPVAAS  120

Query  444  sapvpvaapaptpaptagsgDVYG------QAASNLVAGNNLEGAIQQILDMGGGTWDRE  605
                P A P+      A +    G      QAASNLV+G +LE  +QQILDMGGGTW+R+
Sbjct  121  EPAPPSAQPSAVSDTPAPAVTASGDADVYSQAASNLVSGGSLEQTVQQILDMGGGTWERD  180

Query  606  TVVRALRAAYNNPERAVEYLYSG  674
             VVRALRAAYNNPERA++YLYSG
Sbjct  181  MVVRALRAAYNNPERAIDYLYSG  203



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 126/199 (63%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  437
            ENKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  438  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
             ++      A        +   D YGQA SNLVAG+NLE  IQ IL+MGGG WDR+ V+ 
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            AL AA+NNPERAVEYLYSG
Sbjct  181  ALSAAFNNPERAVEYLYSG  199



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 126/199 (63%), Gaps = 2/199 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  437
            ENKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  438  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  617
             ++      A        +   D YGQA SNLVAG+NLE  IQ IL+MGGG WDR+ V+ 
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  618  ALRAAYNNPERAVEYLYSG  674
            AL AA+NNPERAVEYLYSG
Sbjct  181  ALSAAFNNPERAVEYLYSG  199



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 129/196 (66%), Gaps = 9/196 (5%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V+P D V  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDAVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKV E+ F+VVM++K+K+S   GS+S    +   +    T+ ST     P  AP     
Sbjct  61   DNKVTEDGFLVVMLSKSKTSGLAGSSSGQLASTNPSTIPPTTDSTTRTEAPIQAPPLQST  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            ++    A+            D YGQAAS LVAG NLE  IQQI+DMGGG WDRETV RAL
Sbjct  121  TSAPDTASAHS---------DTYGQAASTLVAGTNLEQTIQQIMDMGGGNWDRETVTRAL  171

Query  624  RAAYNNPERAVEYLYS  671
            RAAYNNPERAV+YLYS
Sbjct  172  RAAYNNPERAVDYLYS  187



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 130/198 (66%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG  FEIE +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1    MKLSVKTLKGNRFEIEAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  264  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  440
            +N + EN F VV++     SS+   S++STA+T      S+  A  +     AS      
Sbjct  61   DNTITENGFLVVMLTKSKTSSAVGASSTSTASTVQPTQTSTPPAPASNPVEVASPVVSQL  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
             +     +  AP       + D YG+AAS LVAG+NLE  IQQ+LDMGGG+WDR+TVVRA
Sbjct  121  PAVAPAASVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            LRAAYNNPERAVEYLYSG
Sbjct  181  LRAAYNNPERAVEYLYSG  198



>ref|XP_010532056.1| PREDICTED: ubiquitin receptor RAD23b [Tarenaya hassleriana]
Length=360

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 129/197 (65%), Gaps = 14/197 (7%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG HFEI V+P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGRHFEIRVQPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+K++   G++S+       +   +   ++ P  VPA  P P   
Sbjct  61   ENKVTEEGFLVVMLSKSKTAGSAGTSSAQPAYTASSTKPAAPPASQPTSVPALNPTPAQE  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                P               D YGQAAS LV+G+NLE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  QTAAPT--------------DTYGQAASTLVSGSNLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  167  RAAYNNPERAVDYLYSG  183



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 132/198 (67%), Gaps = 1/198 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG  FEI+ +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1    MKLSVKTLKGNRFEIDAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  264  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  440
            +N++ EN F VV++     SS+   S++S+A+T      S+  A  +     AS     P
Sbjct  61   DNQITENGFLVVMLTKTKTSSAAGASSTSSASTIQHTQTSTPLAPASNPVEAASPVVSQP  120

Query  441  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  620
             +     +  AP       + D YG+AAS LVAG+NLE  IQQ+LDMGGG+WDR+TVVRA
Sbjct  121  PAVAPATSVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  621  LRAAYNNPERAVEYLYSG  674
            LRAAYNNPERAVEYLYSG
Sbjct  181  LRAAYNNPERAVEYLYSG  198



>gb|KJB67005.1| hypothetical protein B456_010G170000 [Gossypium raimondii]
Length=371

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 129/197 (65%), Gaps = 7/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HF+I V P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFQITVNPNDTVMAVKKNIEGIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            +NKV+E++F+VVM+        +  +  +A   +  PASST ++ AP   P   P     
Sbjct  61   DNKVSEDSFLVVML-------SKSKSLGSAGASSAQPASSTPSTIAPVSNPTPTPEAPTQ  113

