BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048P17

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615007.1|  PREDICTED: probable metal-nicotianamine tran...    266   7e-81   Nicotiana tomentosiformis
ref|XP_009794095.1|  PREDICTED: probable metal-nicotianamine tran...    265   1e-80   Nicotiana sylvestris
ref|XP_006363210.1|  PREDICTED: probable metal-nicotianamine tran...    265   3e-80   Solanum tuberosum [potatoes]
ref|XP_004233770.1|  PREDICTED: probable metal-nicotianamine tran...    262   4e-79   Solanum lycopersicum
ref|XP_009593058.1|  PREDICTED: probable metal-nicotianamine tran...    262   5e-79   Nicotiana tomentosiformis
ref|XP_006343309.1|  PREDICTED: probable metal-nicotianamine tran...    261   6e-79   Solanum tuberosum [potatoes]
ref|XP_009798435.1|  PREDICTED: probable metal-nicotianamine tran...    261   1e-78   Nicotiana sylvestris
gb|KDP27275.1|  hypothetical protein JCGZ_21006                         259   4e-78   Jatropha curcas
ref|XP_011097988.1|  PREDICTED: probable metal-nicotianamine tran...    258   8e-78   Sesamum indicum [beniseed]
ref|XP_002525883.1|  oligopeptide transporter, putative                 258   1e-77   Ricinus communis
gb|EYU25678.1|  hypothetical protein MIMGU_mgv1a002252mg                258   1e-77   Erythranthe guttata [common monkey flower]
gb|EPS73705.1|  hypothetical protein M569_01043                         258   1e-77   Genlisea aurea
ref|XP_004234495.1|  PREDICTED: probable metal-nicotianamine tran...    256   8e-77   Solanum lycopersicum
ref|XP_002266657.1|  PREDICTED: probable metal-nicotianamine tran...    256   1e-76   Vitis vinifera
ref|XP_010245490.1|  PREDICTED: probable metal-nicotianamine tran...    249   4e-76   Nelumbo nucifera [Indian lotus]
ref|XP_011046072.1|  PREDICTED: probable metal-nicotianamine tran...    253   9e-76   Populus euphratica
ref|XP_011046075.1|  PREDICTED: probable metal-nicotianamine tran...    253   1e-75   Populus euphratica
ref|XP_002269277.1|  PREDICTED: probable metal-nicotianamine tran...    253   1e-75   Vitis vinifera
ref|XP_011046073.1|  PREDICTED: probable metal-nicotianamine tran...    251   7e-75   Populus euphratica
ref|XP_011016255.1|  PREDICTED: probable metal-nicotianamine tran...    245   8e-75   Populus euphratica
ref|XP_006391519.1|  hypothetical protein EUTSA_v10018216mg             250   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_006372621.1|  hypothetical protein POPTR_0017s03320g             249   4e-74   
ref|XP_006372622.1|  iron transporter-related family protein            248   5e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010112419.1|  putative metal-nicotianamine transporter YSL7      248   5e-74   Morus notabilis
ref|XP_011046074.1|  PREDICTED: probable metal-nicotianamine tran...    248   6e-74   Populus euphratica
gb|ABB76761.1|  YSL transporter 1                                       248   8e-74   Noccaea caerulescens
gb|KFK41018.1|  hypothetical protein AALP_AA2G074700                    248   1e-73   Arabis alpina [alpine rockcress]
ref|XP_006847870.1|  hypothetical protein AMTR_s00029p00090040          235   1e-73   
ref|XP_002886962.1|  hypothetical protein ARALYDRAFT_475677             246   2e-73   
ref|XP_002269403.1|  PREDICTED: probable metal-nicotianamine tran...    246   3e-73   Vitis vinifera
ref|XP_010940334.1|  PREDICTED: probable metal-nicotianamine tran...    246   3e-73   Elaeis guineensis
ref|XP_006372353.1|  hypothetical protein POPTR_0017s00810g             245   7e-73   
ref|XP_006372354.1|  hypothetical protein POPTR_0017s00810g             245   9e-73   
ref|NP_176750.1|  putative metal-nicotianamine transporter YSL7         245   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029356.1|  YELLOW STRIPE like 5                               244   1e-72   
ref|XP_011046070.1|  PREDICTED: probable metal-nicotianamine tran...    244   2e-72   Populus euphratica
gb|KDP45817.1|  hypothetical protein JCGZ_17424                         244   2e-72   Jatropha curcas
ref|XP_011035386.1|  PREDICTED: probable metal-nicotianamine tran...    243   3e-72   Populus euphratica
ref|XP_010511122.1|  PREDICTED: probable metal-nicotianamine tran...    243   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008441625.1|  PREDICTED: probable metal-nicotianamine tran...    243   5e-72   Cucumis melo [Oriental melon]
ref|XP_009105166.1|  PREDICTED: probable metal-nicotianamine tran...    243   5e-72   Brassica rapa
gb|ACD77012.1|  metal transporter protein                               243   5e-72   Brassica juncea [brown mustard]
ref|XP_010069525.1|  PREDICTED: probable metal-nicotianamine tran...    243   5e-72   Eucalyptus grandis [rose gum]
ref|XP_002279707.1|  PREDICTED: probable metal-nicotianamine tran...    243   6e-72   Vitis vinifera
ref|XP_010470452.1|  PREDICTED: probable metal-nicotianamine tran...    242   1e-71   Camelina sativa [gold-of-pleasure]
gb|KFK39092.1|  hypothetical protein AALP_AA3G199800                    242   1e-71   Arabis alpina [alpine rockcress]
emb|CDY39272.1|  BnaC06g27190D                                          241   2e-71   Brassica napus [oilseed rape]
ref|XP_002305689.1|  hypothetical protein POPTR_0004s06790g             241   2e-71   
ref|XP_002277292.1|  PREDICTED: probable metal-nicotianamine tran...    242   2e-71   Vitis vinifera
ref|XP_010025985.1|  PREDICTED: probable metal-nicotianamine tran...    243   2e-71   
ref|XP_002510093.1|  oligopeptide transporter, putative                 241   2e-71   Ricinus communis
gb|KCW48664.1|  hypothetical protein EUGRSUZ_K02319                     238   3e-71   Eucalyptus grandis [rose gum]
ref|XP_004158540.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    241   4e-71   
ref|XP_004138807.1|  PREDICTED: probable metal-nicotianamine tran...    241   4e-71   Cucumis sativus [cucumbers]
gb|KDP41617.1|  hypothetical protein JCGZ_16024                         241   4e-71   Jatropha curcas
gb|KCW48659.1|  hypothetical protein EUGRSUZ_K02315                     237   5e-71   Eucalyptus grandis [rose gum]
ref|XP_011072072.1|  PREDICTED: probable metal-nicotianamine tran...    241   5e-71   Sesamum indicum [beniseed]
emb|CDY46890.1|  BnaA01g27900D                                          241   5e-71   Brassica napus [oilseed rape]
ref|XP_009113863.1|  PREDICTED: probable metal-nicotianamine tran...    241   5e-71   Brassica rapa
ref|XP_010528609.1|  PREDICTED: probable metal-nicotianamine tran...    240   7e-71   Tarenaya hassleriana [spider flower]
ref|XP_008779631.1|  PREDICTED: probable metal-nicotianamine tran...    229   9e-71   
ref|XP_006406708.1|  hypothetical protein EUTSA_v10020160mg             240   1e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010037025.1|  PREDICTED: probable metal-nicotianamine tran...    239   1e-70   Eucalyptus grandis [rose gum]
ref|XP_009135543.1|  PREDICTED: probable metal-nicotianamine tran...    239   2e-70   Brassica rapa
ref|XP_002891428.1|  hypothetical protein ARALYDRAFT_473974             239   2e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_006300806.1|  hypothetical protein CARUB_v10019889mg             239   2e-70   Capsella rubella
emb|CAN72423.1|  hypothetical protein VITISV_014262                     238   2e-70   Vitis vinifera
ref|XP_010943908.1|  PREDICTED: probable metal-nicotianamine tran...    239   2e-70   Elaeis guineensis
gb|KHG02257.1|  putative metal-nicotianamine transporter YSL5 -li...    238   3e-70   Gossypium arboreum [tree cotton]
ref|XP_010487657.1|  PREDICTED: probable metal-nicotianamine tran...    239   3e-70   Camelina sativa [gold-of-pleasure]
emb|CDY68937.1|  BnaCnng61140D                                          239   3e-70   Brassica napus [oilseed rape]
gb|KCW57904.1|  hypothetical protein EUGRSUZ_H00651                     238   3e-70   Eucalyptus grandis [rose gum]
gb|KJB26835.1|  hypothetical protein B456_004G262100                    238   3e-70   Gossypium raimondii
gb|KJB75155.1|  hypothetical protein B456_012G027400                    238   3e-70   Gossypium raimondii
ref|XP_010039025.1|  PREDICTED: probable metal-nicotianamine tran...    238   4e-70   Eucalyptus grandis [rose gum]
ref|XP_010037024.1|  PREDICTED: probable metal-nicotianamine tran...    238   4e-70   Eucalyptus grandis [rose gum]
ref|XP_003548294.1|  PREDICTED: probable metal-nicotianamine tran...    238   4e-70   Glycine max [soybeans]
ref|XP_010037026.1|  PREDICTED: probable metal-nicotianamine tran...    238   5e-70   Eucalyptus grandis [rose gum]
ref|XP_010551587.1|  PREDICTED: probable metal-nicotianamine tran...    238   6e-70   Tarenaya hassleriana [spider flower]
ref|XP_007211297.1|  hypothetical protein PRUPE_ppa001999mg             238   7e-70   Prunus persica
emb|CDY46051.1|  BnaC01g34980D                                          240   7e-70   Brassica napus [oilseed rape]
gb|ABB76762.1|  YSL transporter 2                                       238   8e-70   Noccaea caerulescens
ref|XP_003533289.1|  PREDICTED: probable metal-nicotianamine tran...    237   9e-70   Glycine max [soybeans]
ref|XP_010551578.1|  PREDICTED: probable metal-nicotianamine tran...    236   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_004953195.1|  PREDICTED: probable metal-nicotianamine tran...    237   1e-69   Setaria italica
ref|XP_007152542.1|  hypothetical protein PHAVU_004G138900g             236   2e-69   Phaseolus vulgaris [French bean]
ref|XP_010465820.1|  PREDICTED: probable metal-nicotianamine tran...    237   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010505667.1|  PREDICTED: probable metal-nicotianamine tran...    237   2e-69   Camelina sativa [gold-of-pleasure]
ref|NP_564525.1|  metal-nicotianamine transporter YSL8                  237   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185468.1|  yellow stripe-like transporter 12                  237   2e-69   Zea mays [maize]
ref|XP_004976283.1|  PREDICTED: probable metal-nicotianamine tran...    236   2e-69   Setaria italica
ref|XP_006393421.1|  hypothetical protein EUTSA_v10011269mg             236   3e-69   Eutrema salsugineum [saltwater cress]
ref|XP_006297072.1|  hypothetical protein CARUB_v10013074mg             236   4e-69   Capsella rubella
ref|NP_566584.1|  putative metal-nicotianamine transporter YSL5         236   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549024.1|  PREDICTED: probable metal-nicotianamine tran...    235   5e-69   Tarenaya hassleriana [spider flower]
ref|XP_008436975.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    235   5e-69   
ref|XP_002446809.1|  hypothetical protein SORBIDRAFT_06g023010          236   5e-69   Sorghum bicolor [broomcorn]
ref|XP_011035385.1|  PREDICTED: probable metal-nicotianamine tran...    235   5e-69   Populus euphratica
ref|XP_004515282.1|  PREDICTED: probable metal-nicotianamine tran...    235   6e-69   Cicer arietinum [garbanzo]
ref|XP_002883075.1|  hypothetical protein ARALYDRAFT_479246             235   6e-69   
ref|XP_003580167.1|  PREDICTED: probable metal-nicotianamine tran...    235   8e-69   Brachypodium distachyon [annual false brome]
gb|KGN64213.1|  hypothetical protein Csa_1G043160                       234   9e-69   Cucumis sativus [cucumbers]
ref|XP_004165464.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    234   9e-69   
gb|AAS00697.1|  metal-nicotianamine transporter YSL8                    235   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420946.1|  PREDICTED: probable metal-nicotianamine tran...    234   1e-68   
ref|XP_004137637.1|  PREDICTED: probable metal-nicotianamine tran...    234   1e-68   
ref|XP_009107360.1|  PREDICTED: probable metal-nicotianamine tran...    234   2e-68   Brassica rapa
ref|XP_006441429.1|  hypothetical protein CICLE_v10019091mg             234   2e-68   Citrus clementina [clementine]
gb|KFK36098.1|  hypothetical protein AALP_AA4G077100                    234   2e-68   Arabis alpina [alpine rockcress]
ref|XP_010501891.1|  PREDICTED: probable metal-nicotianamine tran...    232   3e-68   
ref|XP_003620154.1|  Yellow stripe-like protein 2.1                     233   3e-68   Medicago truncatula
ref|XP_007210334.1|  hypothetical protein PRUPE_ppa002002mg             233   4e-68   Prunus persica
ref|XP_010933277.1|  PREDICTED: probable metal-nicotianamine tran...    233   5e-68   
