BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049D08

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    292   6e-90   Nicotiana tomentosiformis
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    278   1e-88   Nicotiana tabacum [American tobacco]
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    286   2e-87   Nicotiana tomentosiformis
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    285   2e-87   Nicotiana sylvestris
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    285   2e-87   Solanum tuberosum [potatoes]
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    284   7e-87   Nicotiana sylvestris
gb|KDO56532.1|  hypothetical protein CISIN_1g0476211mg                  267   5e-86   Citrus sinensis [apfelsine]
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    281   1e-85   
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    276   5e-84   Sesamum indicum [beniseed]
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     274   4e-83   Tarenaya hassleriana [spider flower]
ref|XP_002298197.2|  beta-glucosidase family protein                    271   5e-82   
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      271   5e-82   Solanum lycopersicum
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    270   1e-81   Medicago sativa subsp. x varia
ref|XP_002303181.1|  beta-glucosidase family protein                    270   2e-81   
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    269   2e-81   Citrus sinensis [apfelsine]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             269   2e-81   Citrus clementina [clementine]
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    269   2e-81   Nelumbo nucifera [Indian lotus]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    269   3e-81   Medicago truncatula
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    269   4e-81   Solanum tuberosum [potatoes]
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   4e-81   
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   4e-81   Populus euphratica
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   5e-81   Populus euphratica
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   5e-81   Pyrus x bretschneideri [bai li]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   5e-81   
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   5e-81   Cicer arietinum [garbanzo]
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   6e-81   Eucalyptus grandis [rose gum]
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   6e-81   Populus euphratica
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   6e-81   Vitis vinifera
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    268   6e-81   
ref|XP_002513707.1|  Beta-glucosidase, putative                         268   7e-81   Ricinus communis
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         267   1e-80   Jatropha curcas
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    266   2e-80   
gb|EPS65933.1|  hypothetical protein M569_08842                         266   3e-80   Genlisea aurea
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    266   3e-80   Eucalyptus grandis [rose gum]
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              266   4e-80   Populus tremula x Populus alba [gray poplar]
emb|CBI40687.3|  unnamed protein product                                265   4e-80   Vitis vinifera
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    266   5e-80   Vitis vinifera
emb|CDY18705.1|  BnaA09g06900D                                          266   5e-80   Brassica napus [oilseed rape]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                265   6e-80   Brassica rapa
ref|XP_007043027.1|  Beta-D-xylosidase 4                                265   1e-79   
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             265   1e-79   Phaseolus vulgaris [French bean]
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                265   1e-79   Erythranthe guttata [common monkey flower]
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              263   1e-79   Populus tremula x Populus alba [gray poplar]
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    264   3e-79   Arabis alpina [alpine rockcress]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    263   5e-79   Nelumbo nucifera [Indian lotus]
emb|CDY46812.1|  BnaC02g43200D                                          263   6e-79   Brassica napus [oilseed rape]
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                262   8e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX81229.1|  BnaC09g06400D                                          263   8e-79   
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             262   1e-78   Capsella rubella
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             262   1e-78   Eutrema salsugineum [saltwater cress]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    262   1e-78   
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           262   1e-78   Gossypium arboreum [tree cotton]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    262   1e-78   Gossypium raimondii
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             261   2e-78   Prunus persica
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    261   2e-78   Glycine max [soybeans]
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    261   3e-78   Glycine max [soybeans]
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                261   3e-78   Camelina sativa [gold-of-pleasure]
ref|NP_201262.1|  beta-D-xylosidase 4                                   260   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    259   7e-78   
emb|CDY31313.1|  BnaA02g34280D                                          260   7e-78   Brassica napus [oilseed rape]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                260   7e-78   Camelina sativa [gold-of-pleasure]
ref|XP_002866623.1|  beta-xylosidase 4                                  260   7e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                260   8e-78   Brassica rapa
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    260   9e-78   Eucalyptus grandis [rose gum]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     259   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    259   2e-77   Sesamum indicum [beniseed]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      259   2e-77   Morus notabilis
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    259   2e-77   Prunus mume [ume]
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    259   2e-77   
emb|CDY52884.1|  BnaC06g27770D                                          247   2e-77   Brassica napus [oilseed rape]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    258   3e-77   Elaeis guineensis
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             258   4e-77   Phaseolus vulgaris [French bean]
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    258   5e-77   Cucumis melo [Oriental melon]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    258   8e-77   
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    257   8e-77   Eucalyptus grandis [rose gum]
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    257   1e-76   Fragaria vesca subsp. vesca
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    257   1e-76   Fragaria vesca subsp. vesca
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    254   6e-76   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY56487.1|  BnaCnng30450D                                          254   1e-75   Brassica napus [oilseed rape]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            254   1e-75   Raphanus sativus
emb|CDY51290.1|  BnaA06g23560D                                          254   1e-75   Brassica napus [oilseed rape]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             254   2e-75   Eutrema salsugineum [saltwater cress]
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    253   2e-75   Sesamum indicum [beniseed]
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     253   2e-75   Brassica rapa
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                253   3e-75   Camelina sativa [gold-of-pleasure]
ref|NP_196535.1|  beta-xylosidase 3                                     253   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    252   5e-75   Cicer arietinum [garbanzo]
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        252   5e-75   Medicago truncatula
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    252   7e-75   Arabis alpina [alpine rockcress]
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           239   1e-74   Glycine soja [wild soybean]
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    251   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002873418.1|  beta-xylosidase 3                                  251   2e-74   Arabidopsis lyrata subsp. lyrata
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    250   3e-74   Medicago sativa subsp. x varia
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          248   9e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          249   1e-73   Amborella trichopoda
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          249   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    248   2e-73   Eucalyptus grandis [rose gum]
dbj|BAJ89945.1|  predicted protein                                      243   2e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                248   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    248   2e-73   Fragaria vesca subsp. vesca
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     248   2e-73   Camelina sativa [gold-of-pleasure]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    248   3e-73   Gossypium raimondii
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     248   3e-73   Camelina sativa [gold-of-pleasure]
emb|CDY01780.1|  BnaC06g28200D                                          247   4e-73   
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           246   6e-73   Gossypium arboreum [tree cotton]
emb|CDY21595.1|  BnaC09g46970D                                          248   1e-72   Brassica napus [oilseed rape]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                246   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    246   1e-72   Glycine max [soybeans]
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                246   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    243   1e-72   
emb|CDX97115.1|  BnaC09g45100D                                          244   1e-72   
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                245   2e-72   Brassica rapa
emb|CDY35825.1|  BnaC09g37570D                                          244   4e-72   Brassica napus [oilseed rape]
emb|CDX96113.1|  BnaA07g26180D                                          247   4e-72   
emb|CDX69892.1|  BnaA10g22410D                                          244   5e-72   
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                244   9e-72   
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                243   2e-71   Brassica rapa
dbj|BAJ90420.1|  predicted protein                                      241   5e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                      241   5e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       234   7e-71   
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    240   2e-70   Hordeum vulgare [barley]
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          239   5e-70   Sorghum bicolor [broomcorn]
gb|KHG24361.1|  Beta-D-xylosidase 1 -like protein                       225   8e-70   Gossypium arboreum [tree cotton]
ref|XP_010657638.1|  PREDICTED: beta-D-xylosidase 4-like                224   2e-69   
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     237   3e-69   Setaria italica
ref|NP_001054038.1|  Os04g0640700                                       236   4e-69   
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          234   2e-68   Amborella trichopoda
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                234   2e-68   Erythranthe guttata [common monkey flower]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    234   3e-68   
gb|KJB38536.1|  hypothetical protein B456_006G259500                    231   4e-68   Gossypium raimondii
gb|KDO87027.1|  hypothetical protein CISIN_1g0041902mg                  220   4e-68   Citrus sinensis [apfelsine]
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     234   4e-68   
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             233   5e-68   Selaginella moellendorffii
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              233   9e-68   Selaginella moellendorffii
ref|XP_002515300.1|  Beta-glucosidase, putative                         233   9e-68   Ricinus communis
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                232   2e-67   
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            228   2e-67   Glycine soja [wild soybean]
ref|XP_004170761.1|  PREDICTED: beta-D-xylosidase 1-like                218   5e-67   
ref|XP_003625957.1|  Beta-xylosidase                                    231   5e-67   Medicago truncatula
gb|KJB38535.1|  hypothetical protein B456_006G259500                    230   7e-67   Gossypium raimondii
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       218   2e-66   Morus notabilis
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                229   2e-66   Brachypodium distachyon [annual false brome]
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         229   2e-66   Jatropha curcas
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            229   2e-66   Populus euphratica
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            229   2e-66   Populus euphratica
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       229   2e-66   Gossypium arboreum [tree cotton]
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    229   3e-66   Ricinus communis
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              229   3e-66   Nelumbo nucifera [Indian lotus]
gb|KJB77632.1|  hypothetical protein B456_012G147500                    229   3e-66   Gossypium raimondii
gb|ACD93208.1|  beta xylosidase                                         228   3e-66   Camellia sinensis [black tea]
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       228   4e-66   Glycine max [soybeans]
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     228   5e-66   Sesamum indicum [beniseed]
emb|CDP17081.1|  unnamed protein product                                226   7e-66   Coffea canephora [robusta coffee]
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             228   7e-66   
dbj|BAF00595.1|  xylosidase                                             217   7e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KJB72795.1|  hypothetical protein B456_011G198200                    227   8e-66   Gossypium raimondii
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            227   9e-66   Cucumis melo [Oriental melon]
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             227   1e-65   
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            227   1e-65   Glycine max [soybeans]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            226   1e-65   Glycine soja [wild soybean]
emb|CDY15255.1|  BnaC05g01340D                                          226   1e-65   Brassica napus [oilseed rape]
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         227   2e-65   Jatropha curcas
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         226   2e-65   Jatropha curcas
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            226   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002885319.1|  beta-1,4-xylosidase                                227   2e-65   
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            226   3e-65   Brassica rapa
emb|CDX89954.1|  BnaA10g01280D                                          226   3e-65   
gb|EYU44008.1|  hypothetical protein MIMGU_mgv1a0207571mg               212   3e-65   Erythranthe guttata [common monkey flower]
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             226   3e-65   
ref|XP_003591420.1|  Beta xylosidase                                    225   4e-65   Medicago truncatula
ref|XP_010094323.1|  Beta-D-xylosidase 1                                225   4e-65   Morus notabilis
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             225   5e-65   
emb|CDY67410.1|  BnaCnng54810D                                          221   6e-65   Brassica napus [oilseed rape]
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                225   6e-65   Brassica rapa
emb|CDY00033.1|  BnaC09g02680D                                          225   6e-65   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    225   7e-65   
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            224   9e-65   Populus euphratica
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             224   1e-64   Phaseolus vulgaris [French bean]
gb|AAS17751.2|  beta xylosidase                                         224   1e-64   Fragaria x ananassa
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            224   1e-64   
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             224   1e-64   Selaginella moellendorffii
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             224   1e-64   Selaginella moellendorffii
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            224   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             224   1e-64   Phaseolus vulgaris [French bean]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             224   1e-64   Capsella rubella
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            223   2e-64   Glycine soja [wild soybean]
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              224   2e-64   Fragaria vesca subsp. vesca
ref|NP_188596.1|  putative beta-D-xylosidase 5                          224   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            224   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_003592512.1|  Xylosidase                                         224   2e-64   Medicago truncatula
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  224   2e-64   
dbj|BAB02547.1|  beta-1,4-xylosidase                                    224   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311398.2|  beta-D-xylosidase family protein                   223   2e-64   
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              223   3e-64   Prunus mume [ume]
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             223   3e-64   Prunus persica
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              223   3e-64   Gossypium arboreum [tree cotton]
gb|KJB09457.1|  hypothetical protein B456_001G143600                    223   3e-64   Gossypium raimondii
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    223   3e-64   Vitis vinifera
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             223   3e-64   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            223   3e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    223   3e-64   Arabis alpina [alpine rockcress]
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       223   4e-64   Glycine max [soybeans]
dbj|BAG28345.1|  arabinofuranosidase                                    223   4e-64   Citrus unshiu [satsuma mandarin]
ref|XP_002316021.1|  beta-D-xylosidase family protein                   223   4e-64   Populus trichocarpa [western balsam poplar]
emb|CDY49607.1|  BnaA09g03310D                                          223   5e-64   Brassica napus [oilseed rape]
ref|XP_002527511.1|  Beta-glucosidase, putative                         223   6e-64   Ricinus communis
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          223   6e-64   
emb|CDY05634.1|  BnaC02g39030D                                          222   7e-64   
emb|CDY33913.1|  BnaA02g30740D                                          222   8e-64   Brassica napus [oilseed rape]
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg             221   8e-64   
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              222   9e-64   Populus euphratica
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          222   9e-64   Persea americana
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            222   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    222   1e-63   
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       222   1e-63   Cucumis sativus [cucumbers]
emb|CDY58860.1|  BnaCnng33860D                                          221   1e-63   Brassica napus [oilseed rape]
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             221   1e-63   Citrus clementina [clementine]
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    221   1e-63   Arabis alpina [alpine rockcress]
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            221   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_003594795.1|  Beta xylosidase                                    221   1e-63   Medicago truncatula
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         221   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             221   1e-63   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       221   1e-63   Glycine max [soybeans]
ref|NP_563659.1|  probable beta-D-xylosidase 2                          221   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                221   1e-63   Cicer arietinum [garbanzo]
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     221   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            221   1e-63   Prunus mume [ume]
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            221   2e-63   
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            221   2e-63   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       221   2e-63   Cicer arietinum [garbanzo]
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            221   2e-63   Brassica rapa