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +        A   A    + + Y QAASNLVAG+NLE  IQQ++DMGGG WD+ETV  AL
Sbjct  114  APASMGTTSASDAATANPNTNTYSQAASNLVAGSNLEQTIQQLMDMGGGNWDKETVTHAL  173

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  174  RAAYNNPERAVDYLYSG  190



>ref|XP_002889262.1| hypothetical protein ARALYDRAFT_316857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65521.1| hypothetical protein ARALYDRAFT_316857 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 126/197 (64%), Gaps = 14/197 (7%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG N YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKNNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+K++   G +S    + T +     + ST  +    ++P     
Sbjct  61   ENKVTEEGFLVVMLSKSKTAGSAGQSSVQPASATTSSTKPETPSTTQSIAVPASPITAQE  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                                D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  QPAAQT--------------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  167  RAAYNNPERAVDYLYSG  183



>ref|NP_974181.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 gb|AEE36280.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=351

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 132/197 (67%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+KS    G AS   ++ +   +++TS++   AP    +     +
Sbjct  61   ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPAS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
              P      A T        D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  PIPAQEQPAAQT--------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  173  RAAYNNPERAVDYLYSG  189



>dbj|BAC76389.1| RAD23-like protein [Arabidopsis thaliana]
Length=371

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 132/197 (67%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+KS    G AS   ++ +   +++TS++   AP    +     +
Sbjct  61   ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPAS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
              P      A T        D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  PIPAQEQPAAQT--------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  173  RAAYNNPERAVDYLYSG  189



>ref|NP_850982.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 sp|Q84L33.3|RD23B_ARATH RecName: Full=Ubiquitin receptor RAD23b; Short=AtRAD23b; AltName: 
Full=Putative DNA repair protein RAD23-1; AltName: Full=RAD23-like 
protein 1; Short=AtRAD23-1 [Arabidopsis thaliana]
 gb|AAM65583.1| DNA repair protein RAD23, putative [Arabidopsis thaliana]
 gb|ABG89118.1| Rad23-3Aii [synthetic construct]
 gb|AEE36281.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=371

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 132/197 (67%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+KS    G AS   ++ +   +++TS++   AP    +     +
Sbjct  61   ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPAS  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
              P      A T        D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  PIPAQEQPAAQT--------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  173  RAAYNNPERAVDYLYSG  189



>ref|NP_565216.2| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 gb|AAK59419.1| putative DNA repair protein RAD23 [Arabidopsis thaliana]
 gb|AAL34277.1| putative DNA repair protein RAD23 [Arabidopsis thaliana]
 gb|AEE36279.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=365

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 126/197 (64%), Gaps = 14/197 (7%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+KS    G AS    + T +     + ST  +    ++P P   
Sbjct  61   ENKVTEEGFLVVMLSKSKSGGSAGQASVQPVSATTSSTKPAAPSTTQSSPVPASPIPAQE  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                                D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  QPAAQT--------------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  167  RAAYNNPERAVDYLYSG  183



>dbj|BAC76390.1| RAD23-like protein [Arabidopsis thaliana]
Length=365

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 126/197 (64%), Gaps = 14/197 (7%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+KS    G AS    + T +     + ST  +    ++P P   
Sbjct  61   ENKVTEEGFLVVMLSKSKSGGSAGQASVQPVSATTSSTKPAAPSTTQSSPVPASPIPAQE  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
                                D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  QPAAQT--------------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  167  RAAYNNPERAVDYLYSG  183



>gb|KHN38092.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=446

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 131/209 (63%), Gaps = 20/209 (10%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDT------------VADVKKSIETVQGSNVYPASQLMLIH  227
            MK+ VKTLKG+HFEI V+P DT            V  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTLEWEESVTRLYVVMAVKKNIEDVQGKDNYPCGQQLLIH  60

Query  228  QGKVLKDGTTLEENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapa  407
             GKVLKD TTL ENKV+E+ F+VVM++K+K+S    ++S    +      S+++++    
Sbjct  61   NGKVLKDETTLVENKVSEDGFLVVMLSKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSD  120

Query  408  pvpasapapvpasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGG  587
            P   +  A    S+                  D YG AASNLVAG+NLE  IQQI+DMGG
Sbjct  121  PPVQTQAANNSTSSTDAPTTNVSA--------DTYGLAASNLVAGSNLEQTIQQIMDMGG  172

Query  588  GTWDRETVVRALRAAYNNPERAVEYLYSG  674
            G WDR+TV RALRAAYNNPERA++YLYSG
Sbjct  173  GNWDRDTVSRALRAAYNNPERAIDYLYSG  201



>ref|XP_010429866.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Camelina 
sativa]
Length=370

