BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF049B10

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...    109   7e-24   Nicotiana sylvestris
emb|CDP14783.1|  unnamed protein product                                108   2e-23   Coffea canephora [robusta coffee]
ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                        107   4e-23   Nicotiana tomentosiformis
ref|XP_009628959.1|  PREDICTED: extensin-like                           105   1e-22   Nicotiana tomentosiformis
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog      105   2e-22   Solanum tuberosum [potatoes]
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...    104   3e-22   Solanum lycopersicum
ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...    103   7e-22   Solanum tuberosum [potatoes]
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4        103   7e-22   Solanum lycopersicum
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...    103   9e-22   Nicotiana sylvestris
gb|EPS62243.1|  hypothetical protein M569_12549                         101   4e-21   Genlisea aurea
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...    100   5e-21   
gb|KHN35253.1|  hypothetical protein glysoja_042323                     100   6e-21   Glycine soja [wild soybean]
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog      100   6e-21   Cicer arietinum [garbanzo]
ref|XP_007132659.1|  hypothetical protein PHAVU_011G113900g             100   7e-21   Phaseolus vulgaris [French bean]
gb|KEH17617.1|  structural constituent of cell wall protein, puta...    100   1e-20   Medicago truncatula
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...  99.8    2e-20   Prunus mume [ume]
ref|XP_011098021.1|  PREDICTED: extensin                              99.4    2e-20   Sesamum indicum [beniseed]
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1        99.4    3e-20   Fragaria vesca subsp. vesca
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...  99.0    3e-20   Prunus mume [ume]
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg           99.0    3e-20   Prunus persica
ref|XP_006283593.1|  hypothetical protein CARUB_v10004649mg           97.8    6e-20   Capsella rubella
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...  97.8    8e-20   Glycine max [soybeans]
gb|KHN31988.1|  hypothetical protein glysoja_025822                   97.4    1e-19   Glycine soja [wild soybean]
ref|XP_010448000.1|  PREDICTED: vacuolar protein-sorting protein ...  97.1    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002869511.1|  hypothetical protein ARALYDRAFT_491942           97.1    1e-19   
ref|XP_010438481.1|  PREDICTED: formin-like protein 5                 97.1    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010433239.1|  PREDICTED: bromodomain-containing protein 4-...  97.1    1e-19   Camelina sativa [gold-of-pleasure]
ref|NP_194559.2|  uncharacterized protein                             96.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...  96.7    2e-19   Glycine max [soybeans]
emb|CAB79632.1|  predicted proline-rich protein                       95.9    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010110218.1|  hypothetical protein L484_009824                 95.9    4e-19   Morus notabilis
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...  94.7    8e-19   
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...  94.7    8e-19   Pyrus x bretschneideri [bai li]
emb|CDX89188.1|  BnaA01g17050D                                        94.4    1e-18   
ref|XP_009144355.1|  PREDICTED: protein transport protein SEC31-like  94.0    1e-18   Brassica rapa
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg              94.4    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_006412973.1|  hypothetical protein EUTSA_v10024987mg           94.4    1e-18   Eutrema salsugineum [saltwater cress]
emb|CDY67879.1|  BnaC07g50480D                                        94.0    1e-18   Brassica napus [oilseed rape]
ref|XP_009137778.1|  PREDICTED: basic salivary proline-rich prote...  93.6    2e-18   Brassica rapa
gb|KFK35898.1|  hypothetical protein AALP_AA4G050800                  93.2    3e-18   Arabis alpina [alpine rockcress]
emb|CDX97433.1|  BnaC08g12980D                                        93.2    3e-18   
emb|CDY25250.1|  BnaA02g22060D                                        93.2    3e-18   Brassica napus [oilseed rape]
emb|CDY18985.1|  BnaC01g20830D                                        92.4    5e-18   Brassica napus [oilseed rape]
ref|NP_974630.1|  uncharacterized protein                             91.3    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...  91.7    1e-17   Eucalyptus grandis [rose gum]
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...  91.3    1e-17   Pyrus x bretschneideri [bai li]
emb|CBI21851.3|  unnamed protein product                              86.7    2e-17   Vitis vinifera
emb|CDY14248.1|  BnaA08g13790D                                        90.5    2e-17   Brassica napus [oilseed rape]
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1              89.7    5e-17   
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...  89.4    6e-17   Pyrus x bretschneideri [bai li]
ref|XP_006376495.1|  hydroxyproline-rich glycoprotein                 89.4    7e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...  89.0    9e-17   Vitis vinifera
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...  89.0    9e-17   Pyrus x bretschneideri [bai li]
ref|XP_007043595.1|  Structural constituent of cell wall              89.0    9e-17   
emb|CAN71577.1|  hypothetical protein VITISV_043279                   86.7    1e-16   Vitis vinifera
ref|XP_011037329.1|  PREDICTED: bromodomain-containing protein 4-...  89.0    1e-16   Populus euphratica
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2              88.6    1e-16   
gb|ACU16150.1|  unknown                                               85.1    1e-16   Glycine max [soybeans]
ref|XP_009109102.1|  PREDICTED: formin-like protein 3                 87.8    2e-16   Brassica rapa
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...  87.8    2e-16   Pyrus x bretschneideri [bai li]
gb|KDP24130.1|  hypothetical protein JCGZ_25787                       87.4    3e-16   Jatropha curcas
ref|XP_011037330.1|  PREDICTED: putative uncharacterized protein ...  87.0    4e-16   Populus euphratica
gb|KJB77268.1|  hypothetical protein B456_012G128800                  86.7    6e-16   Gossypium raimondii
gb|KJB77271.1|  hypothetical protein B456_012G128800                  86.3    7e-16   Gossypium raimondii
ref|XP_002517918.1|  structural constituent of cell wall, putative    86.3    8e-16   Ricinus communis
gb|KHG27956.1|  S-adenosylmethionine synthase 1                       85.9    9e-16   Gossypium arboreum [tree cotton]
gb|KJB31694.1|  hypothetical protein B456_005G201600                  85.9    1e-15   Gossypium raimondii
ref|XP_003543336.1|  PREDICTED: RNA polymerase II degradation fac...  85.5    1e-15   Glycine max [soybeans]
gb|KHN36637.1|  hypothetical protein glysoja_001368                   85.5    1e-15   Glycine soja [wild soybean]
ref|XP_002325597.2|  hydroxyproline-rich glycoprotein                 85.1    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...  84.3    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...  84.3    3e-15   Glycine max [soybeans]
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...  84.0    4e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011002849.1|  PREDICTED: calcium-binding protein P-like        82.8    1e-14   Populus euphratica
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...  82.8    1e-14   Eucalyptus grandis [rose gum]
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog    82.0    2e-14   Cucumis melo [Oriental melon]
ref|XP_004136824.1|  PREDICTED: uncharacterized protein LOC101206745  82.0    2e-14   Cucumis sativus [cucumbers]
ref|XP_010540875.1|  PREDICTED: extensin                              81.3    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_007149849.1|  hypothetical protein PHAVU_005G103700g           79.7    1e-13   Phaseolus vulgaris [French bean]
gb|KEH39132.1|  structural constituent of cell wall protein, puta...  79.0    2e-13   Medicago truncatula
ref|XP_008455323.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    2e-13   Cucumis melo [Oriental melon]