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       221   2e-63   Morus notabilis
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             221   2e-63   Eutrema salsugineum [saltwater cress]
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           221   2e-63   Prunus salicina [Japanese plum]
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            221   2e-63   Vitis vinifera
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                221   2e-63   Glycine max [soybeans]
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                221   2e-63   Brassica rapa
ref|XP_008362602.1|  PREDICTED: probable beta-D-xylosidase 7            214   2e-63   
ref|XP_007051080.1|  Beta-xylosidase 2                                  221   2e-63   
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              221   2e-63   Populus euphratica
gb|AAP83934.1|  auxin-induced beta-glucosidase                          220   3e-63   Oxybasis rubra [pigweed]
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            221   3e-63   Fragaria vesca subsp. vesca
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                220   3e-63   Phoenix dactylifera
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    220   3e-63   Cucumis melo [Oriental melon]
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                220   3e-63   Camelina sativa [gold-of-pleasure]
emb|CBI22460.3|  unnamed protein product                                221   3e-63   Vitis vinifera
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             220   3e-63   Capsella rubella
emb|CAN82161.1|  hypothetical protein VITISV_035506                     221   3e-63   Vitis vinifera
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     220   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    220   4e-63   Cucumis melo [Oriental melon]
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            220   4e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            220   4e-63   Nicotiana sylvestris
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             219   5e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     219   5e-63   Brassica rapa
emb|CDX85405.1|  BnaC07g27160D                                          219   5e-63   
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             219   6e-63   Prunus persica
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                220   6e-63   
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            219   6e-63   Sesamum indicum [beniseed]
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            219   7e-63   Prunus mume [ume]
emb|CDO97479.1|  unnamed protein product                                218   7e-63   Coffea canephora [robusta coffee]
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              219   7e-63   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     219   8e-63   Eucalyptus grandis [rose gum]
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              219   9e-63   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              219   9e-63   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            219   9e-63   Camelina sativa [gold-of-pleasure]
dbj|BAO45878.1|  beta-D-xylosidase                                      219   9e-63   Acacia mangium
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       219   9e-63   
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            219   1e-62   Elaeis guineensis
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    218   1e-62   
gb|KHN12900.1|  Beta-D-xylosidase 1                                     218   1e-62   Glycine soja [wild soybean]
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     218   2e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              218   2e-62   Eucalyptus grandis [rose gum]
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                218   2e-62   Cucumis sativus [cucumbers]
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            218   2e-62   Nicotiana sylvestris
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     218   2e-62   Eucalyptus grandis [rose gum]
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           218   2e-62   Prunus salicina [Japanese plum]
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          218   2e-62   Amborella trichopoda
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    218   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                218   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              218   2e-62   
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            218   3e-62   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             218   3e-62   
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             218   3e-62   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       218   3e-62   
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          216   4e-62   
ref|XP_002865732.1|  beta-xylosidase 1                                  217   4e-62   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            217   5e-62   
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            217   5e-62   
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             217   5e-62   
gb|KJB16241.1|  hypothetical protein B456_002G219100                    217   6e-62   
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             216   7e-62   
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            216   8e-62   
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            216   1e-61   
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    216   1e-61   
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       216   1e-61   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            216   1e-61   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       216   1e-61   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            216   1e-61   
gb|KJB59941.1|  hypothetical protein B456_009G282000                    213   1e-61   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            216   1e-61   
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            216   1e-61   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             216   1e-61   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    216   1e-61   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    216   2e-61   
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          215   2e-61   
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            215   2e-61   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            216   2e-61   
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       215   2e-61   
gb|KJB49844.1|  hypothetical protein B456_008G140600                    215   3e-61   
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            215   3e-61   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              214   3e-61   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         214   4e-61   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               214   4e-61   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            214   4e-61   
dbj|BAF79669.1|  beta-D-xylosidase                                      214   4e-61   
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        214   4e-61   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   214   4e-61   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       214   5e-61   
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     212   5e-61   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            214   5e-61   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             214   7e-61   
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                   211   8e-61   
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       213   9e-61   
emb|CDO98788.1|  unnamed protein product                                213   1e-60   
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                213   1e-60   
gb|KJB59940.1|  hypothetical protein B456_009G282000                    213   1e-60   
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             213   1e-60   
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              213   1e-60   
emb|CDP18762.1|  unnamed protein product                                209   1e-60   
ref|XP_002513887.1|  hypothetical protein RCOM_1034150                  201   1e-60   
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    213   2e-60   
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            213   2e-60   
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          213   2e-60   
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            213   2e-60   
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                213   2e-60   
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       212   3e-60   
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             212   3e-60   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            213   3e-60   
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    212   3e-60   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          212   3e-60   
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                212   3e-60   
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            212   3e-60   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                212   4e-60   
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                212   4e-60   
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            212   4e-60   
gb|AES97966.2|  glycoside hydrolase family 3 protein                    212   4e-60   
emb|CBI19138.3|  unnamed protein product                                215   4e-60   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                211   5e-60   
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          211   5e-60   
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         211   5e-60   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       211   6e-60   
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    209   6e-60   
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       211   7e-60   
gb|AAF17692.1|AC009243_19  F28K19.27                                    210   7e-60   
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       211   7e-60   
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       211   7e-60   
ref|NP_196618.1|  putative beta-D-xylosidase 6                          211   7e-60   
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        214   7e-60   
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        214   7e-60   
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        214   7e-60   
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   211   7e-60   
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       211   7e-60   
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             211   7e-60   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    211   8e-60   
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             211   8e-60   
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            211   9e-60   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            211   9e-60   
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730          211   1e-59   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             210   1e-59   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            210   1e-59   
gb|EYU23228.1|  hypothetical protein MIMGU_mgv1a018779mg                208   1e-59   
emb|CAN72807.1|  hypothetical protein VITISV_033721                     198   2e-59   
ref|NP_177929.1|  putative beta-D-xylosidase 7                          210   2e-59   
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            210   2e-59   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            210   2e-59   
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             209   2e-59   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            210   2e-59   
emb|CAJ41429.1|  beta (1,4)-xylosidase                                  209   3e-59   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                209   3e-59   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            209   4e-59   
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            209   4e-59   
gb|KJB29303.1|  hypothetical protein B456_005G093200                    209   4e-59   
ref|XP_009536966.1|  xylosidase                                         209   4e-59   
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    209   4e-59   
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            209   5e-59   
gb|KJB29304.1|  hypothetical protein B456_005G093200                    209   5e-59   
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    209   5e-59   
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg             209   5e-59   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            209   5e-59   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             209   6e-59   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             208   6e-59   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         208   9e-59   
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                208   9e-59   
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            208   1e-58   
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            208   1e-58   
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            207   1e-58   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         207   1e-58   
ref|XP_002527212.1|  beta-glucosidase, putative                         199   1e-58   
emb|CDX87482.1|  BnaA07g33910D                                          207   1e-58   
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              207   1e-58   
ref|XP_003615012.1|  Auxin-induced beta-glucosidase                     194   1e-58   
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg                207   1e-58   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            207   1e-58   
emb|CBI22910.3|  unnamed protein product                                207   2e-58   
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          207   2e-58   
gb|KJB44020.1|  hypothetical protein B456_007G230000                    207   2e-58   
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like       207   2e-58   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    210   2e-58   
emb|CDX88410.1|  BnaC06g38540D                                          207   2e-58   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    207   3e-58   
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            206   3e-58   
emb|CDP01027.1|  unnamed protein product                                210   3e-58   
gb|KJB59094.1|  hypothetical protein B456_009G239100                    207   3e-58   
ref|XP_006581546.1|  PREDICTED: probable beta-D-xylosidase 7-like...    204   3e-58   
ref|XP_004953945.1|  PREDICTED: probable beta-D-xylosidase 7-like       206   3e-58   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    206   3e-58   
gb|KHG02565.1|  putative beta-D-xylosidase 7                            206   3e-58   
ref|XP_006840294.1|  hypothetical protein AMTR_s00045p00064060          206   3e-58   
dbj|BAK01582.1|  predicted protein                                      205   5e-58   
emb|CBI25718.3|  unnamed protein product                                206   5e-58   
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                206   5e-58   
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                206   5e-58   
ref|XP_011466576.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    204   5e-58   
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like       206   6e-58   
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7            206   6e-58   
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein         205   6e-58   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       206   6e-58   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       206   7e-58   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             206   7e-58   
gb|ETI41971.1|  hypothetical protein F443_12854                         205   7e-58   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   206   7e-58   
gb|ETL88623.1|  hypothetical protein L917_12312                         205   7e-58   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   206   7e-58   
ref|XP_001775759.1|  predicted protein                                  206   7e-58   
gb|ETM41887.1|  hypothetical protein L914_12392                         205   7e-58   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            206   7e-58   
gb|ETK81998.1|  hypothetical protein L915_12566                         205   8e-58   
ref|XP_008909231.1|  hypothetical protein PPTG_14386                    205   8e-58   
gb|ETP11715.1|  hypothetical protein F441_12812                         205   8e-58   
gb|ETO70591.1|  hypothetical protein F444_12960                         205   8e-58   
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5            205   8e-58   
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    205   1e-57   
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       205   1e-57   
gb|EEC74020.1|  hypothetical protein OsI_08964                          205   1e-57   
ref|NP_001048140.1|  Os02g0752200                                       205   1e-57   
gb|KJB16242.1|  hypothetical protein B456_002G219200                    204   1e-57   
ref|XP_009599906.1|  PREDICTED: probable beta-D-xylosidase 7            204   1e-57   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    204   2e-57   
ref|XP_006449653.1|  hypothetical protein CICLE_v10017977mg             204   2e-57   
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...    204   2e-57   
gb|KJB29307.1|  hypothetical protein B456_005G093300                    204   2e-57   
ref|XP_006468195.1|  PREDICTED: probable beta-D-xylosidase 5-like       204   2e-57   
emb|CDX97026.1|  BnaC09g45990D                                          204   2e-57   
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6            204   2e-57   
gb|AAK38482.1|  beta-D-xylosidase                                       204   2e-57   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             204   2e-57   
emb|CDP01028.1|  unnamed protein product                                204   2e-57   
gb|EPS70883.1|  hypothetical protein M569_03875                         204   2e-57   
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg             204   2e-57   
ref|XP_009782575.1|  PREDICTED: probable beta-D-xylosidase 7            204   2e-57   
gb|KJB16243.1|  hypothetical protein B456_002G219200                    204   2e-57   
ref|XP_008364222.1|  PREDICTED: probable beta-D-xylosidase 5            196   3e-57   
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg                204   3e-57   
ref|XP_002975008.1|  hypothetical protein SELMODRAFT_103038             204   3e-57   
ref|XP_002977427.1|  hypothetical protein SELMODRAFT_106899             204   3e-57   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            204   3e-57   
gb|KDP42384.1|  hypothetical protein JCGZ_02441                         196   4e-57   
ref|NP_001130324.1|  putative O-Glycosyl hydrolase superfamily pr...    203   4e-57   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       203   5e-57   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            203   5e-57   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  203   6e-57   
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7            203   6e-57   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       202   6e-57   
ref|XP_010250379.1|  PREDICTED: probable beta-D-xylosidase 5            203   6e-57   
ref|XP_006647908.1|  PREDICTED: probable beta-D-xylosidase 7-like       202   8e-57   
ref|XP_006354073.1|  PREDICTED: probable beta-D-xylosidase 7-like       202   9e-57   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            202   1e-56   
ref|XP_010693351.1|  PREDICTED: probable beta-D-xylosidase 7            202   1e-56   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       202   1e-56   
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       204   1e-56   
ref|XP_010676949.1|  PREDICTED: probable beta-D-xylosidase 7            202   1e-56   
gb|KDP42389.1|  hypothetical protein JCGZ_02446                         197   2e-56   
emb|CDO97277.1|  unnamed protein product                                201   2e-56   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            201   2e-56   
ref|XP_002452540.1|  hypothetical protein SORBIDRAFT_04g027700          201   3e-56   
gb|EAY80660.1|  hypothetical protein OsI_35838                          201   3e-56   
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                201   3e-56   
ref|XP_004238520.1|  PREDICTED: probable beta-D-xylosidase 7            201   3e-56   
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg                201   3e-56   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            201   4e-56   
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7            201   4e-56   
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    201   4e-56   
gb|EYU23222.1|  hypothetical protein MIMGU_mgv1a021704mg                201   4e-56   
ref|XP_003612944.1|  Beta-D-xylosidase                                  200   4e-56   
gb|EYU33327.1|  hypothetical protein MIMGU_mgv1a001678mg                200   4e-56   
gb|KDP43295.1|  hypothetical protein JCGZ_24216                         196   5e-56   
ref|XP_003576084.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    200   5e-56   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            200   5e-56   
ref|XP_008383565.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    200   5e-56   
gb|ABY48135.1|  beta-D-xylosidase                                       200   6e-56   