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 129/197 (65%), Gaps = 9/197 (5%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGNHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+K++   G +S+   +  ++  S      AP    ++A  P   
Sbjct  61   ENKVTEEGFLVVMLSKSKTAGSAGQSSAQPASAAMSTTSLAKQPAAPTTSQSTAVPPSLI  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             A     AP           D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  PAQEQPGAPTD---------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  171

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  172  RAAYNNPERAVDYLYSG  188



>ref|XP_010429867.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Camelina 
sativa]
Length=369

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 10/197 (5%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGNHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM++K+K++   G +S+   +  ++  S    +        + P  +  
Sbjct  61   ENKVTEEGFLVVMLSKSKTAGSAGQSSAQPASAAMSTTSLAKPAAPTTSQSTAVPPSLIP  120

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            +   P A             D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121  AQEQPGAPTD----------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  170

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  171  RAAYNNPERAVDYLYSG  187



>ref|XP_009117771.1| PREDICTED: probable ubiquitin receptor RAD23a [Brassica rapa]
 emb|CDY52848.1| BnaA09g56400D [Brassica napus]
Length=359

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 119/197 (60%), Gaps = 13/197 (7%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  Q  + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV E  F+VVM+             S + T + A  SS   ++        A A    
Sbjct  61   ENKVTEEGFLVVML-------------SKSKTASSAGPSSAQPTSTTTSSAMPAAASTTH  107

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
            S PVP +         A   D   QAAS L +G++ E  +QQI++MGGG+WD+ETV RAL
Sbjct  108  SIPVPASVSTLAQEQPAAPSDTNAQAASTLASGSSTEQMVQQIMEMGGGSWDKETVARAL  167

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  168  RAAYNNPERAVDYLYSG  184



>ref|XP_006389863.1| hypothetical protein EUTSA_v10018655mg [Eutrema salsugineum]
 gb|ESQ27149.1| hypothetical protein EUTSA_v10018655mg [Eutrema salsugineum]
Length=403

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 118/197 (60%), Gaps = 14/197 (7%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTL G  FEI V+  DTV  VKK+IE  QG N YP  Q +LIH GKVLKD TTL 
Sbjct  37   MKLTVKTLMGRQFEIRVQSSDTVMAVKKNIEDSQGKNNYPCGQQLLIHNGKVLKDETTLL  96

Query  264  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  443
            ENKV+E  F+VVM+           + S         ++  +++T          A    
Sbjct  97   ENKVSEEGFLVVML-----------SKSRTAASAGQSSAQPASTTTSTTSSTKPAATSTT  145

Query  444  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  623
             +    A+P       A   D YGQAAS LV+GN++E   QQ+++MGGG+WD+ETV RAL
Sbjct  146  QSTAVPASPIHAQEQPAAQTDNYGQAASTLVSGNSVE---QQLMEMGGGSWDKETVARAL  202

Query  624  RAAYNNPERAVEYLYSG  674
            RAAYNNPERAV+YLYSG
Sbjct  203  RAAYNNPERAVDYLYSG  219



>ref|XP_008462954.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Cucumis melo]
Length=364

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 117/176 (66%), Gaps = 4/176 (2%)
 Frame = +3

Query  159  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMMaktksssgegs  338
            VKK+IE VQG + YP  Q +LIH GKVLKD +TL ENKV+E  F+VVM++K+K+S+  G 
Sbjct  3    VKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLAENKVSEEGFLVVMLSKSKTSASAGQ  62

Query  339  asstattktiapasstsastapapvpasapapvpasapvpvaapaptpaptagsgDV---  509
            +S+             S++ A    P+  PAP   +     A    T      + +V   
Sbjct  63   SSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAPTQAPSSALKNTTSTSDRVTDNVQTD  122

Query  510  -YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
             YGQAASNLVAGNNLE  +QQ++DMGGGTWDRETVVRALRAAYNNPERAV+YLYSG
Sbjct  123  TYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETVVRALRAAYNNPERAVDYLYSG  178



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  148  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSG  204



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  130  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSG  186



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  149  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSG  205



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  131  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSG  187



>ref|XP_009597821.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=148

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSG
Sbjct  148  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSG  204



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSG
Sbjct  130  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSG  186



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSG
Sbjct  146  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSG  202



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74


 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAAS+LVAGNNL+GAIQQILDMGGGTWDRETVVRALRAA+NNPERAVEYLYSG
Sbjct  151  DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYLYSG  207



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74


 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAAS+LVAGNNL+GAIQQILDMGGGTWDRETVVRALRAA+NNPERAVEYLYSG
Sbjct  162  DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYLYSG  218



>gb|KDO58999.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=308

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  213



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPEDTV DVKKSIET QG+ VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVTDVKKSIETAQGAEVYPASQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIML  74


 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAAS LVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  144  DVYGQAASTLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  200