ref|XP_004136823.1|  PREDICTED: uncharacterized protein LOC101206501  78.6    3e-13   Cucumis sativus [cucumbers]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                 75.5    3e-12   Citrus sinensis [apfelsine]
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                 75.5    3e-12   Citrus sinensis [apfelsine]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg           75.5    3e-12   Citrus clementina [clementine]
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg           75.5    3e-12   Citrus clementina [clementine]
dbj|BAK01177.1|  predicted protein                                    74.7    6e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50510.1|  hypothetical protein TRIUR3_23019                     74.3    8e-12   Triticum urartu
gb|KJB77274.1|  hypothetical protein B456_012G128800                  73.6    1e-11   Gossypium raimondii
gb|KEH39131.1|  structural constituent of cell wall protein, puta...  73.6    1e-11   Medicago truncatula
ref|XP_002458505.1|  hypothetical protein SORBIDRAFT_03g034890        72.8    2e-11   Sorghum bicolor [broomcorn]
ref|XP_004969990.1|  PREDICTED: trithorax group protein osa-like      72.8    3e-11   Setaria italica
ref|XP_008655245.1|  PREDICTED: uncharacterized protein LOC100383...  72.4    3e-11   Zea mays [maize]
gb|EMT05386.1|  hypothetical protein F775_26441                       72.4    3e-11   
emb|CDM84126.1|  unnamed protein product                              72.4    3e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008810226.1|  PREDICTED: ataxin-2 homolog isoform X2           69.7    2e-10   Phoenix dactylifera
ref|XP_008810225.1|  PREDICTED: ataxin-2 homolog isoform X1           69.3    3e-10   Phoenix dactylifera
ref|XP_006644725.1|  PREDICTED: mediator of RNA polymerase II tra...  68.9    4e-10   Oryza brachyantha
ref|XP_006644724.1|  PREDICTED: mediator of RNA polymerase II tra...  68.9    4e-10   Oryza brachyantha
ref|XP_010924425.1|  PREDICTED: hepatocyte growth factor-regulate...  68.6    5e-10   Elaeis guineensis
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...  68.6    5e-10   Elaeis guineensis
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...  68.2    8e-10   Elaeis guineensis
gb|EEC71500.1|  hypothetical protein OsI_03777                        67.8    9e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001044280.1|  Os01g0754500                                     67.8    1e-09   
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...  67.4    1e-09   Phoenix dactylifera
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...  67.0    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW89535.1|  hypothetical protein EUGRSUZ_A01820                   63.2    3e-08   Eucalyptus grandis [rose gum]
ref|NP_001169238.1|  uncharacterized protein LOC100383096             61.2    1e-07   Zea mays [maize]
gb|ACN28687.1|  unknown                                               57.0    3e-07   Zea mays [maize]
tpg|DAA58176.1|  TPA: putative DUF1421 domain family protein          57.4    4e-07   
tpg|DAA58177.1|  TPA: putative DUF1421 domain family protein          57.0    4e-07   
ref|XP_006844887.1|  hypothetical protein AMTR_s00058p00125550        58.9    9e-07   
gb|AFW79145.1|  putative DUF1421 domain family protein                58.9    9e-07   
gb|EEE55398.1|  hypothetical protein OsJ_03493                        58.5    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440244.1|  hypothetical protein SORBIDRAFT_09g028390        58.9    9e-07   Sorghum bicolor [broomcorn]
ref|NP_001143126.1|  uncharacterized protein LOC100275604             58.5    1e-06   Zea mays [maize]
ref|XP_010232129.1|  PREDICTED: uncharacterized protein LOC100831431  58.5    1e-06   Brachypodium distachyon [annual false brome]
tpg|DAA58178.1|  TPA: putative DUF1421 domain family protein          57.8    2e-06   
ref|NP_001266367.1|  uncharacterized protein LOC101202710             57.8    2e-06   
gb|ACN33301.1|  unknown                                               57.8    2e-06   Zea mays [maize]
ref|XP_004961233.1|  PREDICTED: adenylate cyclase, terminal-diffe...  57.0    3e-06   Setaria italica
ref|XP_004961232.1|  PREDICTED: adenylate cyclase, terminal-diffe...  57.0    4e-06   Setaria italica
gb|EAY75332.1|  hypothetical protein OsI_03225                        57.0    4e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_003568842.1|  PREDICTED: zyxin-like                            57.0    4e-06   Brachypodium distachyon [annual false brome]
gb|EAZ13051.1|  hypothetical protein OsJ_02970                        56.6    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644504.1|  PREDICTED: mediator of RNA polymerase II tra...  56.2    7e-06   
gb|EAY99014.1|  hypothetical protein OsI_20972                        55.8    8e-06   Oryza sativa Indica Group [Indian rice]
gb|AAU10648.1|  hypothetical protein                                  55.8    8e-06   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK01901.1|  predicted protein                                    55.8    9e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT01630.1|  hypothetical protein F775_09697                       55.5    1e-05   
dbj|BAJ94416.1|  predicted protein                                    55.5    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004960805.1|  PREDICTED: protein diaphanous homolog 1-like     55.5    1e-05   
ref|XP_002458299.1|  hypothetical protein SORBIDRAFT_03g030820        55.1    2e-05   Sorghum bicolor [broomcorn]
ref|NP_001142422.1|  putative DUF1421 domain family protein           54.7    2e-05   Zea mays [maize]
ref|XP_008654665.1|  PREDICTED: putative DUF1421 domain family pr...  54.3    3e-05   Zea mays [maize]
ref|XP_008654664.1|  PREDICTED: putative DUF1421 domain family pr...  54.3    3e-05   Zea mays [maize]
ref|XP_006655586.1|  PREDICTED: adenylate cyclase, terminal-diffe...  54.3    3e-05   
emb|CDM83294.1|  unnamed protein product                              53.9    4e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011097415.1|  PREDICTED: protein enabled-like                  53.5    5e-05   Sesamum indicum [beniseed]
gb|EMS54596.1|  Tryptophan aminotransferase 1                         53.1    7e-05   Triticum urartu
emb|CBI34879.3|  unnamed protein product                              52.8    1e-04   Vitis vinifera
ref|XP_002440684.1|  hypothetical protein SORBIDRAFT_09g005090        52.8    1e-04   
ref|XP_002275607.1|  PREDICTED: protein enabled                       52.8    1e-04   Vitis vinifera
ref|XP_002985569.1|  hypothetical protein SELMODRAFT_446314           52.4    1e-04   Selaginella moellendorffii
ref|XP_002987005.1|  hypothetical protein SELMODRAFT_425866           52.4    2e-04   Selaginella moellendorffii
ref|XP_003567907.1|  PREDICTED: transcriptional regulator DEF1-like   52.0    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...  51.2    3e-04   Oryza brachyantha
ref|XP_008666394.1|  PREDICTED: putative mediator of RNA polymera...  51.2    3e-04   Zea mays [maize]
ref|XP_008784980.1|  PREDICTED: uncharacterized protein LOC103703781  51.6    3e-04   Phoenix dactylifera
tpg|DAA47389.1|  TPA: hypothetical protein ZEAMMB73_495059            50.8    4e-04   
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...  51.2    4e-04   Oryza brachyantha
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     50.8    4e-04   Elaeis guineensis
ref|XP_010908580.1|  PREDICTED: pollen-specific leucine-rich repe...  50.8    4e-04   Elaeis guineensis
gb|EMS64546.1|  hypothetical protein TRIUR3_27252                     50.8    5e-04   Triticum urartu
ref|XP_010108811.1|  hypothetical protein L484_020546                 50.8    5e-04   Morus notabilis
emb|CAN60421.1|  hypothetical protein VITISV_021069                   50.8    5e-04   Vitis vinifera
dbj|BAJ85240.1|  predicted protein                                    50.4    6e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002524656.1|  DNA binding protein, putative                    50.1    7e-04   Ricinus communis
ref|XP_008656735.1|  PREDICTED: chromatin modification-related pr...  50.1    7e-04   Zea mays [maize]
ref|XP_008656734.1|  PREDICTED: mediator of RNA polymerase II tra...  50.1    8e-04   
gb|AFW83522.1|  putative DUF1421 domain family protein                50.1    8e-04   