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            PV +QT+PV+ACD   NPG+K+  FC+  LDV +RV DLVKRLTL EKIT LVNTAG+VS
Sbjct  31   PVLAQTSPVFACDVANNPGVKNFAFCDVSLDVSSRVNDLVKRLTLEEKITMLVNTAGSVS  90

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIPTYEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +ST
Sbjct  91   RLGIPTYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVST  150

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLTYWSPN+NI+RDPRWGRGQE PGEDPTL  KY   +V+GLQ
Sbjct  151  EARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVGYVKGLQ  204



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = +3

Query  126  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFP  +LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPPTILTSASFNETLFETIGKAVS  150

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAM+N GLAGLTYWSPN+NI+RDPRWGRGQE PGEDPTL  KY  A+V+GLQ
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVAYVKGLQ  205



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV DLV+RLTL EKI FLV+ AG VS
Sbjct  37   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVS  96

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP YEWWSEALHG+SYTGPGV+F+G++PAATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  97   RLGIPRYEWWSEALHGVSYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGKVVST  156

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT KY AA+VRGLQ
Sbjct  157  EARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLTSKYGAAYVRGLQ  210



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV+DLV+RLTL EKI FLV+ AG VS
Sbjct  40   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVSDLVQRLTLSEKIGFLVSGAGGVS  99

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP YEWWSEALHG+SYTGPGV+F+G+VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  100  RLGIPRYEWWSEALHGVSYTGPGVHFSGLVPGATSFPQVILTAASFNVTLFETIGKVVST  159

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT KY AA+VRGLQ
Sbjct  160  EARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLTSKYGAAYVRGLQ  213



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKIT LVNTAGNVS
Sbjct  34   PVSAQTSAVFACDTATNPSLKSFPFCDVSLGVSARVKDLVKRLTLQEKITMLVNTAGNVS  93

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFETIGKVVST  153

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            E RAM+N G AGLTYWSPN+NI+RDPRWGRGQE  GEDPTL+ KY  A+V+GLQ
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLSSKYGVAYVKGLQ  207



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   284 bits (726),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = +3

Query  126  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVS  150

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAM+N GLAGLTYWSPN+NI+RDPRWGRGQE PGEDPTL  KY  A+V+GLQ
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVAYVKGLQ  205



>gb|KDO56532.1| hypothetical protein CISIN_1g0476211mg, partial [Citrus sinensis]
Length=250

 Score =   267 bits (682),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V+GLQ
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQ  202



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKI+ LVNTAG+VS
Sbjct  34   PVSAQTSAVFACDTANNPSLKSFPFCDVSLGVSDRVNDLVKRLTLQEKISMLVNTAGSVS  93

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFQTIGKVVST  153

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            E RAM+N G AGLTYWSPN+NI+RDPRWGRGQE  GEDPTL+ +Y  A+V+GLQ
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLSSRYGVAYVKGLQ  207



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            PV +QT P +ACD   NPGLK+  FC+Q LDVK+RVADLV RLTL EKI +LVNTA  VS
Sbjct  24   PVFAQTKPAFACDVSNNPGLKNFSFCDQSLDVKSRVADLVGRLTLQEKIGWLVNTAKGVS  83

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP Y+WWSEALHG+SY GPG  F+G+VP ATSFPQ +LTAA+FNE+LF  IGKV+ST
Sbjct  84   RLGIPDYQWWSEALHGVSYVGPGTKFSGLVPGATSFPQVILTAATFNESLFEIIGKVVST  143

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE  GEDP L+ KY AA+VRGLQ
Sbjct  144  EARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLSSKYGAAYVRGLQ  197



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P ++Q++PV+ACD   NP L    FC++ L+V  RVADLV RLTL EKI FLVN A  VS
Sbjct  23   PSEAQSSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVS  82

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  83   RLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGKVVST  142

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAAA+V+GLQ
Sbjct  143  EARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAAYVKGLQ  196



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQ  205



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++  V +Q +PV+ACD   NP L +L FC+  L V+ RV DLV RLTL EKI FLV+ AG
Sbjct  23   LLKQVLAQNSPVFACDVTSNPALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAG  82

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             VSRLGIP YEWWSEALHG++YTGPGV+FT +VP ATSFPQ +LTAASFN TLF TIGKV
Sbjct  83   GVSRLGIPKYEWWSEALHGVAYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGKV  142

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT KY  A+V GLQ
Sbjct  143  VSTEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTSKYGVAYVEGLQ  199



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P ATSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGATSFPMPILIAASFNASLFQTIGKVVS  148

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQ  203



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  30   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  149

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQ  202



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V+GLQ
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQ  202



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V+GLQ
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQ  202



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S  +PV+ACD  KNPGL +  FCN  LD+  RV DLV+RLTL EKITFLV+ AG V+RLG
Sbjct  30   SGQSPVFACDVGKNPGLAAFGFCNTSLDIAARVNDLVERLTLQEKITFLVSKAGAVNRLG  89

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP+YEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  90   IPSYEWWSEALHGVSYVGPGTHFSSAVPGATSFPQVILTAASFNTSLFEDIGKVVSTEAR  149

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +V+GLQ
Sbjct  150  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVQGLQ  200



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQ  203



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  120  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  299
            + PV +Q +PV+ACD   NP L +L FC+  L V+ RV DLVKRLTL EKI FLV+ A  
Sbjct  60   LKPVLAQNSPVFACDITSNPALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASG  119

Query  300  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  479
            VSRLGIP YEWWSEALHG++YTGPGV+F+ +VP ATSFPQ +LTAASFN +LF TIGKV+
Sbjct  120  VSRLGIPKYEWWSEALHGVAYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGKVV  179

Query  480  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            STEARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT  Y  A+V+GLQ
Sbjct  180  STEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTSTYGVAYVKGLQ  235



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQ  202



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD V+NP L SL FCN    +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  32   VSAQSSPVFACDVVRNPSLASLGFCNTSSGINDRVVDLVKRLTLQEKILFLVNSAGNVSR  91

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  92   LGIPKYEWWSEALHGVSYVGPGTHFSNDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  151

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ
Sbjct  152  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQ  204



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQ  205



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGRVVSTE  149

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQ  202



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQ  202



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G V SQT+PV+ACD  KNP L +  FCN+ L V  RV+DLV RLTL EKI  LVN+A +V
Sbjct  29   GRVWSQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDV  88

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQ  203



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   268 bits (686),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD   NP L +  FCN  L V+ RVADLV+RLTL EK+ FLV+ AGNV RLGIP Y
Sbjct  40   PVFACDVDGNPSLAAFGFCNTSLGVEARVADLVQRLTLQEKVGFLVSGAGNVDRLGIPKY  99

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN
Sbjct  100  EWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHN  159

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ
Sbjct  160  VGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQ  206



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQ  205



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLGQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F  +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  150

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+A+VRGLQ
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASAYVRGLQ  203



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  Q++PV+ACD   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQ  202



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD   NP L S  FCN  L +  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVKSNPSLASFGFCNVSLGISDRVTDLVNRLTLQEKIGFLVNSAGSVSR  92

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSNIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  152

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVRGLQ  205



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q +PV+ACD  KNP + S  FCN  L +  RV DLV+RLTL EKI+FLVN+AG+VSR
Sbjct  27   VVAQPSPVFACDVSKNPSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSR  86

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  87   LGIPKYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTE  146

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  147  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQ  199



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  Q++PV+ACD   N  L S  FC+  L V  RV DLVKRLTLPEKI FLVN AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPVLSSKYGSGYVRGLQ  202



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   +P LK+L FC+  LDVKTRV DLV RLTLPEK+ +L N+A  VSRLGIP Y
Sbjct  20   PIFACDVSADPALKTLAFCDSSLDVKTRVDDLVNRLTLPEKLGWLANSAKGVSRLGIPDY  79

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSE LHG+SYTGPGV FT +VP ATSFPQ +LT+ASFNE+LF  IGKV+STEARAM+N
Sbjct  80   EWWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILTSASFNESLFRAIGKVVSTEARAMYN  139

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G AGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KY  A+VRGLQ
Sbjct  140  VGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLTSKYGVAYVRGLQ  186



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = +3

Query  129  VQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            V  QT+ PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV 
Sbjct  32   VAGQTSKPVFACDVDSDPSLAGFGFCNASLGVEVRVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  92   RLGIPKYEWWSEALHGVSYLGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  151

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+++VRGLQ
Sbjct  152  EARAMHNVGLAELTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASSYVRGLQ  205



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 143/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI---  479
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKVI   
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVISQV  152

Query  480  -STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ
Sbjct  153  VSTEARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQ  209



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +VRGLQ
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQ  203



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +VRGLQ
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQ  203



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  204



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  204



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  138  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  317
            QT+PV+ACD  KNP + S  FCN  L +++RVADLV+RLTL EKI F+V+ AG+VSRLGI
Sbjct  47   QTSPVFACDATKNPEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSRLGI  106

Query  318  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  497
            P YEWWSEALHG+S  GPG  F+ +VP ATSFPQ +LTAASFN TLF  IG+V+STEARA
Sbjct  107  PKYEWWSEALHGVSNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGRVVSTEARA  166

Query  498  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            M+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP LT KY +++V+GLQ
Sbjct  167  MYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLTSKYGSSYVKGLQ  216



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A NVSR
Sbjct  32   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGNLVNSAVNVSR  91

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG +F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSVVPGATSFPMPILTAASFNSSLFEAIGRVVSTE  151

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  204



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
              GPV SQ  PV+ACD   NPGLK+  FC+  LDVK RV DLV RLTL EKI +LV+ A 
Sbjct  19   CFGPVCSQAQPVFACDVSSNPGLKNFSFCDPSLDVKARVDDLVARLTLQEKIGWLVHAAK  78

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             VSRLGIP+Y WWSEALHG+S  G G  FTG VPAATSFPQ +LT A+FNE+LF  IGKV
Sbjct  79   GVSRLGIPSYGWWSEALHGVSDVGGGSRFTGPVPAATSFPQVILTGATFNESLFQAIGKV  138

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYAAA+VRGLQ
Sbjct  139  VSTEARAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLTSKYAAAYVRGLQ  195



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  31   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  90

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK-----  473
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGK     
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVYYTQ  150

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ
Sbjct  151  VVSTEARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQ  208



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +QT+PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  33   AQTSPVFACDVTGNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  92

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  203



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +3

Query  144  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  323
            +PV+ACD  KN GL +  FCN    +  RV DLVKRLTL EKI FLVN AG V+RLGIP+
Sbjct  35   SPVFACDVGKNSGLAAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPS  94

Query  324  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  503
            YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+
Sbjct  95   YEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGKVVSTEARAMY  154

Query  504  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  155  NVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPILASKYAAGYVQGLQ  202