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NL+  IQQILDMGGGTWDR+TVV ALRAA+NNPERAVEYLYSG
Sbjct  173  DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVHALRAAFNNPERAVEYLYSG  229



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NL+  IQQILDMGGGTWDR+TVVRAL AA+NNPERAVEYLYSG
Sbjct  176  DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALHAAFNNPERAVEYLYSG  232



>gb|KDO59000.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=364

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  213



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNN E AIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  154  DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  210



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNN E AIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  155  DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  211



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  157  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYLYSG  213



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  157  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYLYSG  213



>gb|ACJ83348.1| unknown [Medicago truncatula]
Length=159

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  152  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  208



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  178  DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNNPERAVEYLYSG  234



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  213



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  158  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  214



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  213



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  151  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  207



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  188  DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNNPERAVEYLYSG  244



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  213



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQG+VLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGRVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  159  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYLYSG  215



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+ QG+++YPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKTIESTQGADIYPATQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++FVVVM+
Sbjct  61   ENKVAESSFVVVML  74


 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGNNLEGA+QQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  187  DVYGQAASNLVAGNNLEGAVQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  243



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  156  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  212



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  155  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  211



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  155  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  211



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD  T+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDEKTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNL AG+NL+  IQQILDMGGGTWDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  172  DIYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALRAAFNNPERAVEYLYSG  228



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  81   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  260
            +MKIFVKTLKGTHFEIEVKPEDTVADVKK++ETVQGS+VYPA+Q MLIHQGKVLKD TTL
Sbjct  65   SMKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQMLIHQGKVLKDETTL  124

Query  261  EENKVAENNFVVVMM  305
            EENKVAE +FVVVM+
Sbjct  125  EENKVAEKSFVVVML  139


 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY +AASNLVAG NLEG IQQI+DMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  203  DVYSEAASNLVAGTNLEGTIQQIIDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  259



>ref|XP_008361862.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=83

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+FVV+M+
Sbjct  61   GNKVAENSFVVIML  74



>ref|XP_009597820.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
tomentosiformis]
Length=288

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYS  671
            DVY  AASNLVAG+NLE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAV+YLYS
Sbjct  145  DVYDLAASNLVAGSNLEATVQQILDMGGGSWDRDTVVRALRAAYNNPERAVDYLYS  200



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  213



>ref|NP_974211.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73825.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=299

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYLY+G
Sbjct  172  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTG  228



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQ KVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQVKVLKDPTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSG
Sbjct  146  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSG  202



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSG
Sbjct  152  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG  208



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLI  GKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIPPGKVLKDPTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSG
Sbjct  144  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSG  200



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG HFEIEVKP+D+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGIHFEIEVKPDDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGGTWDR TVVRALRAA+NNPERAVEYLYSG
Sbjct  169  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRNTVVRALRAAFNNPERAVEYLYSG  225



>gb|ACU18469.1| unknown [Glycine max]
Length=160

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  162  DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  218



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VKTLKGTHFEIEVKPED+++DVKK+IET QG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIYVKTLKGTHFEIEVKPEDSISDVKKNIETAQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGGTWDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  180  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRDTVVRALRAAFNNPERAVEYLYSG  236



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  190  DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  246



>ref|XP_004172134.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLVAG+NLE  +QQILDMG G WDR+TVVRALRAAYNNPERAV+YLYSG
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYLYSG  228



>ref|XP_004135098.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLVAG+NLE  +QQILDMG G WDR+TVVRALRAAYNNPERAV+YLYSG
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYLYSG  228



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGSN+YPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSNIYPAGQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
             N VAE +FVV+M+
Sbjct  61   ANNVAEKSFVVIML  74


 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VY QAASNLVAG+ LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  139  VYDQAASNLVAGSTLETTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  194



>ref|XP_007033285.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY04211.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=350

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  264  ENKVAENNFVVVMM  305
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLVAGNN+E  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  161  DVYSQAASNLVAGNNIEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  217



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLVAG+NLE  IQQILDMG G WDR+TVVRALRAAYNNPERAV+YLYSG
Sbjct  174  DVYSQAASNLVAGSNLEETIQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYLYSG  230



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYLY+G
Sbjct  172  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTG  228



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLVAG+NLE  +QQILDMG G WDR+TVVRALRAAYNNPERAV+YLYSG
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYLYSG  228



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYP++Q MLIHQGKVL+D TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQMLIHQGKVLRDETTME  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE +F+V+M+
Sbjct  61   ENKVAEKSFIVIML  74


 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  138  DIYGQAASNLVAGSNLEATIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  194



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYLY+G
Sbjct  171  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTG  227



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  146  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  202