dbj|BAE44205.1|  hypothetical protein                                   233   6e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653608.1|  PREDICTED: probable metal-nicotianamine tran...    232   6e-68   
ref|XP_008801345.1|  PREDICTED: probable metal-nicotianamine tran...    233   8e-68   Phoenix dactylifera
sp|Q5JQD7.2|YSL12_ORYSJ  RecName: Full=Probable metal-nicotianami...    232   9e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648859.1|  PREDICTED: probable metal-nicotianamine tran...    232   9e-68   Oryza brachyantha
gb|AAL09744.1|  AT3g17650/MKP6_20                                       232   9e-68   Arabidopsis thaliana [mouse-ear cress]
sp|Q6H7J6.1|YSL14_ORYSJ  RecName: Full=Probable metal-nicotianami...    232   9e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008240337.1|  PREDICTED: probable metal-nicotianamine tran...    232   1e-67   Prunus mume [ume]
gb|AEQ28190.1|  yellow stripe-like protein 5                            232   1e-67   Malus baccata var. xiaojinensis
ref|XP_010461657.1|  PREDICTED: probable metal-nicotianamine tran...    231   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010479258.1|  PREDICTED: probable metal-nicotianamine tran...    231   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_008676713.1|  PREDICTED: uncharacterized protein LOC100272...    231   1e-67   
ref|NP_001152285.1|  yellow stripe-like transporter 14A                 231   1e-67   
gb|KDO46150.1|  hypothetical protein CISIN_1g005295mg                   231   2e-67   Citrus sinensis [apfelsine]
ref|XP_008645969.1|  PREDICTED: probable metal-nicotianamine tran...    231   2e-67   Zea mays [maize]
ref|XP_006306886.1|  hypothetical protein CARUB_v10008440mg             231   2e-67   Capsella rubella
ref|XP_008393519.1|  PREDICTED: probable metal-nicotianamine tran...    230   6e-67   
ref|XP_006493428.1|  PREDICTED: probable metal-nicotianamine tran...    229   8e-67   Citrus sinensis [apfelsine]
gb|AET00398.2|  OPT family oligopeptide transporter                     229   8e-67   Medicago truncatula
ref|XP_009383038.1|  PREDICTED: probable metal-nicotianamine tran...    229   9e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003617439.1|  Yellow stripe-like protein 2.8                     229   9e-67   
ref|XP_010276313.1|  PREDICTED: probable metal-nicotianamine tran...    218   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_008802875.1|  PREDICTED: probable metal-nicotianamine tran...    221   2e-66   Phoenix dactylifera
ref|XP_002520094.1|  oligopeptide transporter, putative                 228   2e-66   Ricinus communis
ref|XP_006653609.1|  PREDICTED: probable metal-nicotianamine tran...    227   3e-66   
ref|NP_001276131.1|  uncharacterized protein LOC100809484               228   3e-66   Glycine max [soybeans]
gb|EMT06635.1|  Putative metal-nicotianamine transporter YSL14          228   3e-66   
ref|XP_002452492.1|  hypothetical protein SORBIDRAFT_04g026840          228   3e-66   
ref|XP_002446810.1|  hypothetical protein SORBIDRAFT_06g023020          228   3e-66   Sorghum bicolor [broomcorn]
ref|XP_004978143.1|  PREDICTED: probable metal-nicotianamine tran...    228   3e-66   Setaria italica
ref|XP_004500424.1|  PREDICTED: probable metal-nicotianamine tran...    227   4e-66   
ref|XP_010666835.1|  PREDICTED: probable metal-nicotianamine tran...    226   8e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002449540.1|  hypothetical protein SORBIDRAFT_05g018520          226   1e-65   Sorghum bicolor [broomcorn]
emb|CAH67887.1|  OSIGBa0153E02-OSIGBa0093I20.16                         226   1e-65   Oryza sativa [red rice]
gb|EMT14396.1|  Putative metal-nicotianamine transporter YSL13          226   1e-65   
ref|NP_001185810.1|  yellow stripe-like transporter 11                  226   2e-65   Zea mays [maize]
sp|Q7X660.1|YSL11_ORYSJ  RecName: Full=Probable metal-nicotianami...    226   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575422.1|  PREDICTED: probable metal-nicotianamine tran...    226   2e-65   Brachypodium distachyon [annual false brome]
ref|XP_009384580.1|  PREDICTED: probable metal-nicotianamine tran...    225   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299460.1|  PREDICTED: probable metal-nicotianamine tran...    225   4e-65   Fragaria vesca subsp. vesca
ref|XP_008669136.1|  PREDICTED: probable metal-nicotianamine tran...    224   6e-65   Zea mays [maize]
dbj|BAE91892.1|  hypothetical protein                                   224   7e-65   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE91891.1|  hypothetical protein                                   224   1e-64   Oryza sativa Japonica Group [Japonica rice]
emb|CAI44637.1|  OSJNBb0065J09.17                                       223   1e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009413131.1|  PREDICTED: probable metal-nicotianamine tran...    223   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675190.1|  PREDICTED: probable metal-nicotianamine tran...    223   2e-64   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ89062.1|  predicted protein                                      222   4e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92335.1|  predicted protein                                      222   4e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAD49762.2|AC007932_10  F11A17.8                                     223   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779403.1|  PREDICTED: probable metal-nicotianamine tran...    221   1e-63   
ref|XP_002448760.1|  hypothetical protein SORBIDRAFT_06g032720          221   1e-63   Sorghum bicolor [broomcorn]
emb|CAN70906.1|  hypothetical protein VITISV_043868                     220   2e-63   Vitis vinifera
emb|CAH67885.1|  OSIGBa0153E02-OSIGBa0093I20.14                         220   3e-63   Oryza sativa [red rice]
ref|XP_007146944.1|  hypothetical protein PHAVU_006G083800g             219   3e-63   Phaseolus vulgaris [French bean]
sp|Q7XKF4.2|YSL13_ORYSJ  RecName: Full=Probable metal-nicotianami...    220   3e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976284.1|  PREDICTED: probable metal-nicotianamine tran...    219   4e-63   Setaria italica
gb|KEH34582.1|  OPT family oligopeptide transporter                     219   4e-63   Medicago truncatula
ref|XP_003581442.1|  PREDICTED: probable metal-nicotianamine tran...    219   4e-63   Brachypodium distachyon [annual false brome]
gb|EMT24509.1|  Putative metal-nicotianamine transporter YSL12          219   5e-63   
gb|KEH34580.1|  OPT family oligopeptide transporter                     219   6e-63   Medicago truncatula
gb|AFW59877.1|  hypothetical protein ZEAMMB73_955581                    215   2e-61   
ref|XP_010032362.1|  PREDICTED: probable metal-nicotianamine tran...    214   2e-61   
ref|XP_010940749.1|  PREDICTED: probable metal-nicotianamine tran...    214   3e-61   
ref|XP_008805741.1|  PREDICTED: probable metal-nicotianamine tran...    213   5e-61   Phoenix dactylifera
sp|Q0J932.2|YSL10_ORYSJ  RecName: Full=Probable metal-nicotianami...    212   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054241.1|  Os04g0674600                                       213   1e-60   
ref|XP_009392235.1|  PREDICTED: probable metal-nicotianamine tran...    212   2e-60   
ref|XP_006653020.1|  PREDICTED: probable metal-nicotianamine tran...    212   2e-60   Oryza brachyantha
emb|CBG76262.1|  OO_Ba0005L10-OO_Ba0081K17.13                           211   3e-60   Oryza officinalis
gb|EMT24510.1|  Putative metal-nicotianamine transporter YSL13          211   6e-60   
ref|XP_008441627.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    209   7e-60   Cucumis melo [Oriental melon]
ref|XP_011072202.1|  PREDICTED: probable metal-nicotianamine tran...    210   1e-59   Sesamum indicum [beniseed]
emb|CDP01725.1|  unnamed protein product                                196   2e-58   Coffea canephora [robusta coffee]
ref|XP_008461864.1|  PREDICTED: probable metal-nicotianamine tran...    206   3e-58   Cucumis melo [Oriental melon]
emb|CAJ86097.1|  H0103C06.1                                             206   3e-58   Oryza sativa [red rice]
emb|CAE03239.2|  OSJNBa0018M05.14                                       206   5e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148573.1|  PREDICTED: probable metal-nicotianamine tran...    205   7e-58   Cucumis sativus [cucumbers]
ref|XP_004163304.1|  PREDICTED: probable metal-nicotianamine tran...    204   9e-58   
ref|XP_007043321.1|  YELLOW STRIPE like 7                               202   1e-56   
ref|XP_006484556.1|  PREDICTED: probable metal-nicotianamine tran...    201   1e-56   
gb|KDO52778.1|  hypothetical protein CISIN_1g044922mg                   201   2e-56   Citrus sinensis [apfelsine]
ref|XP_008663726.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    201   2e-56   
ref|XP_006484586.1|  PREDICTED: probable metal-nicotianamine tran...    201   2e-56   
ref|XP_006437555.1|  hypothetical protein CICLE_v10030879mg             201   2e-56   Citrus clementina [clementine]
ref|XP_009402082.1|  PREDICTED: probable metal-nicotianamine tran...    201   2e-56   
ref|XP_006437556.1|  hypothetical protein CICLE_v10030844mg             201   2e-56   Citrus clementina [clementine]
ref|XP_008340452.1|  PREDICTED: probable metal-nicotianamine tran...    201   3e-56   Malus domestica [apple tree]
gb|KHG05118.1|  putative metal-nicotianamine transporter YSL7 -li...    200   4e-56   Gossypium arboreum [tree cotton]
ref|XP_009592956.1|  PREDICTED: probable metal-nicotianamine tran...    194   6e-56   Nicotiana tomentosiformis
ref|XP_002446812.1|  hypothetical protein SORBIDRAFT_06g023040          200   8e-56   
gb|KJB79884.1|  hypothetical protein B456_013G070800                    199   9e-56   Gossypium raimondii
ref|XP_011463452.1|  PREDICTED: probable metal-nicotianamine tran...    199   1e-55   Fragaria vesca subsp. vesca
gb|EMS55053.1|  putative metal-nicotianamine transporter YSL10          198   2e-55   Triticum urartu
ref|XP_008221041.1|  PREDICTED: probable metal-nicotianamine tran...    198   3e-55   Prunus mume [ume]
gb|EEC78242.1|  hypothetical protein OsI_17899                          197   3e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_002532101.1|  oligopeptide transporter, putative                 197   3e-55   Ricinus communis
emb|CBI35268.3|  unnamed protein product                                195   4e-55   Vitis vinifera
emb|CBI35280.3|  unnamed protein product                                195   4e-55   Vitis vinifera
ref|XP_011022272.1|  PREDICTED: probable metal-nicotianamine tran...    197   6e-55   Populus euphratica
ref|XP_007225160.1|  hypothetical protein PRUPE_ppa002368mg             197   6e-55   
ref|XP_008360015.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    197   8e-55   
ref|XP_010245475.1|  PREDICTED: probable metal-nicotianamine tran...    196   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_009758111.1|  PREDICTED: probable metal-nicotianamine tran...    195   1e-54   Nicotiana sylvestris
ref|XP_009351712.1|  PREDICTED: probable metal-nicotianamine tran...    196   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_004978145.1|  PREDICTED: probable metal-nicotianamine tran...    196   2e-54   
ref|XP_009593227.1|  PREDICTED: probable metal-nicotianamine tran...    195   2e-54   Nicotiana tomentosiformis
gb|KDP43290.1|  hypothetical protein JCGZ_24211                         195   2e-54   Jatropha curcas
ref|XP_002446811.1|  hypothetical protein SORBIDRAFT_06g023030          195   4e-54   
ref|XP_010253872.1|  PREDICTED: probable metal-nicotianamine tran...    194   5e-54   Nelumbo nucifera [Indian lotus]
emb|CBI27128.3|  unnamed protein product                                192   6e-54   Vitis vinifera
ref|XP_002306389.2|  hypothetical protein POPTR_0005s09670g             194   6e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006350378.1|  PREDICTED: probable metal-nicotianamine tran...    194   6e-54   Solanum tuberosum [potatoes]
gb|EYU39420.1|  hypothetical protein MIMGU_mgv1a002450mg                193   9e-54   Erythranthe guttata [common monkey flower]
gb|EPS65244.1|  hypothetical protein M569_09533                         192   1e-53   Genlisea aurea
ref|XP_004978146.1|  PREDICTED: probable metal-nicotianamine tran...    192   3e-53   