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +Q+ PV+ACD   N  L S  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPVFACDVAGNSSLSSYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKASGVTRLG  92

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  203



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 137/173 (79%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  QT PV+ACD   NP L S  FCN     + RVADLVKRLTL EK+ FLVN A  VSR
Sbjct  28   VAGQT-PVFACDVASNPSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSR  86

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STE
Sbjct  87   LGIPSYEWWSEALHGVSYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGKVVSTE  146

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA  +VRGLQ
Sbjct  147  ARAMHNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYATGYVRGLQ  199



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q+ P +ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQSKPAFACDVDTNPSLAAYGFCNTDLKMEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  204



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAFGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  156

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQ
Sbjct  157  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQ  208



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L +  FCN  L  + RVADLV RLTL EKI FLV+ A  VSRL
Sbjct  33   NAQSSPVFACDVAGNPSLAAYGFCNTALKSEYRVADLVARLTLQEKIGFLVSKANGVSRL  92

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  204



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +QT P++ACDT  N  L S  FCN    ++ RV DLVKRLTL EK+ FLVN A  VSR
Sbjct  31   VLAQT-PIFACDTASNASLASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP+YEWWSEALHG+S+ GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  90   LGIPSYEWWSEALHGVSFVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  149

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  150  ARAMHNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLASKYAAGYVKGLQ  202



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KY +++V+GLQ
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYGSSYVKGLQ  208



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPQVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KY +++V+GLQ
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYGSSYVKGLQ  208



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +Q++PV+ACD   N  + S  FC+  L +  RVADLVKRLTL EKI FLVN+AG+VSRLG
Sbjct  38   AQSSPVFACDVGSNASVSSFGFCDTSLAIDLRVADLVKRLTLQEKIGFLVNSAGSVSRLG  97

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STEAR
Sbjct  98   IPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTEAR  157

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  158  AMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQ  208



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQ
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQ  205



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  QT+ V+ACD  KNP L    FC++ L ++ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSSVFACDVAKNPALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQ
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQ  205



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  141  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  320
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  321  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  500
            TYEWWSEALHG+SY GPG +FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  92   TYEWWSEALHGVSYIGPGTHFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  151

Query  501  HNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQ
Sbjct  152  YNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQ  200



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  156

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQ
Sbjct  157  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQ  208



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   259 bits (663),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++ P  +Q+ PV+ACD   NP L    FCN  L ++ RVADLV RLTLPEKI FLV+ A 
Sbjct  20   VLPPSNAQSTPVFACDVAGNPSLAGFGFCNTSLGIEARVADLVGRLTLPEKIGFLVSGAK  79

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             VSRLGIP YEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK 
Sbjct  80   AVSRLGIPAYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKA  139

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ K+  A+V+GLQ
Sbjct  140  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKFGVAYVKGLQ  196



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  152  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  203



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  141  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  320
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  321  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  500
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  92   TYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  151

Query  501  HNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQ
Sbjct  152  YNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQ  200



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  156

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQ
Sbjct  157  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQ  208



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  152  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  203



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   260 bits (664),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV RLGIP Y
Sbjct  39   PVFACDVGSDPSLAGFGFCNTSLGVEARVADLVQRLTLQEKVGFLVNNAGNVDRLGIPNY  98

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            +WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN
Sbjct  99   KWWSEALHGVSYVGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHN  158

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE  GEDP L+ KYA+ +VRGLQ
Sbjct  159  VGLAGLTFWSPNVNIFRDPRWGRGQETRGEDPLLSSKYASGYVRGLQ  205



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  141  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  320
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  41   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  100

Query  321  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  500
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  101  TYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  160

Query  501  HNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQ
Sbjct  161  YNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQ  209



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            PV ++  PV+ACD   NPGL +  FC+  LD+KTR+ DLV RLTL EK  +LV+ A  VS
Sbjct  24   PVFAERKPVFACDVTSNPGLMNFSFCDPSLDLKTRMDDLVSRLTLQEKFGWLVSGARGVS  83

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP YEWWSEALHG+SYTGPG  F   VP ATSFPQ +LTA +FNE+LF  IGKV+ST
Sbjct  84   RLGIPNYEWWSEALHGVSYTGPGTKFASPVPGATSFPQVILTAGTFNESLFELIGKVVST  143

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY AA+VRGLQ
Sbjct  144  EARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGAAYVRGLQ  197



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = +3

Query  123  GPVQSQ-TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  299
            G V+ Q T+P +ACD   NP L    FCN  L +++RV DLVKRLTL EKI FLVN+AG 
Sbjct  30   GGVRGQSTSPPFACDVGANPSLAGFGFCNASLGIESRVGDLVKRLTLQEKIGFLVNSAGA  89

Query  300  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  479
            VSRLGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+
Sbjct  90   VSRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNASLFEVIGKVV  149

Query  480  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            STEARAM+N GLAGLTYWSPN+NI RDPRWGR QE PGEDP L+ KYA+ +VRGLQ
Sbjct  150  STEARAMYNVGLAGLTYWSPNVNIVRDPRWGRTQETPGEDPLLSSKYASGYVRGLQ  205



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +Q++PV+AC+   N    S  FC+  L +  RVADLV+RLTL EKI FLVN+AG+VSR
Sbjct  36   VFAQSSPVFACNVASNASASSFGFCDTSLAIDLRVADLVQRLTLQEKIGFLVNSAGSVSR  95

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTE  155

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQ  208



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  41   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  100

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  101  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  160

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ
Sbjct  161  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQ  211



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKA  86

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V +QT P++ACD   NP L +  FCN       RV DLV+RLTL EK+ FLVN A  VSR
Sbjct  30   VLAQT-PIFACDIASNPSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSR  88

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  89   LGIPSYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  148

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  149  ARAMHNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQ  201



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G V  QT+ ++ACD  KNP L    FC++ L V+ RVADLV RLTL EKI  LVN A +V
Sbjct  28   GGVWGQTSAIFACDVEKNPALGGYAFCDKSLGVEERVADLVGRLTLQEKIGNLVNAAVDV  87

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP ATSFP P+LTAASFN +LF TIG+ +S
Sbjct  88   SRLGIPKYEWWSEALHGVSNVGPGTRFSNVVPGATSFPMPILTAASFNTSLFETIGRAVS  147

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRG E PGEDP L  KYAA +V+GLQ
Sbjct  148  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLASKYAAGYVKGLQ  202



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  50   AQSPTAFACDAGTNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  109

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  110  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  169

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ
Sbjct  170  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQ  220



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  68   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  127

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  128  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  187

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ
Sbjct  188  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQ  238



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF TIGKVISTEARAMHN
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGKVISTEARAMHN  158

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+  VRGLQ
Sbjct  159  VGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGHVRGLQ  205



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYW+PN+NIFRDPRWGRGQE PGEDP LT  Y A +VRGLQ
Sbjct  176  ARAMYNVGLAGLTYWAPNINIFRDPRWGRGQETPGEDPLLTSNYGAGYVRGLQ  228



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP LT  Y + +VRGLQ
Sbjct  176  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLTSNYGSGYVRGLQ  228



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   254 bits (650),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S   P++ACD   N  L    FCN     K RV DLVKRLTL EK+ FLVN A  V RLG
Sbjct  28   SGQGPIFACDVASNRSLAGFGFCNVSWGTKQRVKDLVKRLTLQEKVGFLVNKATAVPRLG  87

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP+YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STEAR
Sbjct  88   IPSYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQVILTAASFNATLFKAIGKVVSTEAR  147

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA  +VRGLQ
Sbjct  148  AMHNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYATGYVRGLQ  198



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  162

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQ
Sbjct  163  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQ  214



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++    +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +   
Sbjct  27   LLDSSNAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLH  86

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             V+RLGIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  87   GVARLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKV  146

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  147  VSTEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  203



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++    +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +   
Sbjct  27   LLDSSNAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLH  86

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             V+RLGIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  87   GVTRLGIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKV  146

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQ
Sbjct  147  VSTEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQ  203



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            I  P  +Q++PV+ACD   NP L    FCN  L  + RV DLV RLTL EKI FL + A 
Sbjct  27   ISEPSNAQSSPVFACDITGNPSLAGFGFCNTELKAEDRVTDLVGRLTLEEKIGFLGSRAN  86

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             VSRLGIP Y WWSEALHG+S  G G NF+G VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  87   GVSRLGIPPYNWWSEALHGVSDVGHGTNFSGQVPGATSFPQVILTAASFNVSLFEAIGKV  146

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDPTLT KYA A+V+GLQ
Sbjct  147  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLTSKYAVAYVKGLQ  203



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            GPV +Q  PV+ACD   NPGLK+  FC+  L +KTRV DLV RLTL EKI +LV+ +  V
Sbjct  23   GPVFAQQKPVFACDVTDNPGLKNFRFCDLSLGLKTRVDDLVSRLTLQEKIGWLVSGSEGV  82

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
            SRLGIP Y+WWSEALHG+SY GPG  F+  +PAAT FPQ +LTA++FN++LF TI KV+S
Sbjct  83   SRLGIPDYQWWSEALHGVSYGGPGTKFSSPIPAATIFPQVILTASTFNDSLFETIAKVVS  142

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAM+N GLAGLT++SPN+NIFRDPRWGRGQE PGEDP L+  Y AA+VRGLQ
Sbjct  143  TEARAMYNAGLAGLTFFSPNINIFRDPRWGRGQETPGEDPLLSSNYGAAYVRGLQ  197



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++    +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +   
Sbjct  38   LLDSSNAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLH  97

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             V+RLGIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  98   GVTRLGIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKV  157

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQ
Sbjct  158  VSTEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATRYVKGLQ  214



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD  +NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTRNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP Y WWSEALHG+S  G G NF+G +  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPDYNWWSEALHGVSNVGSGTNFSGQIRGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  152  RAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  203



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  27   NNQSSPVFACDVTGNPSLAGLRFCNAGLSIKARVTDLVGRLTLEEKIGFLTSKAIGVSRL  86

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP+Y+WWSEALHG+S  G G  FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  87   GIPSYKWWSEALHGVSNVGGGSRFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  146

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  147  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  198



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  QT+ V+ACD  KN  L    FC++ L VK RV DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNSSLAGYGFCDKSLSVKERVLDLVKRLTLKEKIGNLGNSAVEVSR  91

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+STE
Sbjct  92   LGIPKYEWWSEALHGISNIGPGTHFSTLVPGATSFPMPILTAASFNTSLFQAIGSVVSTE  151

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQ  204



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  QT+ V+ACD  KN  + S  FC++ L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNTNVSSYGFCDKSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  91

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+S E
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATSFPMPILTAASFNTSLFQAIGSVVSNE  151

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +V+GLQ
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAGYVKGLQ  204



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P+ ++++PV+ACD  K+       FCN  LDV++RV+DLV RLTL EKI FLV+ A  VS
Sbjct  27   PLNAKSSPVFACDVDKDISFSGFRFCNTELDVQSRVSDLVGRLTLEEKIGFLVSRAKGVS  86

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP Y WWSEALHG+S  GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK +ST
Sbjct  87   RLGIPDYNWWSEALHGVSNVGPGSYFSGQVPGATSFPQVILTAASFNVSLFQAIGKAVST  146

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA A+V+GLQ
Sbjct  147  EARAMYNVGQAGLTFWSPNVNIFRDPRWGRGQETPGEDPMLTSKYAVAYVKGLQ  200



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSRLGIP YEW
Sbjct  12   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPRYEW  71

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STEA AM+N G
Sbjct  72   WSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTEAGAMYNVG  131

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAG TYWSPN+NIFRDPRWGRG E PGEDP LT KYAA +V+GLQ
Sbjct  132  LAGFTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQ  176



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  144  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  323
            +P +ACDT  N  L SL FC+    V+ RVADL+ RLTL EKI +L++ A +V+RLGIP 
Sbjct  39   SPAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPK  98

Query  324  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  503
            YEWWSEALHG+S  GPG  FT VVP ATSFPQ + TAASFN TLF  IGKV+S EARAM+
Sbjct  99   YEWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGKVVSNEARAMY  158

Query  504  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY +A+VRGLQ
Sbjct  159  NTGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSAYVRGLQ  206



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L  L FCN  L++K+RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAGLRFCNTGLNIKSRVTDLVGRLTLEEKIGFLGSNAIGVSRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP Y+WWSEALHG+S  G G +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPAYKWWSEALHGVSNVGGGSSFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA A+VRGLQ
Sbjct  152  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPELSSKYAVAYVRGLQ  203