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHKSRMTRSSM P  AY PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQL
Sbjct  50   KEFHKSRMTRSSMFPAPAYSPPEESSFNQDMISTVEKTMKKYADNLMRFLEGISSRLSQL  109

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  110  ELYCYNLDKSI  120



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ P ++Y PPE+SSFNQDVI  VE++MKKYADNLMRFLEG+SSRLSQL
Sbjct  54   KEFHKNRMARSSVFPAASYSPPEESSFNQDVIATVERTMKKYADNLMRFLEGISSRLSQL  113

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  114  ELYCYNLDKSI  124



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHKSRMTRSSM P  AY PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQL
Sbjct  50   KEFHKSRMTRSSMFPAPAYSPPEESSFNQDMICTVEKTMKKYADNLMRFLEGISSRLSQL  109

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  110  ELYCYNLDKSI  120



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHKSRMTRSSM PTS Y PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQL
Sbjct  53   KEFHKSRMTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYADNLMRFLEGISSRLSQL  112

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  113  ELYCYNLDKSI  123



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHKSRMTRSSM P  AY PPE+SSFNQD+I  +EK+MKKY DNLMRFLEG+SSRLSQLE
Sbjct  53   EFHKSRMTRSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRLSQLE  112

Query  668  LYCYNLDKSI  697
            LYCYNLDKSI
Sbjct  113  LYCYNLDKSI  122



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHKSRMTRSSM P  AY PPE+SSFNQD+I  +EK+MKKY DNLMRFLEG+SSRLSQLE
Sbjct  53   EFHKSRMTRSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRLSQLE  112

Query  668  LYCYNLDKSI  697
            LYCYNLDKSI
Sbjct  113  LYCYNLDKSI  122



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RMTRSSM PTS Y PPE+SSFNQD+I  VEK+MKKY DNLMRFLEG+SSRLSQL
Sbjct  53   KEFHKNRMTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRLSQL  112

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  113  ELYCYNLDKSI  123



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RMTRSSM PTS Y PPE+SSFNQD+I  VEK+MKKY DNLMRFLEG+SSRLSQL
Sbjct  53   KEFHKNRMTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRLSQL  112

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  113  ELYCYNLDKSI  123



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHKSRMTRSSM PTS Y PPE+SSFNQD+I  V+K+MKKYADN+MRFLEG+SSRLSQL
Sbjct  53   KEFHKSRMTRSSMFPTSTYSPPEESSFNQDMICTVDKTMKKYADNIMRFLEGISSRLSQL  112

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  113  ELYCYNLDKSI  123



>gb|EPS62243.1| hypothetical protein M569_12549, partial [Genlisea aurea]
Length=512

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            QEFHKSRM+RSS+ PT+ Y PPE+SSFNQ V+ AVE S+KKY DN++RFLEG+SSRLSQL
Sbjct  52   QEFHKSRMSRSSVFPTATYNPPEESSFNQTVVSAVENSVKKYTDNILRFLEGISSRLSQL  111

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  112  ELYCYNLDKSI  122



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +2

Query  479  IEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLS  658
             + +FHKSRM R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLS
Sbjct  42   TDPDFHKSRMARTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLS  100

Query  659  QLELYCYNLDKSI  697
            QLELYCYNLDKSI
Sbjct  101  QLELYCYNLDKSI  113



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +2

Query  479  IEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLS  658
             + +FHKSRM R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLS
Sbjct  42   TDPDFHKSRMARTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLS  100

Query  659  QLELYCYNLDKSI  697
            QLELYCYNLDKSI
Sbjct  101  QLELYCYNLDKSI  113



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            ++FHK+R+ R+S+ PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  52   KDFHKTRVARTSVFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  111  ELYCYNLDKSI  121



>ref|XP_007132659.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
 gb|ESW04653.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
Length=541

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            + +FHK+RM+R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  43   DPDFHKARMSRTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  101

Query  662  LELYCYNLDKSI  697
            LELYCYNLDKSI
Sbjct  102  LELYCYNLDKSI  113



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            ++FHKSR+ R+S+ P  AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  45   KDFHKSRVARTSVFPAPAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  103

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  104  ELYCYNLDKSI  114



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            +Q+FHKSRM R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  52   QQDFHKSRMARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  110

Query  662  LELYCYNLDKSI  697
            LELYCYNLDKSI
Sbjct  111  LELYCYNLDKSI  122



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  464  SSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGL  643
            SS     +EF+KSRM RSS+ P S Y PPE+SSFNQ VI  VE +MKKY DN+MRFLEG+
Sbjct  45   SSATNSTKEFNKSRMARSSVFPASTYSPPEESSFNQGVITTVENTMKKYTDNIMRFLEGI  104

Query  644  SSRLSQLELYCYNLDKSI  697
            SSR+SQLELYCYNLDKSI
Sbjct  105  SSRMSQLELYCYNLDKSI  122



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            Q+FHKSRM RS M  ++AY  PEDS  NQ+VI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  52   QDFHKSRMARSPMYSSAAYGQPEDS-LNQEVIATVEKSMKKYADNLMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  111  ELYCYNLDKSI  121



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            +Q+FHKSRM R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51   KQDFHKSRMARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662  LELYCYNLDKSI  697
            LELYCYNLDKSI
Sbjct  110  LELYCYNLDKSI  121



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            +Q+FHKSRM R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51   KQDFHKSRMARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662  LELYCYNLDKSI  697
            LELYCYNLDKSI
Sbjct  110  LELYCYNLDKSI  121



>ref|XP_006283593.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
 gb|EOA16491.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
Length=497

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +2

Query  476  CIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRL  655
               +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRL
Sbjct  50   ATNKEFHKTRMARSSVFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRL  108

Query  656  SQLELYCYNLDKSI  697
            SQLELYCYNLDK+I
Sbjct  109  SQLELYCYNLDKTI  122



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            Q+FHKSR    +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  45   QDFHKSRRMFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  99

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  100  ELYCYNLDKSI  110



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            Q+FHKSR    +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  45   QDFHKSRRMFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  99

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  100  ELYCYNLDKSI  110



>ref|XP_010448000.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Camelina 
sativa]
Length=495

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLE
Sbjct  49   EFHKTRMARSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLE  107

Query  668  LYCYNLDKSI  697
            LYCYNLDK+I
Sbjct  108  LYCYNLDKTI  117



>ref|XP_002869511.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45770.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  111  ELYCYNLDKTI  121