gb|KCW65044.1|  hypothetical protein EUGRSUZ_G02568                     192   4e-53   Eucalyptus grandis [rose gum]
ref|XP_009768859.1|  PREDICTED: probable metal-nicotianamine tran...    191   4e-53   Nicotiana sylvestris
ref|XP_004231467.1|  PREDICTED: probable metal-nicotianamine tran...    191   6e-53   Solanum lycopersicum
emb|CDP18194.1|  unnamed protein product                                191   6e-53   Coffea canephora [robusta coffee]
ref|XP_004158539.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    191   6e-53   
gb|AFW58894.1|  hypothetical protein ZEAMMB73_605066                    191   1e-52   
ref|XP_010068802.1|  PREDICTED: probable metal-nicotianamine tran...    191   1e-52   Eucalyptus grandis [rose gum]
emb|CBI27129.3|  unnamed protein product                                187   2e-52   Vitis vinifera
ref|XP_004138639.1|  PREDICTED: probable metal-nicotianamine tran...    189   2e-52   Cucumis sativus [cucumbers]
emb|CDP16865.1|  unnamed protein product                                189   2e-52   Coffea canephora [robusta coffee]
ref|XP_008669135.1|  PREDICTED: probable metal-nicotianamine tran...    190   2e-52   Zea mays [maize]
ref|XP_006359441.1|  PREDICTED: probable metal-nicotianamine tran...    189   4e-52   Solanum tuberosum [potatoes]
emb|CBI35270.3|  unnamed protein product                                187   4e-52   Vitis vinifera
gb|EYU27872.1|  hypothetical protein MIMGU_mgv1a019282mg                189   4e-52   Erythranthe guttata [common monkey flower]
emb|CBI27130.3|  unnamed protein product                                186   5e-52   Vitis vinifera
ref|XP_010249085.1|  PREDICTED: probable metal-nicotianamine tran...    187   1e-51   Nelumbo nucifera [Indian lotus]
gb|EEE57430.1|  hypothetical protein OsJ_07631                          187   1e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KJB70679.1|  hypothetical protein B456_011G086700                    187   1e-51   Gossypium raimondii
ref|XP_010556294.1|  PREDICTED: probable metal-nicotianamine tran...    187   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_003549112.1|  PREDICTED: probable metal-nicotianamine tran...    187   1e-51   Glycine max [soybeans]
ref|XP_007161672.1|  hypothetical protein PHAVU_001G088900g             187   2e-51   Phaseolus vulgaris [French bean]
ref|XP_011000961.1|  PREDICTED: probable metal-nicotianamine tran...    186   3e-51   Populus euphratica
ref|XP_004289490.1|  PREDICTED: probable metal-nicotianamine tran...    186   4e-51   Fragaria vesca subsp. vesca
ref|XP_010650300.1|  PREDICTED: probable metal-nicotianamine tran...    186   5e-51   Vitis vinifera
ref|XP_010101178.1|  putative metal-nicotianamine transporter YSL7      185   7e-51   
emb|CDX82356.1|  BnaA03g34650D                                          185   7e-51   
dbj|BAB09702.1|  unnamed protein product                                185   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198916.2|  putative metal-nicotianamine transporter YSL4         185   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003622146.1|  Yellow stripe-like protein 1.1                     185   1e-50   Medicago truncatula
gb|EMT14346.1|  Putative metal-nicotianamine transporter YSL8           185   1e-50   
ref|XP_010913001.1|  PREDICTED: probable metal-nicotianamine tran...    185   1e-50   Elaeis guineensis
gb|KDO63888.1|  hypothetical protein CISIN_1g005868mg                   184   1e-50   Citrus sinensis [apfelsine]
ref|XP_011098915.1|  PREDICTED: probable metal-nicotianamine tran...    184   1e-50   Sesamum indicum [beniseed]
ref|XP_006447029.1|  hypothetical protein CICLE_v10014497mg             184   1e-50   Citrus clementina [clementine]
ref|XP_011098916.1|  PREDICTED: probable metal-nicotianamine tran...    184   1e-50   Sesamum indicum [beniseed]
ref|XP_004514626.1|  PREDICTED: probable metal-nicotianamine tran...    184   2e-50   Cicer arietinum [garbanzo]
ref|XP_006405407.1|  hypothetical protein EUTSA_v10027673mg             184   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_002298639.1|  oligopeptide transporter OPT family protein        184   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009405479.1|  PREDICTED: probable metal-nicotianamine tran...    184   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573299.1|  PREDICTED: probable metal-nicotianamine tran...    184   2e-50   Brachypodium distachyon [annual false brome]
emb|CDO98563.1|  unnamed protein product                                184   2e-50   Coffea canephora [robusta coffee]
ref|XP_006604157.1|  PREDICTED: probable metal-nicotianamine tran...    184   2e-50   Glycine max [soybeans]
ref|XP_009140243.1|  PREDICTED: probable metal-nicotianamine tran...    184   2e-50   Brassica rapa
ref|XP_006844631.1|  hypothetical protein AMTR_s00016p00228960          184   2e-50   
ref|XP_003553947.1|  PREDICTED: probable metal-nicotianamine tran...    184   2e-50   Glycine max [soybeans]
ref|XP_007031922.1|  YELLOW STRIPE like 6                               184   3e-50   
ref|XP_010028979.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   Eucalyptus grandis [rose gum]
ref|XP_006844632.1|  hypothetical protein AMTR_s00016p00229010          175   3e-50   
gb|KHM99726.1|  Putative metal-nicotianamine transporter YSL7           183   3e-50   Glycine soja [wild soybean]
ref|XP_010514385.1|  PREDICTED: probable metal-nicotianamine tran...    183   4e-50   Camelina sativa [gold-of-pleasure]
gb|KDO59686.1|  hypothetical protein CISIN_1g0442262mg                  175   4e-50   Citrus sinensis [apfelsine]
ref|XP_002512907.1|  oligopeptide transporter, putative                 178   4e-50   
ref|XP_010441262.1|  PREDICTED: probable metal-nicotianamine tran...    183   5e-50   
emb|CAN76934.1|  hypothetical protein VITISV_024664                     174   5e-50   
ref|XP_006286072.1|  hypothetical protein CARUB_v10007605mg             183   5e-50   
gb|KFK33623.1|  hypothetical protein AALP_AA5G037700                    182   6e-50   
emb|CDY15924.1|  BnaA04g11870D                                          184   6e-50   
ref|XP_010436040.1|  PREDICTED: probable metal-nicotianamine tran...    182   7e-50   
ref|XP_004148009.1|  PREDICTED: probable metal-nicotianamine tran...    182   7e-50   
ref|XP_002870660.1|  hypothetical protein ARALYDRAFT_493877             182   7e-50   
ref|XP_010112394.1|  putative metal-nicotianamine transporter YSL6      182   7e-50   
gb|ACE77055.2|  yellow stripe-like protein 6.1                          182   7e-50   
ref|XP_004306307.1|  PREDICTED: probable metal-nicotianamine tran...    182   8e-50   
ref|XP_011468195.1|  PREDICTED: probable metal-nicotianamine tran...    182   8e-50   
ref|XP_009111552.1|  PREDICTED: probable metal-nicotianamine tran...    182   8e-50   
ref|XP_001759545.1|  predicted protein                                  182   8e-50   
ref|XP_006395492.1|  hypothetical protein EUTSA_v10003758mg             182   9e-50   
emb|CDY00170.1|  BnaC09g01310D                                          182   1e-49   
ref|XP_007039161.1|  YELLOW STRIPE like 3 isoform 2                     182   1e-49   
ref|XP_007039160.1|  YELLOW STRIPE like 3 isoform 1                     182   1e-49   
ref|XP_010502660.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   
ref|XP_008450132.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   
ref|XP_010425438.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   
ref|XP_010436039.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   
ref|XP_010450578.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   
gb|ACL83357.2|  yellow stripe-like protein 6.4                          182   2e-49   
ref|XP_001751943.1|  predicted protein                                  181   2e-49   
ref|XP_002274559.2|  PREDICTED: probable metal-nicotianamine tran...    181   2e-49   
ref|XP_002877011.1|  hypothetical protein ARALYDRAFT_904909             181   3e-49   
dbj|BAK06445.1|  predicted protein                                      181   3e-49   
gb|AAM64930.1|  unknown                                                 181   3e-49   
ref|XP_010252366.1|  PREDICTED: metal-nicotianamine transporter YSL2    181   3e-49   
ref|NP_566806.1|  putative metal-nicotianamine transporter YSL6         181   3e-49   
gb|AAM53283.1|  unknown protein                                         181   3e-49   
ref|XP_004975420.1|  PREDICTED: probable metal-nicotianamine tran...    181   3e-49   
ref|XP_004954766.1|  PREDICTED: probable metal-nicotianamine tran...    181   3e-49   
gb|AFW66781.1|  hypothetical protein ZEAMMB73_792166                    178   4e-49   
emb|CAN62811.1|  hypothetical protein VITISV_041555                     181   4e-49   
ref|XP_008680017.1|  PREDICTED: probable metal-nicotianamine tran...    180   5e-49   
ref|XP_009613490.1|  PREDICTED: probable metal-nicotianamine tran...    180   5e-49   
gb|AGT16058.1|  metal-nicotianamine transporter                         180   5e-49   
ref|XP_009415879.1|  PREDICTED: probable metal-nicotianamine tran...    181   5e-49   
ref|XP_006290684.1|  hypothetical protein CARUB_v10016778mg             180   5e-49   
ref|XP_009398092.1|  PREDICTED: probable metal-nicotianamine tran...    177   7e-49   
gb|EYU31834.1|  hypothetical protein MIMGU_mgv1a002047mg                180   7e-49   
ref|XP_002453180.1|  hypothetical protein SORBIDRAFT_04g001180          179   9e-49   
ref|XP_009757311.1|  PREDICTED: probable metal-nicotianamine tran...    179   9e-49   
gb|AAS00695.1|  metal-nicotianamine transporter YSL6                    179   1e-48   
ref|XP_010442922.1|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   
emb|CDY20064.1|  BnaA09g01870D                                          181   1e-48   
ref|XP_007153093.1|  hypothetical protein PHAVU_003G006400g             178   1e-48   
gb|KGN63126.1|  hypothetical protein Csa_2G404780                       179   1e-48   
emb|CDP05015.1|  unnamed protein product                                179   1e-48   
ref|XP_003579626.1|  PREDICTED: probable metal-nicotianamine tran...    179   2e-48   
gb|ABB76763.1|  YSL transporter 3                                       178   2e-48   
gb|ABD04075.1|  YSL transporter 3                                       178   2e-48   
ref|XP_009398090.1|  PREDICTED: probable metal-nicotianamine tran...    178   2e-48   
gb|EAY84201.1|  hypothetical protein OsI_05581                          178   2e-48   
dbj|BAB09731.1|  EspB-like protein                                      178   2e-48   
ref|XP_003556608.1|  PREDICTED: probable metal-nicotianamine tran...    178   3e-48   
ref|XP_006423237.1|  hypothetical protein CICLE_v10027961mg             178   3e-48   
ref|XP_003581443.2|  PREDICTED: probable metal-nicotianamine tran...    177   3e-48   
ref|XP_010537055.1|  PREDICTED: metal-nicotianamine transporter Y...    178   3e-48   
ref|XP_010537056.1|  PREDICTED: metal-nicotianamine transporter Y...    178   3e-48   
gb|KHG22766.1|  putative metal-nicotianamine transporter YSL6 -li...    177   3e-48   
ref|NP_200167.2|  metal-nicotianamine transporter YSL3                  178   3e-48   
ref|XP_006487168.1|  PREDICTED: probable metal-nicotianamine tran...    178   3e-48   
dbj|BAE91888.1|  hypothetical protein                                   178   4e-48   
dbj|BAD07718.1|  putative iron-phytosiderophore transporter prote...    178   4e-48   
ref|NP_001131175.1|  hypothetical protein                               177   4e-48   
ref|NP_001045678.1|  Os02g0116400                                       177   4e-48   
ref|XP_002274166.1|  PREDICTED: metal-nicotianamine transporter YSL3    177   6e-48   
ref|XP_010482755.1|  PREDICTED: metal-nicotianamine transporter Y...    177   6e-48   
emb|CBI23058.3|  unnamed protein product                                177   7e-48   
gb|ADN33682.1|  oligopeptide transporter                                166   7e-48   
gb|KJB19873.1|  hypothetical protein B456_003G122700                    177   7e-48   
gb|EAZ30539.1|  hypothetical protein OsJ_14587                          177   8e-48   
ref|XP_004231762.1|  PREDICTED: probable metal-nicotianamine tran...    177   8e-48   
emb|CAN77891.1|  hypothetical protein VITISV_016271                     177   8e-48   
ref|XP_008231092.1|  PREDICTED: probable metal-nicotianamine tran...    177   9e-48   