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  QT+ V+ACD  KN  + S  FC+  L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  31   VYGQTSTVFACDVAKNTNVSSYGFCDNSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  90

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  GPG +F+ +VP AT+FP P+LTAASFN +LF  IG V+S E
Sbjct  91   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATNFPMPILTAASFNTSLFQAIGSVVSNE  150

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +V+GLQ
Sbjct  151  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAGYVKGLQ  203



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  47   NAQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  106

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  107  GIPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEA  166

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  167  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  218



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +3

Query  144  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  323
            +PV+ACDT K+P + S  FCN  L +  RV DLV+RLTL EKI FLVN    VSRLGIP 
Sbjct  29   SPVFACDTSKDPSVGSYGFCNGSLGLSERVQDLVQRLTLSEKIGFLVNKGVGVSRLGIPA  88

Query  324  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  503
            YEWWSEALHG+SY GPG +F+G+VP ATSFPQ + + ASFN +L+  IGKV+STEARAM+
Sbjct  89   YEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVIHSVASFNSSLWEAIGKVVSTEARAMY  148

Query  504  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            N GLAGLT+WSPN+NIFRDPRWGRGQE  GEDP LT KYA  +V+GLQ
Sbjct  149  NVGLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLTSKYAVGYVKGLQ  196



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  47   NAQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  106

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  107  GIPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEA  166

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  167  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  218



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  150  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  329
            V+ CD   +P L +  FCN    V+ RVADLVKRLTL EK+ FL N AG+V RLGIP Y+
Sbjct  43   VFPCD--GDPSLSTFGFCNMSWGVEARVADLVKRLTLQEKVGFLGNHAGSVDRLGIPEYQ  100

Query  330  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  509
            WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN 
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  160

Query  510  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +VRGLQ
Sbjct  161  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQ  206



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQ  200



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P  +Q+ P +AC+   N  L    FCN ++ +++RVADLV RLTL EKI FL ++    S
Sbjct  28   PSNAQSLPAFACNVAGNNSLAGFGFCNTKIKIESRVADLVGRLTLQEKIKFLGSSGNGAS  87

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIPTYEWW+EALHG+S+ GP   F+ +VP+AT FPQ +LTAASFN +LF  IGK +ST
Sbjct  88   RLGIPTYEWWAEALHGVSFIGPATRFSKLVPSATCFPQVILTAASFNVSLFKAIGKAVST  147

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  148  EARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  201



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 137/174 (79%), Gaps = 3/174 (2%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V S +   YAC    N   +S PFC++ L V  RVADLV+RLTL EKITFLV+ AGNVSR
Sbjct  32   VSSVSGQSYACGDGFNA--RSFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSR  89

Query  309  LGIPTYEWWSEALHGLSYTGPG-VNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            LGIPTY+WWSEALHG+S  G G   FT +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPTYQWWSEALHGVSKVGRGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGRVVST  149

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLTYW+PN+NIFRDPRWGRGQE PGEDP LT  Y A +VRGLQ
Sbjct  150  EARAMYNVGLAGLTYWAPNINIFRDPRWGRGQETPGEDPLLTSNYGAGYVRGLQ  203



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  152  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  203



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +3

Query  129  VQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            V  Q +P V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN+S
Sbjct  29   VVGQVSPAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNIS  88

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  89   RLGIPKYEWWSEALHGVSNVGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVST  148

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY +++V+GLQ
Sbjct  149  EARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSSYVKGLQ  202



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  152  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  203



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +3

Query  141  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  320
            ++P +ACD  +NP L    FCN  L  + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPEFACDITRNPSLAGYGFCNTGLKAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  321  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  500
             Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNLSLFQAIGKVVSTEARAM  155

Query  501  HNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTLT KYA A+V+GLQ
Sbjct  156  YNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLTSKYAVAYVKGLQ  204



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++G V   +  V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AG
Sbjct  29   VVGQV---SQAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAG  85

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
            N+SRLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  86   NISRLGIPKYEWWSEALHGVSNIGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKV  145

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY +++V+GLQ
Sbjct  146  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSSYVKGLQ  202



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLTGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              VSRLGIP Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  327  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  503
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  504  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+G+YA A+V+ LQ
Sbjct  153  NVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSGQYAVAYVKALQ  200



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+A +VSRLGIP YEW
Sbjct  30   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAVDVSRLGIPKYEW  89

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F+ V+P ATSFP P+LTAASFN +LF  IG+V+STEARAM+N G
Sbjct  90   WSEALHGVSNVGPGTRFSNVIPGATSFPMPILTAASFNTSLFEVIGRVVSTEARAMYNVG  149

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+NIFRDPRWGRG E PGEDP LT KYAA +V+GLQ
Sbjct  150  LAGLTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQ  194



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  327  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  503
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  504  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+G+YA A+V+ LQ
Sbjct  153  NVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSGQYAVAYVKALQ  200



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 135/173 (78%), Gaps = 3/173 (2%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V+ QT   +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSR
Sbjct  25   VRGQT---FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSR  81

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGIP YEWWSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  82   LGIPRYEWWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTE  141

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            A AM+N GLAGLTYWSPN+NIFRDPRWGRG E PGEDP LT KYAA +V+GLQ
Sbjct  142  AGAMYNVGLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQ  194



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ITKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ  LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLTAASFNASLFQAIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   244 bits (622),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +AC+   N  L    FCN +L ++ RVADLV RLTL EK+ FL ++    SRLGIPTY
Sbjct  35   PAFACNVAGNNSLARFGFCNTKLKIERRVADLVGRLTLQEKVRFLGSSGNGASRLGIPTY  94

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWW+EALHG+S+ GP   FT +VP+AT FPQ +LTAASFN +LF  IGK +STEARAM+N
Sbjct  95   EWWAEALHGVSFIGPATRFTKLVPSATCFPQVILTAASFNVSLFKAIGKAVSTEARAMYN  154

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQ
Sbjct  155  VGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQ  201



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 131/169 (78%), Gaps = 0/169 (0%)
 Frame = +3

Query  141  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  320
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDDTKNPSLAGYRFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  321  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  500
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  155

Query  501  HNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +N G AGLT+W+PN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ
Sbjct  156  YNVGAAGLTFWAPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQ  204



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQ  200



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQ  200



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ
Sbjct  152  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQ  203



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    + RLGIP Y
Sbjct  37   PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPALGRLGIPAY  95

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEARAMHN
Sbjct  96   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHN  155

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQ  202



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
            ++QT PV+ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  28   RAQT-PVFACDA-SNATLASYGFCNRSASASARAADLVSRLTLAEKVGFLVDKQAALPRL  85

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP YEWWSEALHG+SY GPG  F+ +VPAATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  86   GIPLYEWWSEALHGVSYVGPGTRFSSLVPAATSFPQPILTAASFNATLFRAIGEVVSNEA  145

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ
Sbjct  146  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQ  197



>gb|KHG24361.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=244

 Score =   225 bits (573),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  30   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  88

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  148

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++V GLQ
Sbjct  149  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVSGLQ  195



>ref|XP_010657638.1| PREDICTED: beta-D-xylosidase 4-like [Vitis vinifera]
Length=242

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +3

Query  231  VADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATS  410
            VADLVKRLTL EKI FLVN+A  VSRLGIP YEWWS+ALHG+SY GPG +F  VVP ATS
Sbjct  71   VADLVKRLTLEEKIGFLVNSAARVSRLGIPKYEWWSQALHGVSYVGPGTHFNSVVPGATS  130

Query  411  FPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVP  590
            FPQ +L AASF  +LF  IGKV+STEARAM+N GLAGLT+WSPN+NIF+DPRWGRGQE P
Sbjct  131  FPQVILPAASFYASLFEAIGKVVSTEARAMYNVGLAGLTFWSPNVNIFQDPRWGRGQETP  190

Query  591  GEDPTLTGKYAAAFVRGLQ  647
            GEDP L+ KYA+ +VRGLQ
Sbjct  191  GEDPLLSSKYASGYVRGLQ  209



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ
Sbjct  152  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQ  198



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEA
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGEVVSTEA  142

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ
Sbjct  143  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQ  194



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 132/174 (76%), Gaps = 4/174 (2%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P   +  P +ACD      + S PFC++ L +  RV+DL++RLTLPEK   LVN A  ++
Sbjct  20   PAIVEPGPSFACDG----QMGSFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLA  75

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLG+P YEWWSEALHG+S  GPG  F G VP ATSFPQ +LTAASFN +L+  IG+ +ST
Sbjct  76   RLGVPHYEWWSEALHGVSNVGPGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQAVST  135

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDPT+ G+YA  +VRGLQ
Sbjct  136  EARAMYNEGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTVVGRYAGRYVRGLQ  189



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  120  IGPVQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            I PV S   P  +ACD  KNP L+S  FCN  LD++TRVADLV +LTL EKI ++++ + 
Sbjct  27   ITPVFSAGKPGPFACDVSKNPDLESFTFCNPSLDIETRVADLVNKLTLKEKIGWVISGSE  86

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGK  473
             VSRLGIP Y WWSEALHG+   GPG  F    V AATSFPQ +LTAASFN +LFH IGK
Sbjct  87   GVSRLGIPGYWWWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILTAASFNVSLFHLIGK  146

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             ISTEARAMHN G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ +YA A+V+ LQ
Sbjct  147  AISTEARAMHNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSQYAVAYVKALQ  204



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACDA-SNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEA  151

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ
Sbjct  152  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQ  203



>gb|KJB38536.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=589

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  150  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  196



>gb|KDO87027.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
 gb|KDO87028.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
Length=226

 Score =   220 bits (560),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+   ++LPFC   L +  RV DL+ RL+L EK+  L++ A  V RLGI  YEW
Sbjct  28   FACDP-KDATTRTLPFCQVSLPIPQRVNDLIGRLSLQEKVKLLISGAAAVPRLGIKGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TA+SFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGRVVSDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L+GKYAA++VRGLQ
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSGKYAASYVRGLQ  191



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ
Sbjct  152  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQ  198



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  117  IIGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  293
            I+   ++ TA + YACD   N  L S PFC+ +L +  RV DLV RLTL EK+  +VN A
Sbjct  23   ILSNARASTAQLRYACDVSSNASLGSFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAA  82

Query  294  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  473
              + RLG+P+Y+WW EALHG++ + PGV F G+ PAATSFP P+ TAASFN TLF++IG+
Sbjct  83   QGIPRLGVPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIATAASFNSTLFYSIGE  141

Query  474  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             +S+EARA+HN G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L  K+A+ +VRGLQ
Sbjct  142  AVSSEARALHNLGRAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKFASLYVRGLQ  199



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   233 bits (594),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S   P YACD   N  L S PFC+ +L V  RV DLV RLTL EK+  +VN A  + RLG
Sbjct  31   STAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLG  90

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            +P+Y+WW EALHG++ + PGV F G+ PAATSFP P+  AASFN TLF++IG+ +S+EAR
Sbjct  91   VPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIAMAASFNSTLFYSIGEAVSSEAR  149

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            A+HN G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L  K+A+ +VRGLQ
Sbjct  150  ALHNLGRAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKFASLYVRGLQ  200



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD+ K+   K+LPFC  +L ++ RV DL+ RLTL EK+  LVN AG VSRLGI  YEW
Sbjct  28   FACDS-KDGTTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGRVVSDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++V+GLQ
Sbjct  147  AAGLTYWSPNVNILRDPRWGRGQETPGEDPLLVGKYAASYVKGLQ  191



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = +3

Query  123  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  302
            G V     PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    +
Sbjct  25   GNVARAQTPVFACDA-SNATVAGYGFCDRSKSAAARAADLLGRLTLAEKVGFLVNKQAAL  83

Query  303  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  482
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  84   PRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  143

Query  483  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ
Sbjct  144  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQ  198



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQ  190



>ref|XP_004170761.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
Length=241

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = +3

Query  159  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWS  338
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEWWS
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  339  EALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLA  518
            EALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G A
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGRVVSDEARAMYNGGTA  152

Query  519  GLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            GLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  153  GLTYWSPNVNIFRDPRWGRGQETPGEDPILAAKYAANYVQGLQ  195



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+   K+LPFCN +L +  RV DL+ RLT+ EK+  LVN A  V R+G+ +YEW
Sbjct  28   FACDA-KDAATKNLPFCNVKLAIPERVKDLIGRLTMQEKVNLLVNNAPAVPRVGMKSYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F GV PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTRFGGVFPAATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G+YAA++V+GLQ
Sbjct  147  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGRYAASYVKGLQ  191