>ref|XP_010438481.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=497

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLE
Sbjct  49   EFHKTRMARSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLE  107

Query  668  LYCYNLDKSI  697
            LYCYNLDK+I
Sbjct  108  LYCYNLDKTI  117



>ref|XP_010433239.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=494

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLE
Sbjct  49   EFHKTRMARSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLE  107

Query  668  LYCYNLDKSI  697
            LYCYNLDK+I
Sbjct  108  LYCYNLDKTI  117



>ref|NP_194559.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36251.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAM20028.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE85466.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=496

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  111  ELYCYNLDKTI  121



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  57   AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSI  109



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  111  ELYCYNLDKTI  121



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  PEDS FNQDVI AVEKSMK+ ADNLMRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  67   AYTQPEDS-FNQDVISAVEKSMKRNADNLMRFLEGISSRLSQLELYCYNLDKSI  119



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            +FHKSRM+R SM  + AY  PE+S  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLE
Sbjct  52   DFHKSRMSRQSMFSSPAYSQPEES-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQLE  110

Query  668  LYCYNLDKSI  697
            LYCYNLDKSI
Sbjct  111  LYCYNLDKSI  120



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            +FHKSRM+R SM  + AY  PE+S  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLE
Sbjct  52   DFHKSRMSRQSMFSSPAYSQPEES-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQLE  110

Query  668  LYCYNLDKSI  697
            LYCYNLDKSI
Sbjct  111  LYCYNLDKSI  120



>emb|CDX89188.1| BnaA01g17050D [Brassica napus]
Length=470

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +2

Query  458  NLSSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDA-VEKSMKKYADNLMRFL  634
            N    +   +EFHK+RM RSS+ PTS+Y PP+DS  +QD+I+A VE++MKKY+DN+MRFL
Sbjct  38   NSDPAIAANKEFHKTRMARSSVFPTSSYTPPDDS-LSQDIINATVERTMKKYSDNVMRFL  96

Query  635  EGLSSRLSQLELYCYNLDKSI  697
            EG+SSRLSQLELYCYNLDK+I
Sbjct  97   EGISSRLSQLELYCYNLDKTI  117



>ref|XP_009144355.1| PREDICTED: protein transport protein SEC31-like [Brassica rapa]
Length=476

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +2

Query  458  NLSSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDA-VEKSMKKYADNLMRFL  634
            N    +   +EFHK+RM RSS+ PTS+Y PP+DS  +QD+I+A VE++MKKY+DN+MRFL
Sbjct  38   NSDPAIAANKEFHKTRMARSSVFPTSSYTPPDDS-LSQDIINATVERTMKKYSDNVMRFL  96

Query  635  EGLSSRLSQLELYCYNLDKSI  697
            EG+SSRLSQLELYCYNLDK+I
Sbjct  97   EGISSRLSQLELYCYNLDKTI  117



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EF+KSRM RSS+ P   Y  PE+SSFNQ VI  VE +MKK+ DNLMRFLEG+SSRLSQL
Sbjct  52   KEFNKSRMARSSVFPAPTYGTPEESSFNQGVISTVENTMKKHTDNLMRFLEGISSRLSQL  111

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  112  ELYCYNLDKSI  122



>ref|XP_006412973.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
 gb|ESQ54426.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
Length=499

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+   VE++MKKYADN+MRFLEG+SSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDLTATVERTMKKYADNMMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  111  ELYCYNLDKTI  121



>emb|CDY67879.1| BnaC07g50480D [Brassica napus]
Length=478

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QDV   VE++MKKY DN+MRFLEG+SSRLSQL
Sbjct  47   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDVTATVERTMKKYTDNVMRFLEGISSRLSQL  105

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  106  ELYCYNLDKTI  116



>ref|XP_009137778.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
 emb|CDY29896.1| BnaA03g49170D [Brassica napus]
Length=487

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QDV   VE++MKKY DN+MRFLEG+SSRLSQL
Sbjct  48   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDVTATVERTMKKYTDNVMRFLEGISSRLSQL  106

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  107  ELYCYNLDKTI  117



>gb|KFK35898.1| hypothetical protein AALP_AA4G050800 [Arabis alpina]
Length=484

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +Q++   VE+SMKKYADN+MRFLEG+SSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQELTATVERSMKKYADNMMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  111  ELYCYNLDKTI  121



>emb|CDX97433.1| BnaC08g12980D [Brassica napus]
Length=492

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTGSYAPPEDSLREEELTATVERSMKKYSDNMMRFLEGLSSRLSQL  111

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  112  ELYCYNLDKTI  122



>emb|CDY25250.1| BnaA02g22060D [Brassica napus]
Length=492

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTGSYAPPEDSLREEELTATVERSMKKYSDNMMRFLEGLSSRLSQL  111

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  112  ELYCYNLDKTI  122



>emb|CDY18985.1| BnaC01g20830D [Brassica napus]
Length=479

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +2

Query  458  NLSSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLE  637
            N    +   +EFHK+RM RSS+ PTS+Y PPEDS  +QD+   VE +MKKY+DN+MRFLE
Sbjct  37   NSDHAIAANKEFHKTRMARSSVFPTSSYSPPEDS-LSQDINATVESTMKKYSDNMMRFLE  95

Query  638  GLSSRLSQLELYCYNLDKSI  697
            G+SSRLSQLELYCYNLDK+I
Sbjct  96   GISSRLSQLELYCYNLDKTI  115



>ref|NP_974630.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85467.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=438

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQLELYCYNLDK+I
Sbjct  11   SYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQLELYCYNLDKTI  63



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            ++FHKSR+ R  +    AY  PEDS FNQD+I +VEKSMKK+ D+LMRFLEG+SSRLS+L
Sbjct  53   KDFHKSRLVRPMVYSAPAYSQPEDS-FNQDLIASVEKSMKKHTDSLMRFLEGISSRLSEL  111

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  112  ELYCYNLDKSI  122



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            +Q+FH+SRM+R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51   KQDFHRSRMSRQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662  LELYCYNLDKSI  697
            LELYCYN+DKSI
Sbjct  110  LELYCYNVDKSI  121



>emb|CBI21851.3| unnamed protein product [Vitis vinifera]
Length=151

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  539  YIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            Y   E+SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  66   YGQQEESSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSI  118



>emb|CDY14248.1| BnaA08g13790D [Brassica napus]
Length=491

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM +SS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMAKSSVFPTGSYGPPEDS-LREELTATVERSMKKYSDNMMRFLEGLSSRLSQL  110

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  111  ELYCYNLDKTI  121



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            +Q+F +SRM+R  M  + AY  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51   KQDFQRSRMSRQPMFSSPAYSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662  LELYCYNLDKSI  697
            LELYCYN+DKSI
Sbjct  110  LELYCYNVDKSI  121



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            +FH+SRM+R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLE
Sbjct  52   DFHRSRMSRQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLE  110

Query  668  LYCYNLDKSI  697
            LYCYN+DKSI
Sbjct  111  LYCYNVDKSI  120



>ref|XP_006376495.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP54292.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=532

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            ++FHKSRMTRSSM P ++Y  PEDS FNQDV+  VEKSMKK  DN+MRFLEG+SSRLSQL
Sbjct  53   KDFHKSRMTRSSMFPATSYSQPEDS-FNQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQL  111