ref|XP_006338712.1|  PREDICTED: probable metal-nicotianamine tran...    177   9e-48   
ref|XP_010919337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    176   1e-47   
ref|XP_007215002.1|  hypothetical protein PRUPE_ppa002401mg             176   1e-47   
ref|XP_006401691.1|  hypothetical protein EUTSA_v10012886mg             176   1e-47   
ref|XP_006441190.1|  hypothetical protein CICLE_v10019170mg             176   2e-47   
emb|CAN61174.1|  hypothetical protein VITISV_009380                     166   2e-47   
ref|XP_006849121.1|  hypothetical protein AMTR_s00027p00045420          176   2e-47   
ref|XP_006441189.1|  hypothetical protein CICLE_v10019170mg             176   2e-47   
ref|XP_006491948.1|  PREDICTED: metal-nicotianamine transporter Y...    176   2e-47   
ref|XP_006491954.1|  PREDICTED: metal-nicotianamine transporter Y...    176   2e-47   
gb|KDP41791.1|  hypothetical protein JCGZ_26809                         176   2e-47   
emb|CDX80439.1|  BnaC07g30050D                                          169   2e-47   
ref|XP_002446309.1|  hypothetical protein SORBIDRAFT_06g013960          176   2e-47   
gb|EAZ31384.1|  hypothetical protein OsJ_15512                          176   2e-47   
sp|Q7XRV2.1|YSL6_ORYSJ  RecName: Full=Probable metal-nicotianamin...    175   3e-47   
ref|XP_008803948.1|  PREDICTED: probable metal-nicotianamine tran...    175   3e-47   
emb|CAH66436.1|  OSIGBa0132D06.2                                        175   3e-47   
dbj|BAE91886.1|  hypothetical protein                                   175   3e-47   
ref|XP_007153094.1|  hypothetical protein PHAVU_003G006500g             175   4e-47   
ref|XP_006281523.1|  hypothetical protein CARUB_v10027623mg             174   6e-47   
ref|XP_010267463.1|  PREDICTED: metal-nicotianamine transporter Y...    174   7e-47   
gb|KHG05098.1|  Metal-nicotianamine transporter YSL3 -like protein      174   7e-47   
ref|XP_006372356.1|  hypothetical protein POPTR_0017s00820g             174   8e-47   
ref|XP_009346778.1|  PREDICTED: probable metal-nicotianamine tran...    174   8e-47   
ref|XP_009346777.1|  PREDICTED: probable metal-nicotianamine tran...    174   8e-47   
gb|KDP40380.1|  hypothetical protein JCGZ_02378                         174   9e-47   
ref|XP_002528372.1|  oligopeptide transporter, putative                 174   9e-47   
ref|XP_008362099.1|  PREDICTED: probable metal-nicotianamine tran...    174   9e-47   
ref|XP_009344229.1|  PREDICTED: probable metal-nicotianamine tran...    174   1e-46   
ref|XP_009344228.1|  PREDICTED: probable metal-nicotianamine tran...    174   1e-46   
dbj|BAB11231.1|  unnamed protein product                                174   1e-46   
ref|NP_197826.2|  metal-nicotianamine transporter YSL2                  174   1e-46   
ref|XP_006844634.1|  hypothetical protein AMTR_s00016p00229620          174   1e-46   
ref|XP_010445905.1|  PREDICTED: metal-nicotianamine transporter Y...    173   1e-46   
ref|XP_011470188.1|  PREDICTED: metal-nicotianamine transporter Y...    173   1e-46   
ref|XP_006394695.1|  hypothetical protein EUTSA_v10003781mg             173   1e-46   
ref|XP_006845874.1|  hypothetical protein AMTR_s00154p00065510          173   1e-46   
ref|XP_011470187.1|  PREDICTED: metal-nicotianamine transporter Y...    173   1e-46   
ref|XP_006578881.1|  PREDICTED: metal-nicotianamine transporter Y...    170   1e-46   
ref|XP_003579625.1|  PREDICTED: probable metal-nicotianamine tran...    173   2e-46   
ref|XP_006287225.1|  hypothetical protein CARUB_v10000403mg             173   2e-46   
gb|AEQ28191.1|  yellow stripe-like protein 6                            173   2e-46   
gb|KCW83950.1|  hypothetical protein EUGRSUZ_B00835                     172   2e-46   
gb|EYU25659.1|  hypothetical protein MIMGU_mgv1a018719mg                161   2e-46   
ref|XP_002864249.1|  predicted protein                                  172   2e-46   
gb|AFU82908.1|  yellow stripe-like transporter 3.1                      172   3e-46   
ref|XP_008379097.1|  PREDICTED: probable metal-nicotianamine tran...    172   3e-46   
ref|XP_011075924.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    172   5e-46   
ref|XP_002872112.1|  hypothetical protein ARALYDRAFT_489303             172   5e-46   
ref|XP_010679992.1|  PREDICTED: probable metal-nicotianamine tran...    171   6e-46   
ref|XP_010035301.1|  PREDICTED: metal-nicotianamine transporter Y...    171   8e-46   
ref|XP_006372617.1|  hypothetical protein POPTR_0017s032801g            160   8e-46   
ref|XP_008798980.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    170   9e-46   
ref|XP_010493593.1|  PREDICTED: metal-nicotianamine transporter Y...    171   1e-45   
ref|XP_010535963.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|XP_009397635.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|XP_010034897.1|  PREDICTED: metal-nicotianamine transporter Y...    171   1e-45   
ref|XP_010493592.1|  PREDICTED: metal-nicotianamine transporter Y...    171   1e-45   
ref|NP_001268107.1|  YS1-like protein-like                              170   2e-45   
ref|XP_010658081.1|  PREDICTED: YS1-like protein-like isoform X1        170   2e-45   
ref|XP_006653335.1|  PREDICTED: probable metal-nicotianamine tran...    173   2e-45   
ref|XP_003523338.2|  PREDICTED: metal-nicotianamine transporter Y...    170   2e-45   
emb|CBI34579.3|  unnamed protein product                                170   2e-45   
gb|KHN19530.1|  Metal-nicotianamine transporter YSL3                    170   2e-45   
ref|XP_010454747.1|  PREDICTED: metal-nicotianamine transporter Y...    170   2e-45   
ref|XP_006578879.1|  PREDICTED: metal-nicotianamine transporter Y...    170   2e-45   
ref|XP_010454748.1|  PREDICTED: metal-nicotianamine transporter Y...    170   2e-45   
gb|EMT17260.1|  Putative metal-nicotianamine transporter YSL11          170   2e-45   
ref|XP_010099817.1|  putative metal-nicotianamine transporter YSL5      162   3e-45   
gb|KEH35475.1|  OPT family oligopeptide transporter                     169   3e-45   
ref|XP_004165023.1|  PREDICTED: metal-nicotianamine transporter Y...    169   3e-45   
ref|XP_004146239.1|  PREDICTED: metal-nicotianamine transporter Y...    169   3e-45   
ref|XP_009150965.1|  PREDICTED: metal-nicotianamine transporter YSL2    169   3e-45   
gb|AFP55583.1|  yellow stripe-like protein                              171   3e-45   
gb|AES72566.2|  OPT family oligopeptide transporter                     169   3e-45   
ref|XP_006471126.1|  PREDICTED: metal-nicotianamine transporter Y...    169   3e-45   
ref|XP_002515673.1|  oligopeptide transporter, putative                 169   3e-45   
gb|KDO53476.1|  hypothetical protein CISIN_1g047730mg                   169   3e-45   
gb|KGN57644.1|  hypothetical protein Csa_3G238100                       169   3e-45   
gb|EPS62701.1|  hypothetical protein M569_12087                         169   3e-45   
emb|CAN77515.1|  hypothetical protein VITISV_013366                     169   4e-45   
gb|KJB37387.1|  hypothetical protein B456_006G203200                    169   4e-45   
ref|XP_009351940.1|  PREDICTED: metal-nicotianamine transporter Y...    169   4e-45   
gb|KFK27715.1|  hypothetical protein AALP_AA8G420300                    169   4e-45   
gb|KJB37386.1|  hypothetical protein B456_006G203200                    169   4e-45   
ref|XP_007136481.1|  hypothetical protein PHAVU_009G048800g             169   5e-45   
ref|XP_006431856.1|  hypothetical protein CICLE_v10003961mg             169   5e-45   
ref|XP_003556609.1|  PREDICTED: probable metal-nicotianamine tran...    169   5e-45   
gb|AEQ28192.1|  yellow stripe-like protein 3                            169   6e-45   
ref|XP_008381368.1|  PREDICTED: metal-nicotianamine transporter Y...    169   6e-45   
ref|XP_002318472.2|  hypothetical protein POPTR_0012s03180g             168   8e-45   
gb|KDP30688.1|  hypothetical protein JCGZ_16395                         168   8e-45   
ref|XP_003602315.1|  YSL transporter                                    169   9e-45   
gb|KHG10996.1|  Metal-nicotianamine transporter YSL3 -like protein      167   1e-44   
ref|XP_007140990.1|  hypothetical protein PHAVU_008G157800g             168   1e-44   
ref|XP_011043724.1|  PREDICTED: metal-nicotianamine transporter Y...    168   1e-44   
ref|XP_006581667.1|  PREDICTED: metal-nicotianamine transporter Y...    168   1e-44   
ref|XP_007140989.1|  hypothetical protein PHAVU_008G157800g             167   1e-44   
ref|XP_009588595.1|  PREDICTED: metal-nicotianamine transporter Y...    167   1e-44   
ref|XP_009588601.1|  PREDICTED: metal-nicotianamine transporter Y...    167   2e-44   
ref|XP_007220212.1|  hypothetical protein PRUPE_ppa002475mg             167   2e-44   
gb|EMS45266.1|  putative metal-nicotianamine transporter YSL6           170   2e-44   
ref|XP_008456005.1|  PREDICTED: metal-nicotianamine transporter Y...    167   2e-44   
ref|XP_008234683.1|  PREDICTED: metal-nicotianamine transporter YSL3    167   2e-44   
ref|XP_003556858.1|  PREDICTED: metal-nicotianamine transporter Y...    167   2e-44   
ref|XP_008456006.1|  PREDICTED: metal-nicotianamine transporter Y...    166   3e-44   
ref|XP_010541500.1|  PREDICTED: metal-nicotianamine transporter Y...    166   3e-44   
gb|EMT26359.1|  Putative metal-nicotianamine transporter YSL6           167   3e-44   
ref|XP_008444004.1|  PREDICTED: metal-nicotianamine transporter Y...    167   4e-44   
ref|XP_010541499.1|  PREDICTED: metal-nicotianamine transporter Y...    166   4e-44   
sp|Q7XUJ2.2|YSL9_ORYSJ  RecName: Full=Probable metal-nicotianamin...    166   4e-44   
ref|XP_011046069.1|  PREDICTED: probable metal-nicotianamine tran...    166   5e-44   
dbj|BAK07087.1|  predicted protein                                      164   5e-44   
ref|XP_002986072.1|  hypothetical protein SELMODRAFT_123451             166   6e-44   
ref|XP_002981992.1|  hypothetical protein SELMODRAFT_179245             166   6e-44   
ref|XP_004172903.1|  PREDICTED: metal-nicotianamine transporter Y...    165   1e-43   
ref|XP_004150025.1|  PREDICTED: metal-nicotianamine transporter Y...    165   1e-43   
emb|CAH67443.1|  H0501D11.7                                             165   1e-43   
gb|KHN05985.1|  Metal-nicotianamine transporter YSL3-like protein       164   1e-43   
ref|NP_001053449.2|  Os04g0542200                                       164   2e-43   
dbj|BAF48331.1|  putative yellow stripe-like protein                    164   2e-43   
ref|XP_006601048.1|  PREDICTED: metal-nicotianamine transporter Y...    164   2e-43   
ref|XP_009763790.1|  PREDICTED: metal-nicotianamine transporter Y...    164   2e-43   
gb|KHN14758.1|  Metal-nicotianamine transporter YSL1                    164   2e-43   
ref|XP_009763789.1|  PREDICTED: metal-nicotianamine transporter Y...    164   2e-43   
gb|KJB37389.1|  hypothetical protein B456_006G203200                    164   3e-43   
ref|XP_009763791.1|  PREDICTED: metal-nicotianamine transporter Y...    164   3e-43   
ref|XP_003551122.2|  PREDICTED: metal-nicotianamine transporter Y...    164   3e-43   
gb|EYU45295.1|  hypothetical protein MIMGU_mgv1a002502mg                164   3e-43   
ref|XP_006847868.1|  hypothetical protein AMTR_s00029p00088380          152   3e-43   
ref|XP_003536174.2|  PREDICTED: metal-nicotianamine transporter Y...    164   4e-43   
ref|XP_009765494.1|  PREDICTED: metal-nicotianamine transporter Y...    164   4e-43   
ref|XP_009765519.1|  PREDICTED: metal-nicotianamine transporter Y...    164   4e-43   
ref|XP_010318048.1|  PREDICTED: metal-nicotianamine transporter Y...    163   4e-43   
ref|XP_008376798.1|  PREDICTED: metal-nicotianamine transporter YSL3    163   4e-43   
ref|XP_009361313.1|  PREDICTED: metal-nicotianamine transporter YSL2    163   5e-43   
gb|AFU82907.1|  yellow stripe-like transporter 1                        163   5e-43   
ref|XP_010318047.1|  PREDICTED: metal-nicotianamine transporter Y...    163   5e-43   
ref|XP_006350625.1|  PREDICTED: metal-nicotianamine transporter Y...    164   7e-43   
ref|XP_004498492.1|  PREDICTED: metal-nicotianamine transporter Y...    162   9e-43   
ref|XP_003556427.1|  PREDICTED: metal-nicotianamine transporter Y...    162   1e-42   
ref|XP_006606419.1|  PREDICTED: metal-nicotianamine transporter Y...    162   1e-42   