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  150  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  196



>ref|XP_010113184.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC72717.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=293

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 126/176 (72%), Gaps = 3/176 (2%)
 Frame = +3

Query  120  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  299
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  300  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  479
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L++ +G+ +
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAV  136

Query  480  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            STEARAM+N GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  137  STEARAMYNAGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  192



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
            ++QT PV+ACD   N  +    FC++      R ADLV RLTL +K+ FLVN    ++RL
Sbjct  32   RAQT-PVFACDAA-NSTVAGYAFCDRAKSASARAADLVSRLTLADKVGFLVNKQPALARL  89

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S EA
Sbjct  90   GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSNEA  149

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  +YA  +V GLQ
Sbjct  150  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASRYAVGYVSGLQ  201



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K    ++LPFC  +L ++ RV DL+ RLTL EK+  LVN A +VSRLGI  YEW
Sbjct  30   FACDP-KEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLGIKGYEW  88

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  89   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGG  148

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            + GLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++V+GLQ
Sbjct  149  MGGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVGKYAASYVKGLQ  193



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ  190



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ  190



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEAR  143

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA +VRGLQ
Sbjct  144  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAANYVRGLQ  194



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  +N   ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  42   FACDP-RNGVTRNLKFCRANLPIHVRVRDLISRLTLQEKIRLLVNNAAAVPRLGIQGYEW  100

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  101  WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNQSLWEQIGRVVSDEARAMYNGG  160

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  161  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  205



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
             + P      P +ACD  +N   ++LPFC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  21   FVSPRTGDARPAFACDP-RNGLTRNLPFCRPSLPIPNRVRDLIGRLTLQEKIRLLVNNAA  79

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  80   PVPRLGIRGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNASLWEQIGRV  139

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  140  VSDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLAGKYAASYVRGLQ  196



>gb|KJB77632.1| hypothetical protein B456_012G147500 [Gossypium raimondii]
Length=788

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++ P  +Q  P +ACD   +P     PFC+  L  + R  DLV RLTL EK+  LVNTA 
Sbjct  18   VLVPYNTQAQP-FACDK-NDPNTSKFPFCDTTLSYQDRTKDLVSRLTLQEKVQQLVNTAS  75

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             + RLG+P Y+WWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNE L+  +G+V
Sbjct  76   GIPRLGVPAYQWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNEMLWLEMGRV  135

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLTYWSPN+N+FRDPRWGRGQE PGEDPT+  KYA  +VRGLQ
Sbjct  136  VSTEARAMYNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPTVVSKYAVNYVRGLQ  192



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 128/171 (75%), Gaps = 4/171 (2%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S++ P +ACD       ++LPFC   L ++ RV DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   SESRPAFACDGAT----RNLPFCRVSLPIQDRVRDLIGRLTLQEKIRLLVNNAAAVPRLG  80

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            I  YEWWSEALHG+S   PGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EAR
Sbjct  81   IKGYEWWSEALHGVSNADPGVKFGGAFPGATSFPQVISTAASFNASLWEHIGRVVSDEAR  140

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  141  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  191



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQ  191



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   228 bits (581),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   N    +LPFC+  L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDPT-NHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLGIRGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDPT+  KYAA++VRGLQ
Sbjct  147  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPTVAAKYAASYVRGLQ  191



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  ++   K   FC   L +  RV+DL+ RLTL EK+  LVN A  V+RLGI  Y
Sbjct  96   PAFACD-ARDARTKGWGFCGTNLGIAERVSDLIGRLTLQEKVRLLVNNAAEVARLGIKGY  154

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  PAATSFPQ + TAA+FN +L+  IG+V+S E RAM+N
Sbjct  155  EWWSEALHGVSNVGPGTKFGGEFPAATSFPQVITTAAAFNASLWEEIGRVVSDEGRAMYN  214

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             GL GLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  215  GGLGGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  261



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   228 bits (580),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            +I  V+S+  P +ACD  +N   +SL FC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  26   VISLVESR--PPFACDP-RNGLTRSLRFCRVNLPLHVRVRDLLGRLTLQEKIRLLVNNAA  82

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             V RLGI  YEWWSEALHG+S  GPG  F G VP ATSFPQ + TAASFNE+L+  IG+V
Sbjct  83   AVPRLGIQGYEWWSEALHGVSNVGPGAKFGGAVPGATSFPQVITTAASFNESLWEQIGRV  142

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA +V+GLQ
Sbjct  143  VSDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAARYVQGLQ  199



>dbj|BAF00595.1| xylosidase [Arabidopsis thaliana]
Length=303

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRANVPIHVRVQDLLGRLTLQEKIRNLVNNAAAVPRLGIGGY  91

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGISDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP +  KYAA++VRGLQ
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAAKYAASYVRGLQ  198



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + +AASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITSAASFNESLWEQIGRVVSDEAR  143

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA +VRGLQ
Sbjct  144  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAANYVRGLQ  194



>ref|XP_008445351.1| PREDICTED: probable beta-D-xylosidase 7 [Cucumis melo]
Length=783

 Score =   227 bits (579),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNTA  + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCRTSLPIKLRARDLVSRLTLDEKVLQLVNTAPAIPRLG  90

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP YEWWSEALHG++  G G+   G +PAATSFPQ +LTAASF+E L++ IG+ I TEAR
Sbjct  91   IPAYEWWSEALHGVADVGYGIRLNGTIPAATSFPQVILTAASFDENLWYQIGQAIGTEAR  150

Query  495  AMHNYGLA-GLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            A++N G A G+T+W+PN+NIFRDPRWGRGQE PGEDP +TGKY+ A+VRG+Q
Sbjct  151  AVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTGKYSVAYVRGIQ  202



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+   + LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTTRDLPFCQVKLPIQTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAAAFNATLWEAIGQVVSDEARAMFNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ  190



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQ  190



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQ  191



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  16   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  74

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  75   LGIKGYEWWSEALHGVSNVGPGTKFGGTFPAATSFPQVITTAASFNASLWESIGRVVSNE  134

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  135  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  187



>gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A  +SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  G GV+F   VP ATSFP  +L+AASFNETL+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQVVSTEARAMHNVG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +V+GLQ
Sbjct  146  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPFVVSRYAVNYVKGLQ  190



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  +N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  34   FACDP-RNGLTRNLIFCRVNVPIHVRVRDLLGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  92

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  93   WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNGG  152

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  153  LAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  197



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACDT K+    +L FC   + ++ RV DL+ RLTLPEK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVPIQERVKDLIGRLTLPEKVSLLGNTAAAIPRLGIKGYEW  89

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  150  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  194



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   +P      FCN  L  + R  DLV RL+L EK+  LVN A  VSRLG+P YEW
Sbjct  27   FACDR-NDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGVPPYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+NIFRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  146  LAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  192



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  192



>gb|EYU44008.1| hypothetical protein MIMGU_mgv1a0207571mg, partial [Erythranthe 
guttata]
Length=203

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   N   K++PFC   L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  33   FACDP-SNSVSKNMPFCRVSLHIRDRVGDLIGRLTLQEKIRSLVNNAAPVDRLGIKGYEW  91

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  92   WSEALHGVSNTGPGVKFGGEFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGG  151

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDPTL   YAA++V GLQ
Sbjct  152  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAASYAASYVAGLQ  196



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  147  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  191



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            + S+    +ACD  KN    + PFC   L + TRV DL+ RLTL EK++ LVN A  V R
Sbjct  15   MSSEARDPFACDP-KNTSTNNFPFCKASLPIPTRVNDLIGRLTLQEKVSMLVNNAAAVPR  73

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            +GI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + T ASFN +L+  IG+V S E
Sbjct  74   VGIKGYEWWSEALHGVSNVGPGTKFAGQFPAATSFPQVITTVASFNASLWEAIGRVASDE  133

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  134  ARAMYNGGTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQ  186



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = +3

Query  153  YACDTVKNPGL-KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  329
            +ACD     GL +SL FC   L V  RV+DL+ RLTL EKI  LVN A  V RLGI  YE
Sbjct  39   FACD--PRSGLTRSLRFCRTTLPVHVRVSDLIGRLTLQEKIRLLVNNAIEVPRLGIQGYE  96

Query  330  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  509
            WWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N 
Sbjct  97   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  156

Query  510  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  157  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  202



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  ++   ++ PFC  +L +++RV+DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-EDGTSRNFPFCQVKLPIQSRVSDLIGRMTLQEKVGLLVNDAAAVPRLGIKGYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMFNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  190



>emb|CDY67410.1| BnaCnng54810D [Brassica napus]
Length=525

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_009111875.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=787

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   L V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNLPVRVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ  214



>emb|CDY00033.1| BnaC09g02680D [Brassica napus]
Length=788

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD+  N   ++L FC   + V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDSA-NELTRTLRFCQVNIPVRMRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ  214



>ref|XP_006488872.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Citrus 
sinensis]
Length=826

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  68   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  126

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  127  WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  186

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  187  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  231



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   224 bits (572),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S+    +ACD  ++   ++ PFC  +L +++RV DL+ R+TL EK+  LVN A  V RLG
Sbjct  21   SEALDAFACDP-EDGTSRNFPFCQVKLPIQSRVGDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            I  YEWWSEALHG+S  GPG  F GV P ATSFPQ + T+ASFN TL+  IG+V+S EAR
Sbjct  80   IKGYEWWSEALHGVSNVGPGTQFGGVFPGATSFPQVITTSASFNATLWEAIGQVVSDEAR  139

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM N G+AGLT+WSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  140  AMFNGGVAGLTFWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ  190



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN    SLPFC   L +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNAATSSLPFCKASLAIAERVKDLIGRLTMEEKVGLLVNNAAAVPRLGIKGYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
              GLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYA ++VRGLQ
Sbjct  146  TGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAGSYVRGLQ  190



>gb|AAS17751.2| beta xylosidase [Fragaria x ananassa]
Length=772

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA++V+GLQ
Sbjct  149  GGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSAKYAASYVKGLQ  195



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 128/174 (74%), Gaps = 1/174 (1%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGI  YEWWSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N G+AGLTYWSPN+NI RDPRWGR QE PGEDPT+ G+YAA++VRGLQ
Sbjct  147  EARAMYNGGVAGLTYWSPNVNILRDPRWGRAQETPGEDPTVVGRYAASYVRGLQ  200



>ref|XP_002980053.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
 gb|EFJ18923.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
Length=772

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLAITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             +GLT+WSPN+NI+RDPRWGRGQE PGEDP L+  +A  +VRGLQ
Sbjct  148  QSGLTFWSPNINIYRDPRWGRGQETPGEDPLLSSNFATYYVRGLQ  192



>ref|XP_002987446.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
 gb|EFJ11533.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
Length=772

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLPITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             +GLT+WSPN+NI+RDPRWGRGQE PGEDP L+  +A  +VRGLQ
Sbjct  148  QSGLTFWSPNINIYRDPRWGRGQETPGEDPLLSSNFATYYVRGLQ  192



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACDT K+    +L FC   + ++ RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVAIQERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  89

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  150  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  194



>ref|XP_007163167.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
 gb|ESW35161.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
Length=775

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   K+LPFC   + +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNAVTKNLPFCKVSVAITERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  89

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWESIGRVVSDEARAMYNGG  149

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YA ++VRGLQ
Sbjct  150  VAGLTYWSPNINIFRDPRWGRGQETPGEDPVLAGTYAVSYVRGLQ  194



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V+      +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  22   VRVHCRETFACDT-KDAATATLRFCQMSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPR  80

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNE  140

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAAA+VRGLQ
Sbjct  141  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAAAYVRGLQ  193



>gb|KHN19223.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=681

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  89

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  149

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++VRGLQ
Sbjct  150  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVRGLQ  194



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA++V+GLQ
Sbjct  149  GGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAASYVKGLQ  195



>ref|NP_188596.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
 sp|Q9LJN4.2|BXL5_ARATH RecName: Full=Probable beta-D-xylosidase 5; Short=AtBXL5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE76268.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
Length=781

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = +3

Query  117  IIGPVQS--QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNT  290
            II  V S  ++   +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN 
Sbjct  13   IIALVSSLCESQKNFACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNK  71

Query  291  AGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIG  470
            A  V RLG+P YEWWSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G
Sbjct  72   ATGVPRLGVPPYEWWSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMG  131