Query  665  ELYCYNLDKSI  697
            EL CYNLDKSI
Sbjct  112  ELCCYNLDKSI  122



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E+SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  70   EESSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSI  118



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            +Q+ H+SR+ R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51   KQDIHRSRLARQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662  LELYCYNLDKSI  697
            LELYCYN+DKSI
Sbjct  110  LELYCYNVDKSI  121



>ref|XP_007043595.1| Structural constituent of cell wall [Theobroma cacao]
 gb|EOX99426.1| Structural constituent of cell wall [Theobroma cacao]
Length=552

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  PEDS F+ DV   VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLDK+I
Sbjct  69   AYSQPEDS-FSTDVTATVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLDKTI  121



>emb|CAN71577.1| hypothetical protein VITISV_043279 [Vitis vinifera]
Length=292

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
             Y   E+SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  65   VYGQQEESSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSI  118



>ref|XP_011037329.1| PREDICTED: bromodomain-containing protein 4-like isoform X1 [Populus 
euphratica]
Length=527

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +2

Query  482  EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            +Q+FHKSRMTRSSM P ++Y  PEDS F QDV+  VEKSMKK  DN+MRFLEG+SSRLSQ
Sbjct  53   KQDFHKSRMTRSSMFPATSYSQPEDS-FTQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQ  111

Query  662  LELYCYNLDKSI  697
            LEL CYNLDKSI
Sbjct  112  LELCCYNLDKSI  123



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+DKSI
Sbjct  68   AYSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVDKSI  120



>gb|ACU16150.1| unknown [Glycine max]
Length=193

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY   EDS  +QDVI  VEKSMK +ADNLMRFLEGLS+RLSQLELYCYNLDKSI
Sbjct  63   AYSSSEDS-LSQDVIAIVEKSMKTHADNLMRFLEGLSTRLSQLELYCYNLDKSI  115



>ref|XP_009109102.1| PREDICTED: formin-like protein 3 [Brassica rapa]
Length=500

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM +SS+ PT +Y PPED    +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  43   KEFHKTRMAKSSVFPTGSYGPPEDC-LREELTATVERSMKKYSDNMMRFLEGLSSRLSQL  101

Query  665  ELYCYNLDKSI  697
            ELYCYNLDK+I
Sbjct  102  ELYCYNLDKTI  112



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +2

Query  548  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+DKSI
Sbjct  72   PEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVDKSI  120



>gb|KDP24130.1| hypothetical protein JCGZ_25787 [Jatropha curcas]
Length=532

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            ++FHK RM RSS+ P ++Y  PEDS F+QD+I   EKSMKK+ DN+MRFLEG+SSRLSQL
Sbjct  51   KDFHKGRMARSSVFPANSYSQPEDS-FSQDMISFFEKSMKKHTDNVMRFLEGVSSRLSQL  109

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  110  ELYCYNLDKSI  120



>ref|XP_011037330.1| PREDICTED: putative uncharacterized protein DDB_G0294196 isoform 
X2 [Populus euphratica]
Length=526

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            ++FHKSRMTRSSM P ++Y  PEDS F QDV+  VEKSMKK  DN+MRFLEG+SSRLSQL
Sbjct  53   KDFHKSRMTRSSMFPATSYSQPEDS-FTQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQL  111

Query  665  ELYCYNLDKSI  697
            EL CYNLDKSI
Sbjct  112  ELCCYNLDKSI  122



>gb|KJB77268.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77270.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77272.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=551

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  P+DS ++ DV   VEK+MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI
Sbjct  71   AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  123



>gb|KJB77271.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77273.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=566

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  P+DS ++ DV   VEK+MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI
Sbjct  71   AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  123



>ref|XP_002517918.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF44436.1| structural constituent of cell wall, putative [Ricinus communis]
Length=536

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +++HKSRM+RSS+   S+Y  PEDS F+QDVI  VE+SMKK+ D LMRFLEG+SSRLSQL
Sbjct  51   KDYHKSRMSRSSLFHASSYSQPEDS-FSQDVISVVERSMKKHTDGLMRFLEGVSSRLSQL  109

Query  665  ELYCYNLDKSI  697
            EL CYNLDKSI
Sbjct  110  ELNCYNLDKSI  120



>gb|KHG27956.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=552

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  P+DS ++ DV   VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  71   AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLDKSI  123



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHK R+ RS   P+  Y  PEDS F+ DV   VEK+MK+Y DNLMRFLEG+SSRLSQLE
Sbjct  50   EFHKGRVARSMFPPS-GYSQPEDS-FSSDVAATVEKTMKRYTDNLMRFLEGISSRLSQLE  107

Query  668  LYCYNLDKSI  697
            LYCYNLD+SI
Sbjct  108  LYCYNLDRSI  117



>ref|XP_003543336.1| PREDICTED: RNA polymerase II degradation factor 1-like [Glycine 
max]
Length=537

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY P EDS  +QDVI  VEKSMK +ADNLM+FLEGL +RLSQLELYCYNLDKSI
Sbjct  64   AYSPSEDS-LSQDVIATVEKSMKTHADNLMQFLEGLGTRLSQLELYCYNLDKSI  116



>gb|KHN36637.1| hypothetical protein glysoja_001368 [Glycine soja]
Length=537

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY P EDS  +QDVI  VEKSMK +ADNLM+FLEGL +RLSQLELYCYNLDKSI
Sbjct  64   AYSPSEDS-LSQDVIATVEKSMKTHADNLMQFLEGLGTRLSQLELYCYNLDKSI  116



>ref|XP_002325597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99978.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=537

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDS-SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            ++FHKS+MTRSS+ P S+Y  PEDS  F+ DV+  VEK MKK+ DN+MRFLEG+SSRLSQ
Sbjct  53   KDFHKSKMTRSSVYPASSYSQPEDSFHFSPDVVSTVEKGMKKHTDNIMRFLEGISSRLSQ  112

Query  662  LELYCYNLDKSI  697
            LEL CYNLDK+I
Sbjct  113  LELSCYNLDKAI  124



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  563  FNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
             +Q++I AVE++MKKYADNLMRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  77   LSQELISAVERTMKKYADNLMRFLEGISSRLSQLELYCYNLDKSI  121



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY   EDS  +QDVI  VEKSMK +ADNLMRFLEGLS+RLSQLELYCYNLDKSI
Sbjct  63   AYSSSEDS-LSQDVIAIVEKSMKTHADNLMRFLEGLSTRLSQLELYCYNLDKSI  115



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++ SFNQ+VI  VE++MKKYADNL+RFLEG+S RL QLELYCYNL+KS+
Sbjct  70   QEESFNQEVIATVERTMKKYADNLLRFLEGISGRLQQLELYCYNLEKSV  118



>ref|XP_011002849.1| PREDICTED: calcium-binding protein P-like [Populus euphratica]
Length=549

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDS-SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            ++FHKS+MTRSS+ P S+Y  PEDS  F+ DV+  VEK MKK+ D++MRFLEG+SSRLSQ
Sbjct  53   KDFHKSKMTRSSVYPASSYSQPEDSFHFSPDVVSTVEKGMKKHTDSIMRFLEGISSRLSQ  112