>ref|XP_009615007.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana tomentosiformis]
Length=689

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESKEVPSW++QLT RAF VSF+LGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  27   VERIFESKEVPSWQSQLTLRAFVVSFILGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWT+ LEKSGFLK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE VAKQ   A
Sbjct  87   VKTWTRLLEKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVVAKQAVEA  146

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  147  NNAANIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  206

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  207  QGAKLAKKQVKALG  220



>ref|XP_009794095.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana sylvestris]
Length=686

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESKEVPSW++QLT RAF VSF+LGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  24   VERIFESKEVPSWQSQLTLRAFVVSFILGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  83

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWT  LEKSGFLK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE VAKQ   A
Sbjct  84   VKTWTSLLEKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVVAKQAVEA  143

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  144  NNEANIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  203

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  204  QGAKLAKKQVKALG  217



>ref|XP_006363210.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=692

 Score =   265 bits (677),  Expect = 3e-80, Method: Composition-based stats.
 Identities = 168/194 (87%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESKEVPSW+NQLT RAFCVSF+LG+LFTFIV+KL+LTTGIIPSLNVSAGLLGFFF
Sbjct  30   VERIFESKEVPSWQNQLTLRAFCVSFILGILFTFIVLKLSLTTGIIPSLNVSAGLLGFFF  89

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTK LEKSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+F MSE  AKQ T A
Sbjct  90   LKTWTKLLEKSGILKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFAMSEVAAKQSTEA  149

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  150  NNAFNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  209

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ L 
Sbjct  210  QGAKLAKKQVKALA  223



>ref|XP_004233770.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=694

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESKEVPSW++QLT RAFCVSF+LG+LFTFIV+KL+LTTGIIPSLNVSAGLLGFFF
Sbjct  32   VERIFESKEVPSWQDQLTLRAFCVSFILGILFTFIVLKLSLTTGIIPSLNVSAGLLGFFF  91

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTK LEKSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+F MSE  AKQ T A
Sbjct  92   IKTWTKLLEKSGVLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFAMSEVAAKQSTEA  151

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  152  NNAFNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  211

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ L 
Sbjct  212  QGAKLAKKQVKALA  225



>ref|XP_009593058.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=713

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESKEVP+W++QLTFRAF VSFVLG+LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  51   VERIFESKEVPTWQSQLTFRAFFVSFVLGILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  110

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKSG+LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE +AKQ    
Sbjct  111  VKTWTKFLEKSGWLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQSNED  170

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N  +NIKNP + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  171  NAADNIKNPSLGWMISFLFVVSFLGLFSVVPLRKIMIIDFKLVYPSGTATAHLINSFHTP  230

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  231  QGAKLAKKQVKALG  244



>ref|XP_006343309.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=699

 Score =   261 bits (668),  Expect = 6e-79, Method: Composition-based stats.
 Identities = 166/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESK+VPSW++QLT RAF VS +LG+LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  37   VERIFESKQVPSWQSQLTLRAFFVSLILGILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  96

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFL+KSGFLK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE +AKQ T A
Sbjct  97   VKTWTKFLDKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEGIAKQSTEA  156

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N  +N+KNP + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  157  NAADNVKNPSLGWMITFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHTP  216

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  217  QGAKLAKKQVKALG  230



>ref|XP_009798435.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=712

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESKEVP+W++QLTFRAF VSF+LG+LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  50   VERIFESKEVPTWQSQLTFRAFFVSFILGILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKSG+LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE +AKQ    
Sbjct  110  VKTWTKFLEKSGWLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQSNED  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N  +NIKNP + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  170  NAADNIKNPSLGWMISFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  230  QGAKLAKKQVKALG  243



>gb|KDP27275.1| hypothetical protein JCGZ_21006 [Jatropha curcas]
Length=690

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFE+K+VP W++QLT RAF VSFVLGVLF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  33   VEKIFEAKQVPKWQSQLTLRAFVVSFVLGVLFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  92

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFL+K+GFLK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE VAKQ   A
Sbjct  93   VKTWTKFLQKAGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVVAKQSVEA  152

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             NP+N+KNP + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  153  GNPQNVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHTP  212

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  213  QGAKLAKKQVRELG  226



>ref|XP_011097988.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=693

 Score =   258 bits (660),  Expect = 8e-78, Method: Composition-based stats.
 Identities = 168/191 (88%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  90   IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  269
            IFES+EVP W+ QLTFRAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  37   IFESREVPPWQKQLTFRAFIVSFVLAVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  96

Query  270  WTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNP  449
            WTKFLEKSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE VAKQ T AN+ 
Sbjct  97   WTKFLEKSGLLKQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSEVVAKQSTEANDA  156

Query  450  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGA  629
             +IKNP +AWMIGFLFVVSFLGLFSV+PLRK+MIIDFKL YPSGTATAHLINSFHTPQGA
Sbjct  157  LDIKNPSLAWMIGFLFVVSFLGLFSVLPLRKIMIIDFKLIYPSGTATAHLINSFHTPQGA  216

Query  630  KLAKKQVRTLG  662
            KLAKKQVR LG
Sbjct  217  KLAKKQVRALG  227



>ref|XP_002525883.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF36487.1| oligopeptide transporter, putative [Ricinus communis]
Length=717

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 186/219 (85%), Gaps = 14/219 (6%)
 Frame = +3

Query  6    RGEPESGEDLGIdskknedsseseCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFI  185
            +G+ +SG D              + VE IFE+KEVP+W++QLT RAF VSFVLG+LF+FI
Sbjct  45   KGDDQSGAD--------------DSVEMIFEAKEVPTWKDQLTIRAFVVSFVLGILFSFI  90

Query  186  VMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassg  365
            VMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFL KSG LK PFTRQENTVIQTCVVA+SG
Sbjct  91   VMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLSKSGLLKQPFTRQENTVIQTCVVATSG  150

Query  366  iafsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKV  545
            IAFSGGFGSY+FGMSE VAKQ T AN   NIKNP + WMIGFLFVVSFLGLFSVVPLRK+
Sbjct  151  IAFSGGFGSYLFGMSEVVAKQSTEANTAGNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKI  210

Query  546  MIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            MI+DFKL YPSGTATAHLINSFHTPQGAKLAKKQVR LG
Sbjct  211  MIVDFKLIYPSGTATAHLINSFHTPQGAKLAKKQVRELG  249



>gb|EYU25678.1| hypothetical protein MIMGU_mgv1a002252mg [Erythranthe guttata]
Length=695

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE  EVP W+ QLT RAF VSFVLG+LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  37   IEKTFEGTEVPPWQKQLTLRAFVVSFVLGILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  96

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTW+KFLEKSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE +AKQ T A
Sbjct  97   VKTWSKFLEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQSTEA  156

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +N+KNP ++WMIGFLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  157  NDSQNVKNPSLSWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHTP  216

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVRTLG
Sbjct  217  QGAKLAKKQVRTLG  230



>gb|EPS73705.1| hypothetical protein M569_01043 [Genlisea aurea]
Length=695

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFESKEVP W+ QLT RA  VSF+L +LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  35   VEKIFESKEVPPWQRQLTLRAIFVSFILSILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  94

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +A Q T A
Sbjct  95   VKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVIASQSTEA  154

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P+N+KNP +AW+IGFLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  155  NDPKNVKNPNLAWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHTP  214

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVRTLG
Sbjct  215  QGAKLAKKQVRTLG  228



>ref|XP_004234495.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=696

 Score =   256 bits (653),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESK+V SW +QLT RAF VS +LG+LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  30   VERIFESKQVSSWESQLTLRAFFVSLLLGILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  89

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFL+KSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE +AKQ T A
Sbjct  90   VKTWTKFLDKSGVLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQSTEA  149

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N  +N+KNP + WMI FL VVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  150  NAADNVKNPSLGWMITFLLVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHTP  209

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+TLG
Sbjct  210  QGAKLAKKQVKTLG  223



>ref|XP_002266657.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  46   VERIFEGKEVPSWREQLTVRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  105

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V  WTKFL+KSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+++AKQ   A
Sbjct  106  VSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSQAIAKQSENA  165

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFHTP
Sbjct  166  GGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHTP  225

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  226  QGAKLAKKQVRVLG  239



>ref|XP_010245490.1| PREDICTED: probable metal-nicotianamine transporter YSL7, partial 
[Nelumbo nucifera]
Length=502

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ERIF+S+E+P W+NQLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  42   IERIFDSQEIPPWQNQLTLRAFAVSFLLAILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  101

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS + AKQ    
Sbjct  102  VKTWTKFLEKSGMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSSAEAKQSAET  161

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               +NIK+P + WMIGFLF+VSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  162  GAAQNIKDPALGWMIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  221

Query  621  QGAKLAKKQVRTLG  662
            QGA LA+KQVR LG
Sbjct  222  QGANLARKQVRALG  235



>ref|XP_011046072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Populus euphratica]
Length=701

 Score =   253 bits (646),  Expect = 9e-76, Method: Composition-based stats.
 Identities = 164/194 (85%), Positives = 178/194 (92%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  39   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  98

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS++VAKQ+T  
Sbjct  99   IKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDTVAKQLT--  156

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLINSFHTP
Sbjct  157  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  216

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVR LG
Sbjct  217  AGAKLAKKQVRVLG  230



>ref|XP_011046075.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X5 [Populus euphratica]
Length=699

 Score =   253 bits (646),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 164/194 (85%), Positives = 178/194 (92%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  39   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  98

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS++VAKQ+T  
Sbjct  99   IKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDTVAKQLT--  156

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLINSFHTP
Sbjct  157  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  216

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVR LG
Sbjct  217  AGAKLAKKQVRVLG  230



>ref|XP_002269277.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=704

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE KEVPSWR QLT RAF V FVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  42   VERLFEGKEVPSWREQLTVRAFVVRFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  101

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V  WTKFL+KSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+++AKQ   A
Sbjct  102  VSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSQAIAKQSENA  161

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFHTP
Sbjct  162  GGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHTP  221

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  222  QGAKLAKKQVRVLG  235



>ref|XP_011046073.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X3 [Populus euphratica]
Length=700

 Score =   251 bits (640),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 163/194 (84%), Positives = 177/194 (91%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE++EVPSWRNQLT RAF +SFVL +LFT IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAF+GGFGSY+FGMS++VAKQ+T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGSYLFGMSDTVAKQLT--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLINSFHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVR LG
Sbjct  216  AGAKLAKKQVRVLG  229



>ref|XP_011016255.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Populus 
euphratica]
Length=471