Query  471  KVISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +V+STEARAMHN GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  132  EVVSTEARAMHNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V RLGI  YEW
Sbjct  37   FACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVPRLGIKGYEW  95

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  96   WSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  155

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NI RDPRWGR QE PGEDPT+ G+YAA++VRGLQ
Sbjct  156  VAGLTYWSPNVNILRDPRWGRAQETPGEDPTVVGRYAASYVRGLQ  200



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 129/177 (73%), Gaps = 4/177 (2%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
             I P+ SQ    +ACD   +P   + PFCN  L  +TR  DLV RLTL EK   LVN + 
Sbjct  15   FILPITSQK---HACDK-GSPKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPST  70

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNETL++T+G+V
Sbjct  71   GISRLGVPAYEWWSEALHGVSNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQV  130

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +S EARAM+N  LAGLT+WSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQ
Sbjct  131  VSNEARAMYNVDLAGLTFWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQ  187



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 127/177 (72%), Gaps = 4/177 (2%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++ P  +Q    +ACD   +P     PFC+  L  + R  DLV  LTL EK+  LVNTA 
Sbjct  76   LVVPCNTQQ---FACDK-NDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTAS  131

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFN TL+  +G+V
Sbjct  132  GISRLGVPAYEWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQV  191

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEARAM+N GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQ
Sbjct  192  VSTEARAMYNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQ  248



>dbj|BAB02547.1| beta-1,4-xylosidase [Arabidopsis thaliana]
Length=876

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = +3

Query  117  IIGPVQS--QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNT  290
            II  V S  ++   +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN 
Sbjct  13   IIALVSSLCESQKNFACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNK  71

Query  291  AGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIG  470
            A  V RLG+P YEWWSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G
Sbjct  72   ATGVPRLGVPPYEWWSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMG  131

Query  471  KVISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +V+STEARAMHN GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  132  EVVSTEARAMHNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  31   FACDA-KNGLTRSLKFCRVNMPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  89

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM N G
Sbjct  90   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNKSLWEEIGRVVSDEARAMFNGG  149

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  150  MAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  194



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = +3

Query  120  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  299
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  300  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  479
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  480  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAARYVKGLQ  195



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = +3

Query  120  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  299
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  300  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  479
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  480  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAARYVKGLQ  195



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  28   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  86

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EAR
Sbjct  87   IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGRVVSDEAR  146

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++V+GLQ
Sbjct  147  AMYNGGAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVKGLQ  197



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  49   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  107

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EAR
Sbjct  108  IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEAR  167

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++V+GLQ
Sbjct  168  AMYNGGAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVKGLQ  218



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            ++  V  +    +ACD  K+      PFC + + +  RV DL+ RLTL EK+  LVN A 
Sbjct  17   VLAVVSGEARDPFACDP-KDGANAGFPFCRKSIGIGERVKDLIGRLTLEEKVRLLVNNAA  75

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             V RLGI  YEWWSEALHG+S  GPG  F+G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  76   GVPRLGIKGYEWWSEALHGVSNVGPGTKFSGDFPGATSFPQVITTAASFNSSLWEAIGQV  135

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +S EARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L GKYAA +VRGLQ
Sbjct  136  VSDEARAMYNGGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAARYVRGLQ  192



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = +3

Query  129  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  308
            V  Q+   +ACD +K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  17   VCVQSRETFACD-IKDAATATLRFCQLSVPITERVKDLIGRLTLVEKVSLLGNTAAAIPR  75

Query  309  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  488
            LGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S E
Sbjct  76   LGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNE  135

Query  489  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  136  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  188



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +AC+  K+ G ++ PFC   L V  RV DL+ RLTL EK+  LV+ A  V RLGI  YEW
Sbjct  26   FACNP-KHAGFRAFPFCKTTLPVGDRVRDLIGRLTLQEKVKLLVDNAAAVPRLGIQDYEW  84

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  85   WSEALHGVSNVGPGTKFGGKFPTATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNGG  144

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  145  MAGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  189



>gb|KFK42620.1| hypothetical protein AALP_AA1G019000 [Arabis alpina]
Length=766

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            I   V   +   +ACDT  N   K+L FC   + +  RV DL+ RLTL EK++ L NTA 
Sbjct  17   ITSSVCVHSRETFACDT-NNAATKTLRFCQVSVPLPERVRDLIGRLTLAEKVSLLGNTAA  75

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             + RLGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V
Sbjct  76   AIPRLGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNTSLWESIGRV  135

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +S EARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  136  VSNEARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  192



>ref|XP_003520749.2| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=802

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  58   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  116

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  117  WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  176

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++VRGLQ
Sbjct  177  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVRGLQ  221



>dbj|BAG28345.1| arabinofuranosidase [Citrus unshiu]
Length=769

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VR LQ
Sbjct  147  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRRLQ  191



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 125/168 (74%), Gaps = 7/168 (4%)
 Frame = +3

Query  153  YACDTVKNPGL---KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  323
            +ACD    P L   +SL FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  
Sbjct  28   FACD----PKLGLTRSLKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQG  83

Query  324  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  503
            YEWWSEALHG+S  GPG  F G  P AT+FPQ + TAASFNE+L+  IG+V+S EARAM+
Sbjct  84   YEWWSEALHGVSNVGPGTKFGGAFPGATAFPQVITTAASFNESLWEEIGRVVSDEARAMY  143

Query  504  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            N G+AGLTYWSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  144  NGGMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  191



>emb|CDY49607.1| BnaA09g03310D [Brassica napus]
Length=788

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + V+ RV DL+ R TL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNIPVRVRVQDLIGRFTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ  214



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 127/177 (72%), Gaps = 4/177 (2%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            +I P+ SQ    +ACD   +P      FCN  L  + R  DL+ RLTL EK+  +VN A 
Sbjct  16   VIFPIASQN---FACDK-NSPQTNDYSFCNTSLSYQDRAKDLISRLTLQEKVQQVVNHAA  71

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             + RLGIP YEWWSEALHG+S  G GV F G VP ATSFP  +L+AASFNETL+  +G+V
Sbjct  72   GIPRLGIPAYEWWSEALHGVSNVGFGVRFNGTVPGATSFPAMILSAASFNETLWLKMGQV  131

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +STEAR MH+ GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQ
Sbjct  132  VSTEARTMHSVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQ  188



>ref|XP_006830079.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
 gb|ERM97495.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
Length=801

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            YACD  +      LPFCN  L +  R  DLV RL L EK+  LVN A  V+RLG+P YEW
Sbjct  38   YACDKGE---AAPLPFCNISLPIHDRAQDLVSRLNLTEKVQQLVNKAAGVARLGVPPYEW  94

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GP V+F G +P ATSFP  +L+ ASFNETL+  +G+V+STEARAM+N G
Sbjct  95   WSEALHGVSNVGPAVHFNGTIPGATSFPAVILSGASFNETLWFVMGQVVSTEARAMYNTG  154

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQ
Sbjct  155  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVVSRYAVNYVRGLQ  199



>emb|CDY05634.1| BnaC02g39030D [Brassica napus]
Length=772

 Score =   222 bits (566),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEDIGRVVSDEARAMYN  151

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  198



>emb|CDY33913.1| BnaA02g30740D [Brassica napus]
Length=772

 Score =   222 bits (565),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  198



>ref|XP_006406478.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
 gb|ESQ47931.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
Length=749

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +3

Query  153  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  329
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNRATGVPRLGVPPYE  84

Query  330  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  509
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  510  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDA-KNGLTRSLKFCRVNVPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F+G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM N G
Sbjct  87   WSEALHGVSNVGPGTKFSGAFPGATSFPQVITTAASFNKSLWEEIGRVVSDEARAMFNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLT+WSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  147  TAGLTFWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  191



>dbj|BAQ19511.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Persea americana]
Length=777

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = +3

Query  138  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  317
             + P +AC   K    ++LPFC   L +  RV DL+ RLTL EKI  LVN A  V RLGI
Sbjct  31   HSRPAFACVGNK----RNLPFCRTNLPISHRVNDLIGRLTLAEKIRLLVNNAAPVPRLGI  86

Query  318  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  497
              YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARA
Sbjct  87   AGYEWWSEALHGVSNWGPGTRFGGQFPGATSFPQVISTAASFNASLWEEIGRVVSDEARA  146

Query  498  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            M+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ
Sbjct  147  MYNGGIAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ  196



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEAGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N G+AGLTYWSPN+N+ RDPRWGR QE PGEDPT+ G+YAA++VRGLQ
Sbjct  147  EARAMYNGGVAGLTYWSPNVNVLRDPRWGRAQETPGEDPTVVGRYAASYVRGLQ  200



>ref|XP_004163321.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 7-like 
[Cucumis sativus]
Length=783

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L++ IG+ I TEAR
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGTEAR  150

Query  495  AMHNYGLA-GLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            A++N G A G+T+W+PN+NIFRDPRWGRGQE PGEDP +TGKY+ A+VRG+Q
Sbjct  151  AVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTGKYSVAYVRGIQ  202



>ref|XP_004150696.1| PREDICTED: probable beta-D-xylosidase 7-like [Cucumis sativus]
 gb|KGN62174.1| Periplasmic beta-glucosidase [Cucumis sativus]
Length=783

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L++ IG+ I TEAR
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGTEAR  150

Query  495  AMHNYGLA-GLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            A++N G A G+T+W+PN+NIFRDPRWGRGQE PGEDP +TGKY+ A+VRG+Q
Sbjct  151  AVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTGKYSVAYVRGIQ  202



>emb|CDY58860.1| BnaCnng33860D [Brassica napus]
Length=771

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATAKYTFCKASLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+   ++LPFC   L +  RV DL+ RL+L EK+  L++ A  V RLGI  YEW
Sbjct  28   FACDP-KDATTRTLPFCQVSLPIPQRVNDLIGRLSLQEKVKLLISGAAAVPRLGIKGYEW  86

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P ATSFPQ + TA+SFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGRVVSDEARAMYNGG  146

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L+GKYAA++VRGLQ
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSGKYAASYVRGLQ  191



>gb|KFK26586.1| hypothetical protein AALP_AA8G267600 [Arabis alpina]
Length=772

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  198



>ref|XP_010466113.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +3

Query  153  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  329
            +ACD  KN P      FCN  L  + R  DL+ RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLISRLSLTEKVQQLVNKATGVPRLGVPPYE  84

Query  330  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  509
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  510  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_003594795.1| Beta xylosidase [Medicago truncatula]
 gb|AES65046.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=762

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   +S  FCN R+ +  RV DL+ RL LPEKI  +VN A  V RLGI  YEW
Sbjct  27   FACDP-KNGLTRSYKFCNTRVPIHARVQDLIGRLALPEKIRLVVNNAIAVPRLGIQGYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G   AATSFPQ + TAASFN++L+  IG+++S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFSAATSFPQVITTAASFNQSLWLEIGRIVSDEARAMYNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLT+WSPN+NIFRDPRWGRGQE PGEDPT+ GKYAA++V+GLQ
Sbjct  146  AAGLTFWSPNVNIFRDPRWGRGQETPGEDPTVAGKYAASYVQGLQ  190



>gb|AAG10624.1|AC022521_2 Similar to xylosidase [Arabidopsis thaliana]
Length=763

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  25   FACDT-KDAATATLRFCQLSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  83

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  84   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  143

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  144  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  188



>ref|XP_006298950.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
 gb|EOA31848.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
Length=762

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +3

Query  153  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  329
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVLRLSLNEKVQQLVNKATGVPRLGVPPYE  84

Query  330  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  509
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  510  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  145  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_003554544.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=771

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN G K + FC   L +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  27   FACDP-KNGGTKKMAFCKVSLAIAERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GP V F    PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNLGPAVKFNAQFPAATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA +VRGLQ
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAATYVRGLQ  190



>ref|NP_563659.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
 sp|Q94KD8.1|BXL2_ARATH RecName: Full=Probable beta-D-xylosidase 2; Short=AtBXL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK56255.1|AF367266_1 At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AAN28891.1| At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AEE27453.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
Length=768

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  30   FACDT-KDAATATLRFCQLSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  88

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  89   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  148

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  149  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  193



>ref|XP_004487789.1| PREDICTED: beta-D-xylosidase 1-like [Cicer arietinum]
Length=776

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  KN   +   FCN+ + +  RV DL+ RLTL EKI  +VN A  V RLGI  YEW
Sbjct  31   FACDP-KNGLTRGYIFCNKNVPIHVRVQDLIGRLTLAEKIRLVVNNAIEVQRLGIQGYEW  89