Query  662  LELYCYNLDKSI  697
            LEL CYNLDK+I
Sbjct  113  LELSCYNLDKAI  124



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            Q+FHK+R+ R       +   PEDS  N D++  VEKSMK+  D++MRFLEG+SSRLSQL
Sbjct  6    QDFHKNRLVRPVTYAPPSSTQPEDSX-NSDLVSTVEKSMKRNTDSIMRFLEGISSRLSQL  64

Query  665  ELYCYNLDKSI  697
            ELYCYNLDKSI
Sbjct  65   ELYCYNLDKSI  75



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  554  DSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            D + +Q+VI  VE SMKK++DNL+RFLEG+SSRLSQLELYCYNLDKS+
Sbjct  71   DDTISQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDKSV  118



>ref|XP_004136824.1| PREDICTED: uncharacterized protein LOC101206745 [Cucumis sativus]
 ref|XP_004155474.1| PREDICTED: uncharacterized protein LOC101231079 [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  554  DSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            D + +Q+VI  VE SMKK++DNL+RFLEG+SSRLSQLELYCYNLDKS+
Sbjct  71   DDTISQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDKSV  118



>ref|XP_010540875.1| PREDICTED: extensin [Tarenaya hassleriana]
Length=492

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  563  FNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
             +QD+   VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLDK+I
Sbjct  77   LSQDITATVERTMKKYADNMMRFLEGISSRLSQLELYCYNLDKTI  121



>ref|XP_007149849.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
 gb|ESW21843.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
Length=513

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY   EDS   QDVI  VEKSMK + DNLM+FLEG+SSRLS+LELYCYNLDKSI
Sbjct  64   AYGSSEDS-LGQDVIATVEKSMKTHTDNLMQFLEGISSRLSKLELYCYNLDKSI  116



>gb|KEH39132.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=480

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +2

Query  461  LSSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVI-DAVEKSMKKYADNLMRFLE  637
            +S+K    Q+FH SRM ++S  P +AY  PE  S +Q+VI   VEKSMK   D+LMRFLE
Sbjct  14   ISTKFTFLQDFHISRMVKTSTFPATAYNSPE-VSLSQEVIATTVEKSMKTCTDDLMRFLE  72

Query  638  GLSSRLSQLELYCYNLDKSI  697
            G+SSRLSQLELYCYN+DKSI
Sbjct  73   GISSRLSQLELYCYNIDKSI  92



>ref|XP_008455323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Cucumis melo]
Length=542

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY   EDS   QDVI  VE SMKKY+DN++RFLEG+SSRLSQLEL CYNLDKS+
Sbjct  65   AYGQSEDS-IKQDVISTVENSMKKYSDNILRFLEGISSRLSQLELNCYNLDKSV  117



>ref|XP_004136823.1| PREDICTED: uncharacterized protein LOC101206501 [Cucumis sativus]
 ref|XP_004155475.1| PREDICTED: uncharacterized protein LOC101231301 [Cucumis sativus]
 gb|KGN43615.1| Structural constituent of cell wall [Cucumis sativus]
Length=545

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY   EDS   QDVI  VE SMKKY+DN++RFLEG+SSRLSQLEL CYNLDKS+
Sbjct  65   AYGQSEDS-IKQDVISTVENSMKKYSDNILRFLEGISSRLSQLELNCYNLDKSV  117



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+
Sbjct  67   AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSM  119



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+
Sbjct  66   AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSM  118



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+
Sbjct  66   AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSM  118



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+
Sbjct  67   AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSM  119



>dbj|BAK01177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +DS   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  64   QDSYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  112



>gb|EMS50510.1| hypothetical protein TRIUR3_23019 [Triticum urartu]
Length=606

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +DS   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  64   QDSYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  112



>gb|KJB77274.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=461

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  599  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI
Sbjct  1    MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  33



>gb|KEH39131.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=500

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQ  661
            ++FH SRM ++S  P +AY  PE  S +Q+VI   VEKSMK   D+LMRFLEG+SSRLSQ
Sbjct  42   KDFHISRMVKTSTFPATAYNSPE-VSLSQEVIATTVEKSMKTCTDDLMRFLEGISSRLSQ  100

Query  662  LELYCYNLDKSI  697
            LELYCYN+DKSI
Sbjct  101  LELYCYNIDKSI  112



>ref|XP_002458505.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
 gb|EES03625.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
Length=587

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  66   QESYGKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  114



>ref|XP_004969990.1| PREDICTED: trithorax group protein osa-like [Setaria italica]
Length=590

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  66   QESYSKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  114



>ref|XP_008655245.1| PREDICTED: uncharacterized protein LOC100383096 isoform X1 [Zea 
mays]
 gb|AFW85062.1| putative DUF1421 domain family protein [Zea mays]
Length=584

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  62   QESYGKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  110



>gb|EMT05386.1| hypothetical protein F775_26441 [Aegilops tauschii]
Length=606

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  64   QESYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  112



>emb|CDM84126.1| unnamed protein product [Triticum aestivum]
Length=603

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  64   QESYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  112



>ref|XP_008810226.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
 ref|XP_008810227.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
Length=493

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            VI AVEK MKKYADNL+R+LEG+S RLSQLELYCY +++SI
Sbjct  49   VICAVEKCMKKYADNLLRYLEGISGRLSQLELYCYKIERSI  89



>ref|XP_008810225.1| PREDICTED: ataxin-2 homolog isoform X1 [Phoenix dactylifera]
Length=516

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            VI AVEK MKKYADNL+R+LEG+S RLSQLELYCY +++SI
Sbjct  72   VICAVEKCMKKYADNLLRYLEGISGRLSQLELYCYKIERSI  112



>ref|XP_006644725.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Oryza brachyantha]
Length=586

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++S+
Sbjct  60   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSM  108



>ref|XP_006644724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Oryza brachyantha]
Length=587

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++S+
Sbjct  61   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSM  109



>ref|XP_010924425.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Elaeis guineensis]
Length=517

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  569  QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +++I AVEK MKKYADNL++FLEG+S RLSQLELYCY +++S+
Sbjct  70   EEMISAVEKCMKKYADNLLQFLEGISGRLSQLELYCYKIERSL  112



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            VI AVEK MKKYADNL+R LEG+S RLSQLELYC+ +++SI
Sbjct  45   VIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSI  85



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            VI AVEK MKKYADNL+R LEG+S RLSQLELYC+ +++SI
Sbjct  72   VIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSI  112



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG+++RLSQLE+YCY L++S+
Sbjct  61   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSM  109



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   +DV+ AVEK MKKYADNL+R LEG+++RLSQLE+YCY L++S+
Sbjct  60   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSM  108



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  569  QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +++I AVEK MKKYADN++RFLEG+S RLSQL+L+CY +++SI
Sbjct  68   EEMIAAVEKCMKKYADNVLRFLEGISGRLSQLDLHCYKIERSI  110



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  569  QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +D+I AVEK MKKYADNL+R L+G+S RLSQLE++CY L++S+
Sbjct  71   EDIISAVEKCMKKYADNLLRSLDGISGRLSQLEIFCYKLERSL  113



>gb|KCW89535.1| hypothetical protein EUGRSUZ_A01820 [Eucalyptus grandis]
Length=471

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  599  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            MK+  D++MRFLEG+SSRLSQLELYCYNLDKSI
Sbjct  1    MKRNTDSIMRFLEGISSRLSQLELYCYNLDKSI  33