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGN LEG IQQILDMGGG WDR+TVVRALRAAYNNPERA++YLYSG
Sbjct  139  DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNNPERAIDYLYSG  195



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGN LEG IQQILDMGGG WDR+TVVRALRAAYNNPERA++YLYSG
Sbjct  138  DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNNPERAIDYLYSG  194



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNN E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  144  DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  200



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVCVKTLKGTHFEIEVKPEDTVADVKKNIEAVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIMI  74


 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQI+DMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  173  DVYGQAASNLVAGSNLEATVQQIIDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  229



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNN E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  201



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDATTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN F+V+M+
Sbjct  61   ENKVAENTFIVIML  74


 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+G
Sbjct  155  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTG  211



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKP+DT+++VKK+IE VQG +VYPA+Q MLIHQGKVLKDGT+LE
Sbjct  1    MKVFVKTLKGTHFEIEVKPQDTISEVKKNIENVQGVDVYPAAQQMLIHQGKVLKDGTSLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  153  DVYGQAASNLVAGSNLEETVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  209



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  136  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  192



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  137  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  193



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  223  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  279



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLEG +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSG
Sbjct  147  DVYGQAASNLVAGSNLEGTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSG  203



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  222  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  278



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  154  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  210



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  136  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  192



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  75   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  254
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  255  TLEENKVAENNFVVVMM  305
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  206  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSG  262



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  75   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  254
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  255  TLEENKVAENNFVVVMM  305
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  207  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSG  263



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  155  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  211



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  75   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  254
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  255  TLEENKVAENNFVVVMM  305
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  207  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSG  263



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  75   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  254
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  255  TLEENKVAENNFVVVMM  305
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  206  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSG  262



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  264  ENKVAENNFVVVMM  305
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLVAGNN+E  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  247  DVYSQAASNLVAGNNIEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  303



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSG
Sbjct  170  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSG  226



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEACKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRALRAA+NNP RA++YLYSG
Sbjct  127  DSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRALRAAFNNPARAIDYLYSG  183



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVK ED+VADVKK+IETVQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+VVM+
Sbjct  61   ENKVAENSFIVVML  74


 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVVRALRAA+NNPERAVEYLY+G
Sbjct  170  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYLYTG  226



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGTHF+IEVKP+D+VADVK+ IET+QGS+VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGTHFQIEVKPDDSVADVKRIIETIQGSDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG  LE  IQQILDMGGG+WDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  147  DVYGQAASNLVAGTTLESTIQQILDMGGGSWDRDTVIRALRAAYNNPERAVEYLYSG  203



>ref|XP_006437672.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50912.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=212

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYS  671
            VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYS
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYS  199



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTV DVKK+IE+V G +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVDDVKKNIESVHGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+N E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  143  DVYGQAASNLVAGSNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  199



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74


 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            YGQAAS+LVAGNNLEG IQ ILDMGGGTWDR+TVVRALRAA+NNP RA++YLYSG
Sbjct  154  YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNNPARAIDYLYSG  208



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74


 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            YGQAAS+LVAGNNLEG IQ ILDMGGGTWDR+TVVRALRAA+NNP RA++YLYSG
Sbjct  153  YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNNPARAIDYLYSG  207



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  264  ENKVAENNFVVVMM  305
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  201



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIF+KTLKGTHFEIEVKPEDTV DVK++IE  QG +VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFIKTLKGTHFEIEVKPEDTVTDVKRNIEATQGQSVYPAEQQMLIHQGKILKDETTLQ  60

Query  264  ENKVAENNFVVVMM  305
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG NLE  IQ ILDMGGGTWDR+ VVRALRAAYNNPERAVEYLYSG
Sbjct  145  DVYGQAASNLVAGTNLEQTIQHILDMGGGTWDRDIVVRALRAAYNNPERAVEYLYSG  201



>ref|XP_006437673.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50913.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=300

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  200



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  264  ENKVAENNFVVVMM  305
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  201



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74


 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+G
Sbjct  161  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTG  217



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74


 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+G
Sbjct  163  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTG  219



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV+P+DTV++VKKSIETVQG +VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDTVSEVKKSIETVQGVDVYPAALQMLIHQGKVLKDATTLE  60

Query  264  ENKVAENNFVVVMM  305
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYG AASNLVAG+NLEG IQQI+DMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  152  DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  208



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  264  ENKVAENNFVVVMM  305
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  201



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  264  ENKVAENNFVVVMM  305
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  201



>ref|XP_006437674.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50914.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=331

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  200



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENK++EN F+V+M+
Sbjct  61   ENKISENGFIVIML  74


 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  137  DVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  193