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGPFPAATSFPQVITTAASFNQSLWLQIGRVVSDEARAMYNGG  149

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDPTL GKYAA +V+GLQ
Sbjct  150  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAGKYAANYVQGLQ  194



>ref|XP_010546993.1| PREDICTED: beta-D-xylosidase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010546994.1| PREDICTED: beta-D-xylosidase 1-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010546995.1| PREDICTED: beta-D-xylosidase 1-like isoform X3 [Tarenaya hassleriana]
Length=775

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P +ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  31   PPFACDPA-NGLTRTLRFCRVNVPLHLRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  89

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSDVGPGVRFGGQFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  149

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGL+YWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  150  GGMAGLSYWSPNVNIFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  196



>ref|XP_008234021.1| PREDICTED: probable beta-D-xylosidase 7 [Prunus mume]
Length=781

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P +S T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A  + 
Sbjct  25   PTES-TQPPYACDSSQ-PSTSSYPFCKTALPINQRVQDLVSRLTLDEKISQLVNSAPPIP  82

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGIP+YEWWSEALHG++  G G+N  G +  ATSFPQ +LTAASFNE L++ IG+VI T
Sbjct  83   RLGIPSYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQVIGT  142

Query  486  EARAMHNYGLA-GLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARA++N G A G+T+W+PN+NIFRDPRWGRGQE PGEDP + GKYA ++VRG+Q
Sbjct  143  EARALYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVVGKYAVSYVRGVQ  197



>ref|XP_009603126.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana tomentosiformis]
Length=790

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P  SQ    Y  D    P   +  FCN  L    R  D+V RLTL EK+  LVN+A  + 
Sbjct  19   PCNSQIHACYKSD----PNTSTYGFCNTSLAYTDRAKDIVSRLTLQEKVRQLVNSASGIP  74

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLG+P YEWWSEALHG+S TGPGV F   VP ATS P  +L+AASFN +L++T+GKV+ST
Sbjct  75   RLGVPAYEWWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVSLWYTLGKVVST  134

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAMHN GLAGLTYWSPN+N+ RDPRWGR QE PGEDP +  KYA  +VRGLQ
Sbjct  135  EARAMHNVGLAGLTYWSPNVNVLRDPRWGRAQETPGEDPLVVSKYAVNYVRGLQ  188



>ref|XP_008384517.1| PREDICTED: probable beta-D-xylosidase 5 [Malus domestica]
Length=802

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  +       PFCN  L  +TR  DLV RLTL EK+  LV+ +  ++RLG+P YEW
Sbjct  32   FACDN-RASATSQFPFCNTSLPYETRAKDLVSRLTLQEKVIQLVDKSTGIARLGVPAYEW  90

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG +F G VP ATSFP  +L+AASFN++L+  +G+V+STEARAM+N G
Sbjct  91   WSEALHGVSNVGPGTSFNGTVPGATSFPAVILSAASFNQSLWLKMGQVVSTEARAMYNVG  150

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +   YA  +VRGLQ
Sbjct  151  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSDYAVNYVRGLQ  195



>ref|XP_004494414.1| PREDICTED: probable beta-D-xylosidase 2-like [Cicer arietinum]
Length=771

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = +3

Query  138  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  317
            ++   +ACD  K+   K LPFC+ +L +  RV D++ RLTL EK+  LVN A  V R GI
Sbjct  22   ESRDTFACDP-KDGTTKKLPFCSVKLAIPERVKDIIGRLTLQEKVNLLVNNAAAVPRFGI  80

Query  318  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  497
              YEWWSEALHG+S  GPG  F  + P ATSFPQ + TAASFN +L+  IG+V+S EARA
Sbjct  81   KGYEWWSEALHGVSNVGPGTKFGALFPGATSFPQVITTAASFNASLWEAIGRVVSDEARA  140

Query  498  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            M+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++V+GLQ
Sbjct  141  MYNGGAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGSYAASYVKGLQ  190



>ref|XP_009145766.1| PREDICTED: probable beta-D-xylosidase 5 [Brassica rapa]
Length=782

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQ  190



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P  S +   +ACD   +   + LPFC   L ++ RV DL+ RL L EK+  LVN A  V+
Sbjct  25   PSSSASREPFACDPT-DKTTRGLPFCRTSLPIQERVKDLIGRLALQEKVRLLVNNAAAVT  83

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  84   RLGIKGYEWWSEALHGVSNVGPGSKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  143

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP + G YAA++V+GLQ
Sbjct  144  EARAMYNGGVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGTYAASYVKGLQ  197



>ref|XP_006418321.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
 gb|ESQ36674.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
Length=766

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = +3

Query  120  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  299
            I  V+  +   +ACDT K+    +L FC   + +  RV DL+ RLTL EK+  L NTA  
Sbjct  17   ISSVRVHSRETFACDT-KDAATATLRFCQLSVPIPERVKDLIGRLTLVEKVGLLGNTAAA  75

Query  300  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  479
            + RLGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+
Sbjct  76   IPRLGIKGYEWWSEALHGVSNVGPGTKFDGVYPAATSFPQVITTVASFNASLWESIGRVV  135

Query  480  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            S EARAM+N G+ GLTYWSPN+N+ RDPRWGRGQE PGEDP + G+YAA++VRGLQ
Sbjct  136  SNEARAMYNGGVGGLTYWSPNVNVLRDPRWGRGQETPGEDPVVAGRYAASYVRGLQ  191



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = +3

Query  120  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  299
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  300  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  479
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  480  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
              EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ
Sbjct  140  PDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYAARYVKGLQ  195



>ref|XP_002264114.2| PREDICTED: probable beta-D-xylosidase 5 [Vitis vinifera]
Length=794

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  139

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP +  +YA  +VRGLQ
Sbjct  140  AMYNVGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQ  190



>ref|XP_003546334.1| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=775

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  +N   +   FCN  + +  RV DL+ RLTLPEKI  +VN A  V RLGI  YEW
Sbjct  37   FACDP-RNGLTRGFKFCNTHVPIHVRVQDLIARLTLPEKIRLVVNNAIAVPRLGIQGYEW  95

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F G  P AT FPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  96   WSEALHGVSNVGPGTKFGGAFPGATMFPQVISTAASFNQSLWQEIGRVVSDEARAMYNGG  155

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             AGLTYWSPN+NIFRDPRWGRGQE PGEDPTL  KYAA++V+GLQ
Sbjct  156  QAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVKGLQ  200



>ref|XP_009129779.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=772

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + V  RV DL+ RL+L EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLSLQEKIRLLVNNAAAVPRLGIGGY  91

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  198



>ref|XP_008362602.1| PREDICTED: probable beta-D-xylosidase 7 [Malus domestica]
Length=410

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = +3

Query  141  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  320
            T P Y+CD+ + P   S PFC   L +  RV DL+ RLTL EKI+ LVN+A  + RLGIP
Sbjct  33   TQPPYSCDSSQ-PSTSSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIP  91

Query  321  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  500
            +YEWWSEALHG++  G G+     +  ATSFPQ +LTAASFN+ L++ IG+VI TEARA+
Sbjct  92   SYEWWSEALHGVADVGKGIKLYPTIHXATSFPQVILTAASFNDHLWYRIGQVIGTEARAV  151

Query  501  HNYGLA-GLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +N G A G+T+W+PN+NIFRDPRWGRGQE PGEDPT+TG+YA ++VRG+Q
Sbjct  152  YNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPTVTGRYAVSYVRGVQ  201



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD  K+    +LPFC   + +  RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  76   FACDP-KDATTPNLPFCKVSMPISIRVKDLLGRLTLQEKVRLLVNNAAAVPRLGIKGYEW  134

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG  F    PAATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  135  WSEALHGVSNVGPGTKFGRAFPAATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGG  194

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++V+GLQ
Sbjct  195  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVKGLQ  239



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  153  YACDTVKNPGL---KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  323
            +ACD    P L   +S  FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  
Sbjct  28   FACD----PKLGLTRSFKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQG  83

Query  324  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  503
            YEWWSEALHG+S  GPG  F G  P AT FPQ + TAASFNE+L+  IG+V+S EARAM+
Sbjct  84   YEWWSEALHGVSNVGPGTKFGGAFPGATGFPQVITTAASFNESLWEEIGRVVSDEARAMY  143

Query  504  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            N G+AGLTYWSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  144  NGGMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  191



>gb|AAP83934.1| auxin-induced beta-glucosidase [Oxybasis rubra]
Length=767

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 2/177 (1%)
 Frame = +3

Query  117  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  296
            I+   +++ AP+ ACD  K+   ++L FC   L ++ RV DL+ RL L EK+  LVN A 
Sbjct  15   ILLSAEARAAPL-ACDP-KSGLTRALRFCRVNLPIRARVQDLIGRLNLQEKVKLLVNNAA  72

Query  297  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  476
             V RLGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V
Sbjct  73   PVPRLGISGYEWWSEALHGVSNVGPGTKFRGAFPAATSFPQVITTAASFNASLWEAIGQV  132

Query  477  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            +S EARAM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDPTL  +YAA++VRGLQ
Sbjct  133  VSDEARAMYNGGTAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLASQYAASYVRGLQ  189



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2 [Fragaria vesca subsp. 
vesca]
Length=790

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 125/172 (73%), Gaps = 1/172 (1%)
 Frame = +3

Query  132  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  311
            QS T+  +AC+   +   K LPFC  +L +  RV DL+ RLTL EK+  LVN+A  V RL
Sbjct  28   QSPTSSSFACNP-NDASTKDLPFCRVKLPIHVRVRDLIGRLTLQEKVKLLVNSAKAVPRL  86

Query  312  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  491
            GI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+ +S EA
Sbjct  87   GIKDYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEAIGQAVSDEA  146

Query  492  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            RAM+N G+ GLTYWSPN+N+ RDPRWGRGQE PGEDP + G YAA++VRGLQ
Sbjct  147  RAMYNGGMGGLTYWSPNVNVLRDPRWGRGQETPGEDPVVVGAYAASYVRGLQ  198



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 125/174 (72%), Gaps = 3/174 (2%)
 Frame = +3

Query  126  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  305
            P  +   P +AC      GL   PFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PGGAAARPAFACGGGPAVGL---PFCRAALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  306  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  485
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+  IGK +S 
Sbjct  77   RLGIGGYEWWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSD  136

Query  486  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            EARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP + G+YA ++VRGLQ
Sbjct  137  EARAMYNGGQAGLTFWSPNVNIFRDPRWGRGQETPGEDPGVAGRYAVSYVRGLQ  190



>ref|XP_008454299.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Cucumis melo]
Length=741

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            + GLTYWSPN+NIFRDPRWGRGQE PGEDP L G YA  +VRGLQ
Sbjct  146  VGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGTYAVNYVRGLQ  190



>ref|XP_010482214.1| PREDICTED: beta-D-xylosidase 1-like [Camelina sativa]
Length=775

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  34   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRNLVNNAAAVPRLGIGGY  92

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  93   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  152

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  153  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGKYAASYVRGLQ  199



>emb|CBI22460.3| unnamed protein product [Vitis vinifera]
Length=896

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  45   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  103

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  104  VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  163

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP +  +YA  +VRGLQ
Sbjct  164  AMYNVGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQ  214



>ref|XP_006280043.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
 gb|EOA12941.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
Length=776

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  35   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRNLVNNAAAVPRLGIGGY  93

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  94   EWWSEALHGVSDVGPGARFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  153

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  154  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ  200



>emb|CAN82161.1| hypothetical protein VITISV_035506 [Vitis vinifera]
Length=925

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +3

Query  135  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  314
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  315  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  494
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  139

Query  495  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            AM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP +  +YA  +VRGLQ
Sbjct  140  AMYNVGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQ  190



>ref|XP_010440503.1| PREDICTED: beta-D-xylosidase 1 [Camelina sativa]
Length=775

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  147  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  326
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  34   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRNLVNNAAAVPRLGIGGY  92

Query  327  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  506
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  93   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  152

Query  507  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ
Sbjct  153  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGKYAASYVRGLQ  199



>ref|XP_008454298.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Cucumis melo]
Length=768

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  153  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  332
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  333  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  512
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  513  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ  647
            + GLTYWSPN+NIFRDPRWGRGQE PGEDP L G YA  +VRGLQ
Sbjct  146  VGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGTYAVNYVRGLQ  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625