>ref|NP_001169238.1| uncharacterized protein LOC100383096 [Zea mays]
 gb|ACN32051.1| unknown [Zea mays]
Length=507

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  599  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            MKKYADNL+R LEG++SRLSQLE+YCY L++SI
Sbjct  1    MKKYADNLLRSLEGITSRLSQLEIYCYKLERSI  33



>gb|ACN28687.1| unknown [Zea mays]
 tpg|DAA58179.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=118

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  536  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SI
Sbjct  10   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSI  65



>tpg|DAA58176.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=157

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  536  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SI
Sbjct  49   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSI  104



>tpg|DAA58177.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=154

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  536  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SI
Sbjct  46   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSI  101



>ref|XP_006844887.1| hypothetical protein AMTR_s00058p00125550 [Amborella trichopoda]
 gb|ERN06562.1| hypothetical protein AMTR_s00058p00125550 [Amborella trichopoda]
Length=532

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++  FN +VI  VEK+MKK  D L+ F+EG+S R+SQ+E YC N+++SI
Sbjct  24   QNEDFNVEVITTVEKTMKKCMDTLLCFIEGISGRMSQMESYCCNIERSI  72



>gb|AFW79145.1| putative DUF1421 domain family protein [Zea mays]
Length=521

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SI
Sbjct  56   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSI  96



>gb|EEE55398.1| hypothetical protein OsJ_03493 [Oryza sativa Japonica Group]
Length=371

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  599  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            MKKYADNL+R LEG+++RLSQLE+YCY L++S+
Sbjct  1    MKKYADNLLRSLEGITNRLSQLEIYCYKLERSM  33



>ref|XP_002440244.1| hypothetical protein SORBIDRAFT_09g028390 [Sorghum bicolor]
 gb|EES18674.1| hypothetical protein SORBIDRAFT_09g028390 [Sorghum bicolor]
Length=519

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SI
Sbjct  59   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSI  99



>ref|NP_001143126.1| uncharacterized protein LOC100275604 [Zea mays]
 gb|ACG29188.1| hypothetical protein [Zea mays]
Length=521

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SI
Sbjct  56   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSI  96



>ref|XP_010232129.1| PREDICTED: uncharacterized protein LOC100831431 [Brachypodium 
distachyon]
Length=538

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V+ AVE+ MKK AD L+  LEG+  RLSQLELYCY L++SI
Sbjct  61   VMAAVEECMKKQADGLLHSLEGIGGRLSQLELYCYKLERSI  101



>tpg|DAA58178.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=495

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  536  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SI
Sbjct  10   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSI  65



>ref|NP_001266367.1| uncharacterized protein LOC101202710 [Zea mays]
 gb|ACN35148.1| unknown [Zea mays]
Length=531

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  536  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SI
Sbjct  46   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSI  101



>gb|ACN33301.1| unknown [Zea mays]
 tpg|DAA58175.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=534

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  536  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SI
Sbjct  49   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSI  104



>ref|XP_004961233.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X2 [Setaria italica]
 ref|XP_004961234.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X3 [Setaria italica]
Length=484

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V +A+E  MKK ADNL+  LE +S RLSQLELYCY L++SI
Sbjct  17   VTEAIENCMKKQADNLLNSLEVISGRLSQLELYCYKLERSI  57



>ref|XP_004961232.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X1 [Setaria italica]
Length=526

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V +A+E  MKK ADNL+  LE +S RLSQLELYCY L++SI
Sbjct  59   VTEAIENCMKKQADNLLNSLEVISGRLSQLELYCYKLERSI  99



>gb|EAY75332.1| hypothetical protein OsI_03225 [Oryza sativa Indica Group]
Length=540

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            ++S   + V+ AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SI
Sbjct  56   QESYTKEAVMAAVEECMKKQAEGLLHSLEGIGGRLSQLELYCYKLERSI  104



>ref|XP_003568842.1| PREDICTED: zyxin-like [Brachypodium distachyon]
Length=573

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+FN   I  ++++MKKYADNL+  LEG+SSRLSQLE   ++L+ S+
Sbjct  132  ERSNFNAVTIADIDRTMKKYADNLLNALEGVSSRLSQLEGRTHHLEDSV  180



>gb|EAZ13051.1| hypothetical protein OsJ_02970 [Oryza sativa Japonica Group]
Length=540

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V+ AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SI
Sbjct  64   VMAAVEECMKKQAEGLLHSLEGIGGRLSQLELYCYKLERSI  104



>ref|XP_006644504.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Oryza brachyantha]
Length=477

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  578  IDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            + AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SI
Sbjct  1    MAAVEECMKKQAEGLLHLLEGIGGRLSQLELYCYKLERSI  40



>gb|EAY99014.1| hypothetical protein OsI_20972 [Oryza sativa Indica Group]
Length=518

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  551  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E  ++++++I +A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SI
Sbjct  50   EQETYSREIITEAIESCMKKQADNLVNTLDVISGRLSQLELYCYKLERSI  99



>gb|AAU10648.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH00945.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64682.1| hypothetical protein OsJ_19537 [Oryza sativa Japonica Group]
Length=518

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  551  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E  ++++++I +A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SI
Sbjct  50   EQETYSREIITEAIESCMKKQADNLVNTLDVISGRLSQLELYCYKLERSI  99



>dbj|BAK01901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+FN   I  ++++MKKYADNL+  LEG+SSRL+QLE   ++L+ S+
Sbjct  123  ERSNFNAVTIADIDRTMKKYADNLLHALEGVSSRLAQLEGRTHHLEDSV  171



>gb|EMT01630.1| hypothetical protein F775_09697 [Aegilops tauschii]
Length=574

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+FN   I  ++++MKKYADNL+  +EG+SSRL+QLE   ++L+ S+
Sbjct  125  ERSNFNAVTIADIDRTMKKYADNLLHAMEGVSSRLAQLEGRTHHLEDSV  173



>dbj|BAJ94416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V+ AVE+ M+K A+ L+  LEG+  RLSQLELYCY L++SI
Sbjct  61   VMAAVEECMRKQAEGLLHSLEGIGGRLSQLELYCYKLERSI  101



>ref|XP_004960805.1| PREDICTED: protein diaphanous homolog 1-like [Setaria italica]
Length=568

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+F+   I  ++++MKKYADNL+  LEG+SSRLSQLE   Y+L+ S+
Sbjct  118  ERSNFSAVTIVDIDRTMKKYADNLLHALEGVSSRLSQLEDRTYHLENSV  166



>ref|XP_002458299.1| hypothetical protein SORBIDRAFT_03g030820 [Sorghum bicolor]
 gb|EES03419.1| hypothetical protein SORBIDRAFT_03g030820 [Sorghum bicolor]
Length=538

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SI
Sbjct  67   VMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSI  107



>ref|NP_001142422.1| putative DUF1421 domain family protein [Zea mays]
 gb|ACF88458.1| unknown [Zea mays]
 gb|ACN25356.1| unknown [Zea mays]
 gb|AFW81113.1| putative DUF1421 domain family protein [Zea mays]
Length=518

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SI
Sbjct  59   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSI  99



>ref|XP_008654665.1| PREDICTED: putative DUF1421 domain family protein isoform X2 
[Zea mays]
Length=495

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SI
Sbjct  36   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSI  76