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  200



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  200



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT F++EVKPEDT+ADVKKSIET QG++VYPA Q MLI+QGKVLKD TT++
Sbjct  1    MKIFVKTLKGTTFDVEVKPEDTIADVKKSIETTQGADVYPAGQQMLIYQGKVLKDNTTID  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  159  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  215



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTVADVK++IE  QG +VYPA Q MLI+QGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKRNIEATQGQSVYPAEQQMLIYQGKILKDETTLQ  60

Query  264  ENKVAENNFVVVMM  305
            ++KVAEN+FVV+M+
Sbjct  61   DSKVAENSFVVIML  74


 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+ LE  IQ ILDMGGGTW+R+ VVRALRAAYNNPERAVEYLYSG
Sbjct  145  DVYGQAASNLVAGSGLEQTIQHILDMGGGTWERDIVVRALRAAYNNPERAVEYLYSG  201



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYLYSG
Sbjct  147  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYLYSG  203



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYLYSG
Sbjct  146  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYLYSG  202



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEV+P+D V++VKKSIE+ QG++VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDAVSEVKKSIESAQGADVYPAALQMLIHQGKVLKDATTLE  60

Query  264  ENKVAENNFVVVMM  305
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYG AASNLVAG+NLEG IQQI+DMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  154  DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  210



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEI+VKPEDTVADVK+ IET QG  VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVADVKRYIETSQGKTVYPADQQMLIHQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGN LE  IQQILDMGGGTWDR+TVVRALRAAYNNPERA+EYLYSG
Sbjct  146  DAYGQAASNLVAGNTLEQIIQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYLYSG  202



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  264  ENKVAENNFVVVMM  305
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSG
Sbjct  126  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSG  182



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  264  ENKVAENNFVVVMM  305
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSG
Sbjct  129  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSG  185



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSG
Sbjct  158  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSG  214



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  264  ENKVAENNFVVVMM  305
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSG
Sbjct  147  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSG  203



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  264  ENKVAENNFVVVMM  305
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSG
Sbjct  150  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSG  206



>gb|KJB80001.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=320

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  194



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTVADVK+ IE+ QG +VYP+ Q MLIHQGK+LKD TT+ 
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKRIIESTQGQSVYPSEQQMLIHQGKILKDDTTMN  60

Query  264  ENKVAENNFVVVMM  305
            +NKV+ENNF+++M+
Sbjct  61   DNKVSENNFIIIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAG NLE  IQQILDMGGGTW+R+TVVRAL AA NNPERAVEYLYSG
Sbjct  147  DAYGQAASNLVAGGNLEQTIQQILDMGGGTWERDTVVRALHAACNNPERAVEYLYSG  203



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74


 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY G
Sbjct  135  DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYMG  191



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74


 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY G
Sbjct  134  DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYMG  190



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSG
Sbjct  157  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSG  213



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSG
Sbjct  158  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSG  214



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSG
Sbjct  123  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSG  179



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74


 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAG+ LE  IQQILDMGGGTW+R+TVVRALRAAYNNPERAVEYLYSG
Sbjct  147  DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAVEYLYSG  203



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74


 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAG+ LE  IQQILDMGGGTW+R+TVVRALRAAYNNPERAVEYLYSG
Sbjct  147  DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAVEYLYSG  203



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  194



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYGQAASNLVAGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+G
Sbjct  152  VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTG  207



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  136  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  192



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  264  ENKVAENNFVVVMM  305
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYGQAASNLVAGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+G
Sbjct  144  VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTG  199



>ref|XP_007046250.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY02082.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=340

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG++LEGAIQQILDMGGGTWDR+ VVRALRAAYNNPERAVEYLYSG
Sbjct  138  DVYGQAASNLVAGSHLEGAIQQILDMGGGTWDRDIVVRALRAAYNNPERAVEYLYSG  194



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            M+IFVKTLKG+ F+IEVKPEDTVADVKK IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MRIFVKTLKGSTFDIEVKPEDTVADVKKKIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYGQAAS+LVAG+NLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYLYSG
Sbjct  91   VYGQAASSLVAGSNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYLYSG  146



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGTHFEIEVKPEDTV+DVK  IET QG   YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVSDVKTIIETAQGE--YPAAQQMLIHQGKVLKDATTLE  58

Query  264  ENKVAENNFVVVMM  305
            EN VAE +FVV+M+
Sbjct  59   ENNVAEKSFVVIML  72


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLVAGNNLEG IQQILDMGGGTWDR++VVRALRAA+NNPERAVEYLYSG
Sbjct  143  DVYSQAASNLVAGNNLEGTIQQILDMGGGTWDRDSVVRALRAAFNNPERAVEYLYSG  199



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+F IEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFAIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
             N VAEN+F+V+M+
Sbjct  61   ANNVAENSFIVIML  74