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSWRNQLT RAF VSFVL +LFT IVMKLNLTTGI+PSLN+SAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFTVIVMKLNLTTGILPSLNISAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIA SGGFG+Y+FGMSE+VAKQ T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIANSGGFGNYLFGMSETVAKQST--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMI+DFKLTYPSGTAT HLINSFHTP
Sbjct  156  EYRDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIVDFKLTYPSGTATGHLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVR LG
Sbjct  216  TGAKLAKKQVRVLG  229



>ref|XP_006391519.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
 gb|ESQ28805.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
Length=691

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 178/196 (91%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE S EVP  W+NQLTFRA  VSFVL +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  29   VERIFEASSEVPPPWQNQLTFRAMIVSFVLSILFTFVVMKLNLTTGIIPSLNISAGLLGF  88

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K GFLK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ +
Sbjct  89   FFVKTWTKLLHKGGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQSS  148

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN+P NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  149  EANSPLNIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  208

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  209  TPQGAKLAKKQVRALG  224



>ref|XP_006372621.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
 gb|ERP50418.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
Length=698

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSWRNQLT RA  VSFVL +LF  IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRALVVSFVLSILFCVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE+VAKQ+T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAKQLT--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLINSFHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVR LG
Sbjct  216  AGAKLAKKQVRVLG  229



>ref|XP_006372622.1| iron transporter-related family protein [Populus trichocarpa]
 gb|ERP50419.1| iron transporter-related family protein [Populus trichocarpa]
Length=698

 Score =   248 bits (634),  Expect = 5e-74, Method: Composition-based stats.
 Identities = 165/194 (85%), Positives = 178/194 (92%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE+VAKQ T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAKQST--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LINSFHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQV+ LG
Sbjct  216  AGAKLAKKQVKALG  229



>ref|XP_010112419.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
 gb|EXC33540.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
Length=692

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 177/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIF S+EVPSWRNQLT RAF VSFVL +LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  36   VERIFASQEVPSWRNQLTVRAFVVSFVLSILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  95

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WTKFLEKSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ +AK    +
Sbjct  96   VKVWTKFLEKSGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSKRIAKD---S  152

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  + KNP +AW+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  153  SDTSDFKNPSLAWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  212

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVR LG
Sbjct  213  EGAKLAKKQVRVLG  226



>ref|XP_011046074.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X4 [Populus euphratica]
Length=700

 Score =   248 bits (634),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 162/194 (84%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE++EVPSWRNQLT RAF +SFVL +LFT IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAF+GGFG Y+ GMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGHYLLGMSETVARQST--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAHLINSFHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVR LG
Sbjct  216  AGAKLAKKQVRVLG  229



>gb|ABB76761.1| YSL transporter 1 [Noccaea caerulescens]
 gb|ABD04076.1| YSL transporter 1 [Noccaea caerulescens]
Length=693

 Score =   248 bits (632),  Expect = 8e-74, Method: Composition-based stats.
 Identities = 162/196 (83%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFES--KEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE+  +  P+W+NQLT RA  VSFVL +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  30   VERIFEANGEAPPTWQNQLTIRAMIVSFVLSILFTFVVMKLNLTTGIIPSLNISAGLLGF  89

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+GFLK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ  
Sbjct  90   FFVKTWTKLLSKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQSA  149

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN P NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  150  DANTPLNIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  209

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  210  TPQGAKLAKKQVRALG  225



>gb|KFK41018.1| hypothetical protein AALP_AA2G074700 [Arabis alpina]
Length=690

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE   +  P+W+NQLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  28   VERIFEVSGEAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLGF  87

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+GFLK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ  
Sbjct  88   FFVKTWTKLLHKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQSG  147

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN P NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  148  EANTPINIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  207

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  208  TPQGAKLAKKQVRALG  223



>ref|XP_006847870.1| hypothetical protein AMTR_s00029p00090040 [Amborella trichopoda]
 gb|ERN09451.1| hypothetical protein AMTR_s00029p00090040 [Amborella trichopoda]
Length=262

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 174/195 (89%), Gaps = 1/195 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFESK +P W+ QLTFRAF VSFVLGV+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  30   VEQIFESKTIPPWQEQLTFRAFFVSFVLGVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  89

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WTKFLEK G LK PFTRQENTVIQTCVVA SGIAFSGGFGSY+FGMSE++A + T  
Sbjct  90   VKSWTKFLEKMGLLKQPFTRQENTVIQTCVVACSGIAFSGGFGSYLFGMSETIAHRSTDG  149

Query  441  N-NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
              +P+ IKNPG+ WMIGFLFVVSFLGLFS+VPLRK+M+ID+KLTYPSGTATA LINSFHT
Sbjct  150  PIDPQTIKNPGLGWMIGFLFVVSFLGLFSIVPLRKIMVIDYKLTYPSGTATALLINSFHT  209

Query  618  PQGAKLAKKQVRTLG  662
            PQGAKL KKQV  LG
Sbjct  210  PQGAKLVKKQVGALG  224



>ref|XP_002886962.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63221.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
Length=693

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE S E+P  W+ QLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  31   VERIFEASHEIPPPWQKQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  90

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+GFLK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ  
Sbjct  91   FFVKTWTKILNKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQSA  150

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN P NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  151  EANTPMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  210

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  211  TPQGAKLAKKQVRALG  226



>ref|XP_002269403.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFESKEVPSWR QLT RAF VS V+GVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  46   VERIFESKEVPSWREQLTVRAFVVSLVVGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  105

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
               WTKFL+ SG LK PFTRQENTVIQTCVVA SGIAFSGGFGSY+FGMSE VAK+    
Sbjct  106  TSGWTKFLDNSGLLKQPFTRQENTVIQTCVVAISGIAFSGGFGSYLFGMSEVVAKESEDV  165

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + ++ KNP + WMIGFLFVVSFLGLFSV+PLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  166  QSSQDYKNPAIGWMIGFLFVVSFLGLFSVLPLRKIMIIDFKLTYPSGTATAHLINSFHTP  225

Query  621  QGAKLAKKQVRTLG  662
            +GA+LAKKQVR LG
Sbjct  226  EGARLAKKQVRVLG  239



>ref|XP_010940334.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=709

 Score =   246 bits (629),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 155/194 (80%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER+F+ K VP+WR QLT RAF VS +LGV+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   MERVFDEKPVPTWREQLTVRAFAVSALLGVMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TW + LEK+G LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+F MS+++AKQ T  
Sbjct  104  VRTWARVLEKTGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFAMSDTIAKQTTEE  163

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIKNP + WMIGFLFVVSFLGLFS+VPLRK+MIID+KLTYPSGTATAHLINSFHTP
Sbjct  164  NDAQNIKNPKLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLTYPSGTATAHLINSFHTP  223

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVRTLG
Sbjct  224  QGAKLAKKQVRTLG  237



>ref|XP_006372353.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50150.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=680

 Score =   245 bits (625),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 164/194 (85%), Positives = 177/194 (91%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAEQST--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LINSFHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQV  LG
Sbjct  216  AGAKLAKKQVIALG  229



>ref|XP_006372354.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50151.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=698

 Score =   245 bits (625),  Expect = 9e-73, Method: Composition-based stats.
 Identities = 164/194 (85%), Positives = 177/194 (91%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAEQST--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LINSFHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQV  LG
Sbjct  216  AGAKLAKKQVIALG  229



>ref|NP_176750.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 sp|Q9SHY2.1|YSL7_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL7; 
AltName: Full=Protein YELLOW STRIPE LIKE 7; Short=AtYSL7 [Arabidopsis 
thaliana]
 gb|AAF23830.1|AC007234_2 F1E22.10 [Arabidopsis thaliana]
 gb|AAO22767.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04062.1| unknown protein [Arabidopsis thaliana]
 gb|AAS00696.1| metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 gb|AEE34418.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
Length=688

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE S E+P  W+ QLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  26   VERIFEESNEIPPPWQKQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  85

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVK+WTK L K+GFLK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ  
Sbjct  86   FFVKSWTKILNKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQSA  145

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN P NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  146  EANTPLNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  205

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  206  TPQGAKLAKKQVRALG  221



>ref|XP_007029356.1| YELLOW STRIPE like 5 [Theobroma cacao]
 gb|EOY09858.1| YELLOW STRIPE like 5 [Theobroma cacao]
Length=689

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 177/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSWR QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  33   VEQIFESQEVPSWRKQLTMRAFAVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  92

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEKSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +A+Q   +
Sbjct  93   VKTWTKMLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQ---S  149

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +   +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDF+LTYPSGTATAHLINSFHTP
Sbjct  150  GDTRGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFRLTYPSGTATAHLINSFHTP  209

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+TLG
Sbjct  210  QGAKLAKKQVKTLG  223



>ref|XP_011046070.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Populus euphratica]
Length=704

 Score =   244 bits (624),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 160/194 (82%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE++EVPSWRNQLT RAF +SFVL +LFT IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKFLEKSG LK PFTRQENTVIQTCVVASSGIAF+GGFG Y+ GMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGHYLLGMSETVARQST--  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LINSFHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQV+ LG
Sbjct  216  AGAKLAKKQVKALG  229



>gb|KDP45817.1| hypothetical protein JCGZ_17424 [Jatropha curcas]
Length=698

 Score =   244 bits (623),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 162/194 (84%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IF  +EVPSW+ QLT RAF VSF+L +LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  39   VEQIFREQEVPSWQQQLTVRAFVVSFILSILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  98

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WT FLEKS  LKHPFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE++AKQ   +
Sbjct  99   LKIWTSFLEKSRLLKHPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETIAKQ---S  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+  + KNP VAWMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  156  NDKSDHKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQV+TLG
Sbjct  216  AGAKLAKKQVKTLG  229



>ref|XP_011035386.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Populus 
euphratica]
Length=684

 Score =   243 bits (621),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 160/194 (82%), Positives = 179/194 (92%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE++EVPSWRNQLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  24   VERVFENQEVPSWRNQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  83

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTKF+E+SG LK PFTRQ+NTVIQTCVVASSGIAFSGGFGSY+FGMSE+VAKQ T  
Sbjct  84   IKTWTKFVERSGLLKQPFTRQKNTVIQTCVVASSGIAFSGGFGSYLFGMSEAVAKQST--  141

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMI+DFKLTYPSGTATA+LINSFHTP
Sbjct  142  EHTDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIVDFKLTYPSGTATAYLINSFHTP  201

Query  621  QGAKLAKKQVRTLG  662
             GAKLAK+QV+ LG
Sbjct  202  AGAKLAKRQVKVLG  215



>ref|XP_010511122.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=691

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE-SKEVP-SWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE S EVP SW++QLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  29   VERIFEASHEVPPSWQHQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  88

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ  
Sbjct  89   FFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQSA  148

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN   NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  149  EANTAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  208

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  209  TPQGAKLAKKQVRALG  224



>ref|XP_008441625.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Cucumis 
melo]
Length=660

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 179/194 (92%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSW+NQLT RAF VSF L VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  48   VERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  107

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEKSGFLK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FG+S+ ++ Q++ A
Sbjct  108  VKTWTKLLEKSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS-QLSSA  166

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +  E  KNP + W+IGFLF+VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFHTP
Sbjct  167  DINE-FKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHTP  225

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  226  RGAKLAKKQVRTLG  239



>ref|XP_009105166.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Brassica 
rapa]
 emb|CDY07462.1| BnaA07g25410D [Brassica napus]
Length=690

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 173/196 (88%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE  +   P+W+NQLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLL F
Sbjct  28   VERIFEESADAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLSF  87

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE VAKQ  
Sbjct  88   FFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVVAKQSA  147

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN P NIKNP + WMIGFLF VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  148  EANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  207

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  208  TPQGAKLAKKQVRALG  223



>gb|ACD77012.1| metal transporter protein [Brassica juncea]
Length=689

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 173/196 (88%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE  +   P+W+NQLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLL F
Sbjct  27   VERIFEESADAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLSF  86

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE VAKQ  
Sbjct  87   FFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVVAKQSA  146

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN P NIKNP + WMIGFLF VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  147  EANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  206

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  207  TPQGAKLAKKQVRALG  222



>ref|XP_010069525.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Eucalyptus 
grandis]
 gb|KCW57905.1| hypothetical protein EUGRSUZ_H00652 [Eucalyptus grandis]
Length=698

 Score =   243 bits (620),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 158/194 (81%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE KEVPSWR QLT RAF VSFVL VLF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERVFEGKEVPSWRQQLTVRAFVVSFVLSVLFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ +A+QM   
Sbjct  98   VKTWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDHIAEQMGNG  157

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
                + K   + W+IGFLF+VSFLGL +VVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  158  PGANDYKKLSLPWIIGFLFIVSFLGLLAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  217