>ref|XP_008654664.1| PREDICTED: putative DUF1421 domain family protein isoform X1 
[Zea mays]
Length=539

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SI
Sbjct  80   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSI  120



>ref|XP_006655586.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like, 
partial [Oryza brachyantha]
Length=512

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  551  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E  ++++++I +A+E  MKK A+NL+  L+ +S RLSQLELYCY L++SI
Sbjct  45   EQETYSREIITEAIENCMKKQAENLVNTLDVISGRLSQLELYCYKLERSI  94



>emb|CDM83294.1| unnamed protein product [Triticum aestivum]
Length=475

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  578  IDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            + AVE+ M+K A+ L+  LEG+  RLSQLELYCY L++SI
Sbjct  1    MAAVEECMRKQAEGLLHSLEGIGGRLSQLELYCYKLERSI  40



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  548  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            P ++S +  ++  ++++MKKYADNLM  L+G+S+RLSQLE    NL+ S+
Sbjct  120  PVNASLDVSLVSEIDRTMKKYADNLMHTLDGVSARLSQLETRSRNLENSM  169



>gb|EMS54596.1| Tryptophan aminotransferase 1 [Triticum urartu]
Length=891

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+FN   I  ++++MKKYADNL+  +EG+SSRL+QLE   ++L+ S+
Sbjct  89   ERSNFNAVTIADIDRTMKKYADNLLHAMEGVSSRLAQLEGRTHHLEDSV  137



>emb|CBI34879.3| unnamed protein product [Vitis vinifera]
Length=465

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +D + +  ++  ++++MKK+ADNL+  LEGLS+RL+QLE    NL+ S+
Sbjct  112  KDRNIDAAIVSEIDRTMKKHADNLLHVLEGLSARLTQLESRTRNLENSV  160



>ref|XP_002440684.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
 gb|EES19114.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
Length=582

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+F+   I  ++++MKKYADNL+  LE +SSRLSQLE   Y+L+ S+
Sbjct  133  ERSNFSAVTIADIDRTMKKYADNLLHALESVSSRLSQLEDRTYHLENSV  181



>ref|XP_002275607.1| PREDICTED: protein enabled [Vitis vinifera]
Length=563

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +D + +  ++  ++++MKK+ADNL+  LEGLS+RL+QLE    NL+ S+
Sbjct  112  KDRNIDAAIVSEIDRTMKKHADNLLHVLEGLSARLTQLESRTRNLENSV  160



>ref|XP_002985569.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
 gb|EFJ13443.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
Length=538

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 5/47 (11%)
 Frame = +2

Query  563  FNQDVID-----AVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  688
            F++D  D     AVE++MKKYADNL+R LEG+  RLSQLE     L+
Sbjct  113  FDKDAYDSATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLE  159



>ref|XP_002987005.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
 gb|EFJ11848.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
Length=548

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 5/47 (11%)
 Frame = +2

Query  563  FNQDVID-----AVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  688
            F++D  D     AVE++MKKYADNL+R LEG+  RLSQLE     L+
Sbjct  113  FDKDAYDSATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLE  159



>ref|XP_003567907.1| PREDICTED: transcriptional regulator DEF1-like [Brachypodium 
distachyon]
Length=536

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            + +A+E  MKK A+NL+  L+ +S RLSQLELYCY L++SI
Sbjct  57   ITEAIEDCMKKQAENLVNSLDVISGRLSQLELYCYKLERSI  97



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+ +   I  ++++MKKYADNL+  LEG+SSRLSQLE   ++L+ S+
Sbjct  47   ERSNLSAVSIADIDRTMKKYADNLLHALEGVSSRLSQLEGRTHHLENSV  95



>ref|XP_008666394.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26 [Zea mays]
Length=340

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V  A+E  MKK ADNL+  L+ ++ RLSQLELYCY L++SI
Sbjct  45   VTHAIESCMKKQADNLLNSLDVINGRLSQLELYCYILERSI  85



>ref|XP_008784980.1| PREDICTED: uncharacterized protein LOC103703781 [Phoenix dactylifera]
Length=875

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+++   +  +++++KKYADNL+R LEG+SSRL QLE   ++L+ S+
Sbjct  104  EKSAYDAATVAEIDRTVKKYADNLLRTLEGVSSRLMQLESRTHHLESSV  152



>tpg|DAA47389.1| TPA: hypothetical protein ZEAMMB73_495059 [Zea mays]
Length=274

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V  A+E  MKK ADNL+  L+ ++ RLSQLELYCY L++SI
Sbjct  127  VTHAIESCMKKQADNLLNSLDVINGRLSQLELYCYILERSI  167



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            S+F    +  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+
Sbjct  125  SNFGAVTMADIDRTMKKYSDNLLHALEGVSSRLSQLEGQTHHLENSV  171



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+++   +  V++++KKYADNL+  LEG+SSRL++LE   + L+ S+
Sbjct  103  EKSAYDAATVAEVDRTVKKYADNLLHALEGVSSRLTELESRAHQLESSV  151



>ref|XP_010908580.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Elaeis guineensis]
Length=523

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            E S+++   +  ++ ++KKYADNL+  LEG+SSRL+QLE   ++L+ S+
Sbjct  104  EKSAYDAATVAEIDHTVKKYADNLLHTLEGVSSRLTQLESRTHHLESSV  152



>gb|EMS64546.1| hypothetical protein TRIUR3_27252 [Triticum urartu]
Length=656

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +D+   + + +A+E  M K A+NL+  L+ +S RLSQLELYCY L++SI
Sbjct  176  QDNHSKEIITEAIESCMNKQAENLVNSLDVISGRLSQLELYCYKLERSI  224



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  551  EDSSFNQDVIDA-VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            + SSF+   I A ++K+MKK+ADNL+  L+G+S+RL+QLE    NL+ S+
Sbjct  125  DQSSFDSSTIMAEIDKTMKKHADNLLHVLDGVSARLTQLESRTRNLENSV  174



>emb|CAN60421.1| hypothetical protein VITISV_021069 [Vitis vinifera]
Length=604

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            +D + +  ++  ++++MKK ADNL+  LEGLS+RL+QLE    NL+ S+
Sbjct  101  KDRNIDAAIVSEIDRTMKKXADNLLHXLEGLSARLTQLESRTRNLENSV  149



>dbj|BAJ85240.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=575

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            + +A+E  M K A+NL+  L+ +S RLSQLELYCY L++SI
Sbjct  102  ITEAIESCMNKQAENLVNSLDVISGRLSQLELYCYKLERSI  142



>ref|XP_002524656.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF37675.1| DNA binding protein, putative [Ricinus communis]
Length=568

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            S+F+  ++  ++K+MKK+ DNL+  LEG+S+RL+QLE+    L+ S+
Sbjct  144  SAFDAAIVSEIDKTMKKHTDNLLHLLEGVSARLTQLEIRSRCLENSV  190



>ref|XP_008656735.1| PREDICTED: chromatin modification-related protein eaf-1-like 
isoform X2 [Zea mays]
Length=682

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SI
Sbjct  184  VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSI  224



>ref|XP_008656734.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Zea mays]
Length=689

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SI
Sbjct  184  VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSI  224



>gb|AFW83522.1| putative DUF1421 domain family protein [Zea mays]
Length=578

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSI  697
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SI
Sbjct  73   VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSI  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320