 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG  LE  +QQILDMGGG+WDRETV+RALRAA+NNPERAVEYLYSG
Sbjct  143  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVIRALRAAFNNPERAVEYLYSG  199



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG++LEGAIQQILDMGGGTWDR+ VVRALRAAYNNPERAVEYLYSG
Sbjct  138  DVYGQAASNLVAGSHLEGAIQQILDMGGGTWDRDIVVRALRAAYNNPERAVEYLYSG  194



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74


 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGN LE  IQQILDMGGGTW R+TVVRALRAAYNNPERAVEYLYSG
Sbjct  164  DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNNPERAVEYLYSG  220



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74


 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            D YGQAASNLVAGN LE  IQQILDMGGGTW R+TVVRALRAAYNNPERAVEYLYSG
Sbjct  165  DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNNPERAVEYLYSG  221



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VKTLKG+ FEI+V P+D+VADVK+SIET QG+ VYPA+Q MLI+QGKVLKDGTTL 
Sbjct  1    MKIYVKTLKGSQFEIQVNPDDSVADVKRSIETAQGAAVYPAAQQMLIYQGKVLKDGTTLL  60

Query  264  ENKVAENNFVVVMM  305
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            +VY  AAS LVAG+NLEGAIQQILDMGGGTWDR+TV+R +RAA+NNPERAVEYLYSG
Sbjct  143  NVYDSAASLLVAGSNLEGAIQQILDMGGGTWDRDTVIRIVRAAFNNPERAVEYLYSG  199



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  194


 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMM  305
            E+ V EN+F+V+M+
Sbjct  61   ESSVTENSFIVIML  74



>ref|XP_003551850.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Glycine 
max]
 gb|KHN17319.1| Putative DNA repair protein RAD23-4 [Glycine soja]
Length=375

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGTHF ++V P+DTVA VKK+IET QG++VYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKINVKTLKGTHFVLQVNPQDTVAVVKKNIETAQGADVYPAAQQMLIHQGKVLNDATTLE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV ENNFVV+M+
Sbjct  61   ENKVVENNFVVIML  74


 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            +Y  AASNL+AG+NLE  IQQIL+MGGG WDR+TV  AL AA+NNPERA+EYLYSG
Sbjct  135  IYDHAASNLMAGSNLETTIQQILEMGGGNWDRDTVTGALHAAFNNPERAIEYLYSG  190



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI +GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIFKGKVLKDDTTLA  60

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  61   ENSVNENSFIVIML  74


 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQ ASNLVAG+N EG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  138  DVYGQTASNLVAGSNFEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  194



>ref|XP_011022053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VY QAAS+LVAGNNLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYLYSG
Sbjct  136  VYDQAASSLVAGNNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYLYSG  191



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIEV+P+  VADVK+ IE  QG++VYPAS+ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVEPKQLVADVKQVIEKAQGADVYPASKQMLIHQGKVLKDATTLE  60

Query  264  ENKVAENNFVVVMM  305
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSG
Sbjct  137  DVYGQAASNLVAGNNLEVIVQQILDMGGGSWDRDTVLRALRAAFNNPERAVEYLYSG  193



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  516  QAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            + A +LVAGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYLYSG
Sbjct  165  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYLYSG  217



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  516  QAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            + A +LVAGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYLYSG
Sbjct  203  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYLYSG  255



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  516  QAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            + A +LVAGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYLYSG
Sbjct  168  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYLYSG  220



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  516  QAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            + A +LVAGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYLYSG
Sbjct  206  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYLYSG  258



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  516  QAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            + A +LVAGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYLYSG
Sbjct  184  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYLYSG  236



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  516  QAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            + A +LVAGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYLYSG
Sbjct  187  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYLYSG  239



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGTHFEI+V  +DTV DVKK+IE VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLQDTVGDVKKNIEAVQGVDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
            EN+VAEN+FVV+M+
Sbjct  61   ENQVAENSFVVIML  74


 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
             YGQA SNL+AG+NLE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  139  TYGQAESNLIAGSNLESTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYLYSG  194



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIE  PE +VA+VKK IET QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKKIIETTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLV+G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YLYSG
Sbjct  147  DVYSQAASNLVSGSNLEETIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYLYSG  203



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VY QAAS+LVAGNNLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYLYSG
Sbjct  136  VYDQAASSLVAGNNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYLYSG  191



>gb|AFK37901.1| unknown [Medicago truncatula]
Length=215

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  264  ENKVAENNFVVVMM  305
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  525  SNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            SNL+AG+ LE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  137  SNLIAGSTLEPTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYLYSG  186



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYGQAASNLVAGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+G
Sbjct  108  VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTG  163