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  218  EGAKLAKKQVRTLG  231



>ref|XP_002279707.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IF+ +  PSWR QLT RAF VSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  54   VEMIFKGQVEPSWREQLTIRAFVVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  113

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K+WTK +EKSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS +VA Q +  
Sbjct  114  LKSWTKLMEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSTVAGQSSET  173

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N  +N K+P ++W+IGFLF VSFLGLFSV+PLRK+MIID+KLTYPSGTATAHLINSFHTP
Sbjct  174  NAAQNTKDPSLSWIIGFLFAVSFLGLFSVLPLRKIMIIDYKLTYPSGTATAHLINSFHTP  233

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVRTLG
Sbjct  234  QGAKLAKKQVRTLG  247



>ref|XP_010470452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=692

 Score =   242 bits (617),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 163/196 (83%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE-SKEVP-SWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VE+IFE S EVP SW++QLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  30   VEKIFEASHEVPPSWQHQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  89

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ  
Sbjct  90   FFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQSA  149

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN   NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  150  EANTAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  209

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  210  TPQGAKLAKKQVRALG  225



>gb|KFK39092.1| hypothetical protein AALP_AA3G199800 [Arabis alpina]
Length=721

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  53   VEKIFESREVPSWKKQLTLRAFMVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  112

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  113  VKTWTKMLHKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQS--G  170

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  171  DAARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  230

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  231  QGAKLAKKQVRVLG  244



>emb|CDY39272.1| BnaC06g27190D [Brassica napus]
Length=689

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 172/196 (88%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE  +   P W+NQLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLL F
Sbjct  27   VERIFEESADAPPPWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLSF  86

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE VAKQ  
Sbjct  87   FFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVVAKQSP  146

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN P NIKNP + WMIGFLF VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFH
Sbjct  147  EANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  206

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  207  TPQGAKLAKKQVRALG  222



>ref|XP_002305689.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
 gb|EEE86200.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
Length=689

 Score =   241 bits (616),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 156/194 (80%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIF  +EVPSWRNQLT+RAF VSF+L VLF+FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  24   VERIFAKQEVPSWRNQLTWRAFGVSFILSVLFSFIVMKLNLTAGIIPSLNVSAGLLGFFF  83

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWT+FLE  G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS  +A++    
Sbjct  84   VKTWTRFLENCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGRIAQESADQ  143

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + ++IK+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  144  PSAKDIKDPALGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  203

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVR LG
Sbjct  204  EGAKLAKKQVRALG  217



>ref|XP_002277292.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   242 bits (617),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE +F+ K VPSWR QLT RAF VSFVLGVL TFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  54   VEMLFKGKVVPSWREQLTIRAFVVSFVLGVLLTFIVMKLNLTTGIIPSLNVSAGLLGFFF  113

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+W KF+EKSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS  VA Q   +
Sbjct  114  VKSWAKFMEKSGMLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSIVAGQSAKS  173

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +N K+P + W+IGFLF VSFLGLFSV+PLRK+M+ID+KLTYPSGTATAHLINSFHTP
Sbjct  174  IDAQNTKDPRLPWIIGFLFAVSFLGLFSVLPLRKIMVIDYKLTYPSGTATAHLINSFHTP  233

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAK+QVRTLG
Sbjct  234  QGAKLAKQQVRTLG  247



>ref|XP_010025985.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=827

 Score =   243 bits (621),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 154/194 (79%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ FESKEVPSWR QLT RAF VSFVL V+F+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  174  VEKAFESKEVPSWRQQLTVRAFAVSFVLSVMFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  233

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTK LEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+F MS  +A Q    
Sbjct  234  IKTWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSGRIASQAESG  293

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
                + K+P + W+IGFLF+VSF+GL SVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  294  PGTNDYKDPSLGWIIGFLFIVSFVGLLSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  353

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVR LG
Sbjct  354  EGAKLAKKQVRALG  367



>ref|XP_002510093.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF52280.1| oligopeptide transporter, putative [Ricinus communis]
Length=709

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFE + VPSWR QLT+RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEQIFERQGVPSWREQLTWRAFGVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTK LEK G LK PFTRQENTVIQTC+VASSGIAFSGGFGSY+FGMSE  A+Q +  
Sbjct  104  VRTWTKILEKPGLLKQPFTRQENTVIQTCIVASSGIAFSGGFGSYLFGMSERAAQQSSED  163

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N   +IKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  164  NGATSIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  223

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  224  QGAKLAKKQVRELG  237



>gb|KCW48664.1| hypothetical protein EUGRSUZ_K02319 [Eucalyptus grandis]
Length=564

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
             ERIFE + VPSW  QLTFRAF VSF+L ++F FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  52   AERIFEGQAVPSWGRQLTFRAFAVSFMLSIMFAFIVMKLNLTAGIIPSLNVSAGLLGFFF  111

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L+KSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+F MS  VA Q T  
Sbjct  112  VKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSARVAGQSTDP  171

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +    KNP +AWMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  172  QSAHVFKNPSLAWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  231

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  232  QGAKLAKKQVKALG  245



>ref|XP_004158540.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=706

 Score =   241 bits (615),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 159/194 (82%), Positives = 179/194 (92%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSW+NQLT RAF VSF L VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WTK LEKSG+LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FG+S+ ++ Q++ +
Sbjct  109  VKSWTKLLEKSGWLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS-QLS-S  166

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++    KNP + W+IGFLF+VSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  167  DDINEFKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  226

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  227  RGAKLAKKQVRTLG  240



>ref|XP_004138807.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
 gb|KGN63124.1| hypothetical protein Csa_2G404760 [Cucumis sativus]
Length=706

 Score =   241 bits (615),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 159/194 (82%), Positives = 179/194 (92%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSW+NQLT RAF VSF L VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WTK LEKSG+LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FG+S+ ++ Q++ +
Sbjct  109  VKSWTKLLEKSGWLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS-QLS-S  166

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++    KNP + W+IGFLF+VSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  167  DDINEFKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  226

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  227  RGAKLAKKQVRTLG  240



>gb|KDP41617.1| hypothetical protein JCGZ_16024 [Jatropha curcas]
Length=690

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 176/194 (91%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+ VPSWR QLT+RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  27   VEQIFESQRVPSWREQLTWRAFGVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTK LE SG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS  VA+Q T  
Sbjct  87   VRTWTKILETSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGIVAQQST-E  145

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +N  +IK+P + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LINSFHTP
Sbjct  146  DNGTDIKDPKLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTP  205

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVR LG
Sbjct  206  EGAKLAKKQVRELG  219



>gb|KCW48659.1| hypothetical protein EUGRSUZ_K02315 [Eucalyptus grandis]
Length=531

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE + VPSWR QLTFRAF VSFVL V+F FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  51   VERIFEGQGVPSWRGQLTFRAFAVSFVLSVMFAFIVMKLNLTAGIIPSLNVSAGLLGFFF  110

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L+KSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+F MS+ VA Q    
Sbjct  111  VKTWTKVLDKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSKRVADQSKDP  170

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               +  K+P ++WMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  171  QRAQVFKDPSLSWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  230

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  231  EGAKLAKKQVKALG  244



>ref|XP_011072072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=697

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE+KEVPSWR QLT RAF VSF+L V+F FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  35   VERIFENKEVPSWRKQLTVRAFAVSFLLSVMFCFIVMKLNLTTGIIPSLNVSAGLLGFFF  94

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK + KSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +A+Q    
Sbjct  95   VKTWTKLIAKSGMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEQIAQQSEHR  154

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  + KNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  155  KDGFDYKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  214

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVR LG
Sbjct  215  EGAKLAKKQVRELG  228



>emb|CDY46890.1| BnaA01g27900D [Brassica napus]
Length=715

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW  QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +AKQ    
Sbjct  107  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQS--G  164

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  165  DVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  225  QGAKLAKKQVRVLG  238



>ref|XP_009113863.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=714

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW  QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  45   VEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  104

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +AKQ    
Sbjct  105  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQS--G  162

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  163  DVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  222

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  223  QGAKLAKKQVRVLG  236



>ref|XP_010528609.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Tarenaya 
hassleriana]
Length=689

 Score =   240 bits (612),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 160/196 (82%), Positives = 173/196 (88%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFES--KEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE+  +  P W +QLT RA  VSFVL +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  29   VERIFEASGEAPPPWHHQLTIRAMVVSFVLSILFTFVVMKLNLTTGIIPSLNISAGLLGF  88

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+GFLK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ  
Sbjct  89   FFVKTWTKLLHKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQSA  148

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN+  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKL YPSGTATAHLINSFH
Sbjct  149  EANSVMNIKNPQLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLIYPSGTATAHLINSFH  208

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  209  TPQGAKLAKKQVRALG  224



>ref|XP_008779631.1| PREDICTED: probable metal-nicotianamine transporter YSL14, partial 
[Phoenix dactylifera]
Length=286

 Score =   229 bits (584),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER FE K VP+WR QLT RA  VSF+L V+ +FI MKLNLTTGI+PSLNV+AGLLGFFF
Sbjct  28   IERAFEGKRVPTWREQLTLRALVVSFLLSVICSFIAMKLNLTTGIVPSLNVAAGLLGFFF  87

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEK+G L+ PFTRQENTVIQTCVVA+ GIA  GGFG+ + GMSE +AKQ + A
Sbjct  88   VKTWTKALEKAGLLRLPFTRQENTVIQTCVVAAYGIASYGGFGAQLLGMSERIAKQASEA  147

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +N +NI++P + WMIGFLF+VSF GLFS+VPLRK+MIID+KL YPSGTATA LIN FHTP
Sbjct  148  DNAQNIRDPELGWMIGFLFLVSFPGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  207

Query  621  QGAKLAKKQVRTLG  662
            QGAK AKKQVRT+G
Sbjct  208  QGAKQAKKQVRTMG  221



>ref|XP_006406708.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
 dbj|BAJ33889.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48161.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
Length=716

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VEKIFESREVPSWKKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  109  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQS--G  166

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  167  DAARGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  226

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  227  QGAKLAKKQVRVLG  240



>ref|XP_010037025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48660.1| hypothetical protein EUGRSUZ_K02316 [Eucalyptus grandis]
Length=702

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 179/220 (81%), Gaps = 10/220 (5%)
 Frame = +3

Query  3    RRGEPESGEDLGIdskknedsseseCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTF  182
            ++G   SGED           S    VERIFES+ VPSWR QLTFRAF VSF L V+F F
Sbjct  24   KKGGSRSGED----------ESNGLSVERIFESQGVPSWRRQLTFRAFAVSFALSVIFAF  73

Query  183  IVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVass  362
            IVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTK L+KSG L+ PFTRQENTVIQTCVVASS
Sbjct  74   IVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASS  133

Query  363  giafsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRK  542
            GIAFSGGFGS++F MSE VA+Q T   +    KNP + WM GFLFVVSFLGLF+VVPLRK
Sbjct  134  GIAFSGGFGSFLFAMSERVARQSTDPQSAPVYKNPSLLWMTGFLFVVSFLGLFAVVPLRK  193

Query  543  VMIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            +MIIDFKL+YPSGTATAHLINSFHTP+GAKLAKKQV+ LG
Sbjct  194  IMIIDFKLSYPSGTATAHLINSFHTPEGAKLAKKQVKALG  233



>ref|XP_009135543.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=713

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  48   VEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  107

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +AKQ   A
Sbjct  108  VKTWTKVLYKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQSGDA  167

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +     K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  168  S--RGFKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  225

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  226  QGAKLAKKQVRMLG  239



>ref|XP_002891428.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67687.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IFES+EVPSW+NQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKNQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS  +A Q    
Sbjct  116  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQS--G  173

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  174  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  233

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  234  QGAKLAKKQVRVLG  247



>ref|XP_006300806.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
 gb|EOA33704.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
Length=694

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 175/196 (89%), Gaps = 2/196 (1%)
 Frame = +3

Query  81   VERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VER+FE S EVP  W+NQLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  32   VERVFEQSNEVPPPWQNQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  91

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ +AKQ  
Sbjct  92   FFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVIAKQSA  151

Query  435  IANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFH  614
             AN+  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATA LINSFH
Sbjct  152  EANSAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATATLINSFH  211

Query  615  TPQGAKLAKKQVRTLG  662
            TPQGAKLAKKQVR LG
Sbjct  212  TPQGAKLAKKQVRALG  227



>emb|CAN72423.1| hypothetical protein VITISV_014262 [Vitis vinifera]
Length=684

 Score =   238 bits (608),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 156/195 (80%), Positives = 173/195 (89%), Gaps = 1/195 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IF+ +  PSWR QLT RAF VSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  24   VEMIFKGQVEPSWREQLTIRAFVVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  83