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  216  MLIHQGKVLKDGTTLEENKVAENNFVVVMM  305
            MLI+QGKVLKD TTL ENKVAEN+FVV+M+
Sbjct  1    MLIYQGKVLKDDTTLGENKVAENSFVVIML  30



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLV+G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YLYSG
Sbjct  150  DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYLYSG  206



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLV+G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YLYSG
Sbjct  150  DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYLYSG  206



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQ ASNLVAG+N EG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  94   DVYGQTASNLVAGSNFEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSG  150



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGNNLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSG
Sbjct  136  DVYGQAASNLVAGNNLEHVIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSG  192


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+ VKTLKG HF+IEV+P DTV +VKK IE VQG+  YP+ Q +LI+QGKVLKD TT+E
Sbjct  1    MKVSVKTLKGNHFDIEVQPTDTVLNVKKQIEQVQGAQTYPSEQQLLIYQGKVLKDETTIE  60

Query  264  ENKVAENNFVVVMM  305
            ENKV EN F+VVM+
Sbjct  61   ENKVTENTFLVVML  74



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEIEVKP DTV+DVKK+IET+ G + YPA+Q MLIHQGK+L D +TLE
Sbjct  1    MKIFVKTLKGTNFEIEVKPVDTVSDVKKAIETLHGEH-YPAAQQMLIHQGKILNDASTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN VAEN+F+V+M+
Sbjct  60   ENNVAENSFIVIML  73


 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG NLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSG
Sbjct  147  DVYGQAASNLVAGTNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSG  203



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSG
Sbjct  137  DVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSG  193


 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSG
Sbjct  137  DVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSG  193


 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  133  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  189



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  264  ENKVAENNFVVVMM  305
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  525  SNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            SNL+AG+ LE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  137  SNLIAGSTLEPTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYLYSG  186



>gb|KCW86330.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=320

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLEG IQ+IL+MGGGTWDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  147  DVYGQAASNLVAGSNLEGTIQEILEMGGGTWDRDTVVRALRAAFNNPERAVEYLYSG  203


 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGTHF+I+V  +D+VADVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFQIQVNLQDSVADVKKTIEVAQGAGVYPAAQQMLIHQGKVLKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
            EN VAE++FVV+M+
Sbjct  61   ENNVAEDSFVVIML  74


 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            VYGQAASNL+AG+N++  +QQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYLYSG
Sbjct  141  VYGQAASNLIAGSNVDPTVQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYLYSG  196



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  137  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  193



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  135  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  191



>ref|XP_002444556.1| hypothetical protein SORBIDRAFT_07g023746 [Sorghum bicolor]
 gb|EES14051.1| hypothetical protein SORBIDRAFT_07g023746 [Sorghum bicolor]
Length=184

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLV+GNNLE  IQQILDMGGGTW+R+TVVRALRAAYNNPERA++YLYSG
Sbjct  73   DVYSQAASNLVSGNNLEQIIQQILDMGGGTWERDTVVRALRAAYNNPERAIDYLYSG  129



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  136  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  192


 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  136  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  192


 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE  QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIEGAQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  264  ENKVAENNFVVVMM  305
             N VAEN+F+V+M+
Sbjct  61   GNNVAENSFLVIML  74


 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVY QAASNLV+G +LE  +Q ILDMGGGTW+R+ VVRALRAAYNNPERA++YLYSG
Sbjct  153  DVYSQAASNLVSGGSLEQTVQHILDMGGGTWERDMVVRALRAAYNNPERAIDYLYSG  209



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTL GT+FEIEVKP DTV+DVKK+IETV+G+  YPA + MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGTNFEIEVKPADTVSDVKKAIETVKGAE-YPAVKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  133  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  189



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG+NLEG IQ+IL+MGGGTWDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  147  DVYGQAASNLVAGSNLEGTIQEILEMGGGTWDRDTVVRALRAAFNNPERAVEYLYSG  203


 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  264  ENKVAENNFVVVMM  305
            ENK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNL AG+NLE  IQQILDMGGGTWDR TVVRALRAA+NNPERAVEYLYSG
Sbjct  125  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRNTVVRALRAAFNNPERAVEYLYSG  181


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  216  MLIHQGKVLKDGTTLEENKVAENNFVVVMM  305
            MLIHQGKVLKD TT+EENKVAEN+F+V+MM
Sbjct  1    MLIHQGKVLKDETTIEENKVAENSFIVIMM  30



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  138  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  194


 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTLKGT+FEIEV P DT++D K+ IE+ QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIESHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>dbj|BAC76395.1| RAD23-like protein [Arabidopsis thaliana]
Length=343

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  504  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSG  674
            DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSG
Sbjct  133  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSG  189


 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  84   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  263
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  264  ENKVAENNFVVVMM  305
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420