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K+WTK +EKSG LK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS +VA Q +  
Sbjct  84   LKSWTKLMEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSTVAGQSSET  143

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N  +N K+P ++W+IGFLF VSFLGLFSV+PLRK+MIID+KLTYPSGTATAHLINSFHTP
Sbjct  144  NAAQNTKDPSLSWIIGFLFAVSFLGLFSVLPLRKIMIIDYKLTYPSGTATAHLINSFHTP  203

Query  621  QGAKLAKK-QVRTLG  662
            QGAKLAK  QVRTLG
Sbjct  204  QGAKLAKNIQVRTLG  218



>ref|XP_010943908.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=731

 Score =   239 bits (610),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 152/194 (78%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER+F+ K VPSWR Q+TFRA  V+F L V+F+FIVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  65   IERVFDGKPVPSWREQVTFRAMVVAFFLSVMFSFIVMKLNLTTGIIPSLNVAAGLLGFFF  124

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTK LEK+G L+  FTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMSE +A Q T A
Sbjct  125  IKTWTKVLEKTGLLQQAFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSERIANQATEA  184

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +N +N+K+PG+ WMIGFLFVVSFLGLFS+VPLRK+MIID+KL YPSGTATA LIN FHTP
Sbjct  185  DNAQNVKDPGLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  244

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVRTLG
Sbjct  245  QGAKLAKKQVRTLG  258



>gb|KHG02257.1| putative metal-nicotianamine transporter YSL5 -like protein [Gossypium 
arboreum]
Length=696

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 173/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFE +EVP W+ QLT RAF VSFVL +LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VEQIFEKREVPPWKKQLTMRAFAVSFVLSILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE VAKQ   +
Sbjct  98   VKTWTKLLSKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERVAKQ---S  154

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +    KNP + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  155  GDNGGFKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  214

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+TLG
Sbjct  215  QGAKLAKKQVKTLG  228



>ref|XP_010487657.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SGFLK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  104  VKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQS--G  161

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  162  DAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  221

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  222  QGAKLAKKQVRVLG  235



>emb|CDY68937.1| BnaCnng61140D, partial [Brassica napus]
Length=735

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +AKQ   A
Sbjct  109  VKTWTKVLYKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQSGDA  168

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +     K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  169  S--RGFKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  226

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  227  QGAKLAKKQVRMLG  240



>gb|KCW57904.1| hypothetical protein EUGRSUZ_H00651 [Eucalyptus grandis]
Length=683

 Score =   238 bits (607),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 152/192 (79%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  87   RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  266
            + FESKEVPSWR QLT RAF VSFVL V+F+FIVMKLNLTTGIIPSLNVSAGLLGFFF+K
Sbjct  32   KAFESKEVPSWRQQLTVRAFAVSFVLSVMFSFIVMKLNLTTGIIPSLNVSAGLLGFFFIK  91

Query  267  TWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANN  446
            TWTK LEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+F MS  +A Q      
Sbjct  92   TWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSGRIASQAESGPG  151

Query  447  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQG  626
              + K+P + W+IGFLF+VSF+GL SVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP+G
Sbjct  152  TNDYKDPSLGWIIGFLFIVSFVGLLSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPEG  211

Query  627  AKLAKKQVRTLG  662
            AKLAKKQVR LG
Sbjct  212  AKLAKKQVRALG  223



>gb|KJB26835.1| hypothetical protein B456_004G262100 [Gossypium raimondii]
Length=697

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 174/194 (90%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFE++EVP W+ QLT RAF VSFVL +LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  39   VEQIFENREVPPWKKQLTMRAFAVSFVLSILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  98

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE VAKQ   +
Sbjct  99   VKTWTKLLSKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERVAKQ---S  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +    KNP + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  156  GDNGGFKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  215

Query  621  QGAKLAKKQVRTLG  662
            QGAKLA+KQV+TLG
Sbjct  216  QGAKLARKQVKTLG  229



>gb|KJB75155.1| hypothetical protein B456_012G027400 [Gossypium raimondii]
Length=690

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IF+S+EVP W+NQLT RAF VSF+L ++F+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  33   VEEIFQSQEVPLWKNQLTIRAFGVSFLLSIMFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  92

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L+KSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +AKQ   +
Sbjct  93   VKTWTKMLQKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAKQ---S  149

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  + KNP + W+IGFLFVVSFLGLFSV+PLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  150  DDNGSFKNPSLGWIIGFLFVVSFLGLFSVLPLRKIMVIDFKLTYPSGTATAHLINSFHTP  209

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  210  QGAKLAKKQVRALG  223



>ref|XP_010039025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48662.1| hypothetical protein EUGRSUZ_K02318 [Eucalyptus grandis]
Length=707

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE + VPSWR QLTFRAF VSF L V+F FIVMKLNL TGIIPSLNVSAGLLGFFF
Sbjct  45   VERIFEGQGVPSWRRQLTFRAFAVSFALNVMFAFIVMKLNLMTGIIPSLNVSAGLLGFFF  104

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+F M+E VA Q T  
Sbjct  105  VKTWTKVLEKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMNERVANQSTDT  164

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +    KNP + WMIGFLFVVSFLGL +VVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  165  QSAHVYKNPSLLWMIGFLFVVSFLGLLAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  224

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  225  EGAKLAKKQVKALG  238



>ref|XP_010037024.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48658.1| hypothetical protein EUGRSUZ_K02315 [Eucalyptus grandis]
Length=713

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE + VPSWR QLTFRAF VSFVL V+F FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  51   VERIFEGQGVPSWRGQLTFRAFAVSFVLSVMFAFIVMKLNLTAGIIPSLNVSAGLLGFFF  110

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L+KSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+F MS+ VA Q    
Sbjct  111  VKTWTKVLDKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSKRVADQSKDP  170

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               +  K+P ++WMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  171  QRAQVFKDPSLSWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  230

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  231  EGAKLAKKQVKALG  244



>ref|XP_003548294.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Glycine max]
 gb|KHN24500.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=702

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 175/194 (90%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VERVFQHLLVPSWRNQLTVRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKS  L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +AKQ   +
Sbjct  104  VKTWTKFLEKSNMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIAKQ---S  160

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++P + K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  161  SDPSHFKDPKLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  220

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  221  QGAKLAKKQVKMLG  234



>ref|XP_010037026.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48663.1| hypothetical protein EUGRSUZ_K02319 [Eucalyptus grandis]
Length=714

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
             ERIFE + VPSW  QLTFRAF VSF+L ++F FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  52   AERIFEGQAVPSWGRQLTFRAFAVSFMLSIMFAFIVMKLNLTAGIIPSLNVSAGLLGFFF  111

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L+KSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+F MS  VA Q T  
Sbjct  112  VKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSARVAGQSTDP  171

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +    KNP +AWMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  172  QSAHVFKNPSLAWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  231

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  232  QGAKLAKKQVKALG  245



>ref|XP_010551587.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Tarenaya hassleriana]
Length=694

 Score =   238 bits (606),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 158/197 (80%), Positives = 174/197 (88%), Gaps = 3/197 (2%)
 Frame = +3

Query  81   VERIFESKEV--PSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE      P W+NQLT RA  VSFVL ++FTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  24   VERIFEESGAVPPPWQNQLTIRALVVSFVLSIMFTFVVMKLNLTTGIIPSLNISAGLLGF  83

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G+LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ++
Sbjct  84   FFVKTWTKLLHKAGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQIS  143

Query  435  IANNPE-NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSF  611
               +P   IKNP + WMIGFLFVVSF+GLFSVVPLRK+MI+DFKLTYPSGTATAHLINSF
Sbjct  144  PEPSPPMTIKNPQLGWMIGFLFVVSFIGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  203

Query  612  HTPQGAKLAKKQVRTLG  662
            HTPQGAKLAKKQVRTLG
Sbjct  204  HTPQGAKLAKKQVRTLG  220



>ref|XP_007211297.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
 gb|EMJ12496.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
Length=731

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 173/194 (89%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE + VPSW+ QLT RAF +SFVL VLF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  67   VERIFEQQIVPSWKEQLTVRAFFISFVLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  126

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTKFL++ G LK PFTRQENTVIQTCVVASS IAFSGGFG+Y+FGMS  +A+Q T  
Sbjct  127  VRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSSIAFSGGFGNYLFGMSARIAQQST-D  185

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+  +IK+PG+ W IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  186  NSTSDIKDPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  245

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  246  QGAKLAKKQVKELG  259



>emb|CDY46051.1| BnaC01g34980D [Brassica napus]
Length=960

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW  QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +AKQ    
Sbjct  107  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQS--G  164

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  165  DVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  225  QGAKLAKKQVRVLG  238



>gb|ABB76762.1| YSL transporter 2 [Noccaea caerulescens]
 gb|ABD04074.1| YSL transporter 2 [Noccaea caerulescens]
Length=716

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VEKIFESREVPSWKKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG+LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q   A
Sbjct  109  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSGDA  168

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +     K+P + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  169  S--RGFKDPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  226

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  227  QGAKLAKKQVRVLG  240



>ref|XP_003533289.1| PREDICTED: probable metal-nicotianamine transporter YSL8-like 
[Glycine max]
Length=703

 Score =   237 bits (605),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 157/194 (81%), Positives = 174/194 (90%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  45   VERVFQHLLVPSWRNQLTVRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  104

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKS  L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +AKQ   +
Sbjct  105  VKTWTKFLEKSNMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIAKQ---S  161

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  + K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  162  SDTGHFKDPKLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  221

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  222  QGAKLAKKQVKMLG  235



>ref|XP_010551578.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Tarenaya hassleriana]
Length=686

 Score =   236 bits (603),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 158/197 (80%), Positives = 174/197 (88%), Gaps = 3/197 (2%)
 Frame = +3

Query  81   VERIFESKEV--PSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  254
            VERIFE      P W+NQLT RA  VSFVL ++FTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  24   VERIFEESGAVPPPWQNQLTIRALVVSFVLSIMFTFVVMKLNLTTGIIPSLNISAGLLGF  83

Query  255  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT  434
            FFVKTWTK L K+G+LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS+ VAKQ++
Sbjct  84   FFVKTWTKLLHKAGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQIS  143

Query  435  IANNPE-NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSF  611
               +P   IKNP + WMIGFLFVVSF+GLFSVVPLRK+MI+DFKLTYPSGTATAHLINSF
Sbjct  144  PEPSPPMTIKNPQLGWMIGFLFVVSFIGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  203

Query  612  HTPQGAKLAKKQVRTLG  662
            HTPQGAKLAKKQVRTLG
Sbjct  204  HTPQGAKLAKKQVRTLG  220



>ref|XP_004953195.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like 
[Setaria italica]
Length=724

 Score =   237 bits (604),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 147/219 (67%), Positives = 180/219 (82%), Gaps = 0/219 (0%)
 Frame = +3

Query  6    RGEPESGEDLGIdskknedsseseCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFI  185
            +G  E+G+D G+       + ++  VER+F  K VPSWR QLT RAF VS +L V+F+ I
Sbjct  35   KGAGEAGDDEGMCGNGTAGAGDAASVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVI  94

Query  186  VMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassg  365
            VMKLNLTTGIIPSLNVSAGLLGFFFV+ WT  +E+ GFL+ PFTRQENTVIQTCVV++ G
Sbjct  95   VMKLNLTTGIIPSLNVSAGLLGFFFVRMWTAAVERMGFLRQPFTRQENTVIQTCVVSAYG  154

Query  366  iafsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKV  545
            IAFSGGFGSY+FGMS+ +A Q T A +  NIK+P + WMIGFLF+VSF+GL ++VPLRK+
Sbjct  155  IAFSGGFGSYLFGMSDKIANQATEAKDANNIKDPHLGWMIGFLFLVSFIGLLALVPLRKI  214

Query  546  MIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            MI+D+KLTYPSGTATA+LIN FHTP+GAKLAKKQV+TLG
Sbjct  215  MIVDYKLTYPSGTATAYLINGFHTPEGAKLAKKQVKTLG  253



>ref|XP_007152542.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
 gb|ESW24536.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
Length=701

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERVFQHLLVPSWRNQLTGRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKSG L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +A Q T  
Sbjct  103  VKTWTKFLEKSGMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIANQST--  160

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  + K+P + W+I FLFVVSFLGLFSVVPLRK+M++DFKLTYPSGTATAHLINSFHTP
Sbjct  161  -DTSDFKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMVVDFKLTYPSGTATAHLINSFHTP  219

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  220  QGAKLAKKQVKMLG  233



>ref|XP_010465820.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SGFLK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  104  VKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQS--G  161

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  162  DAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  221

Query  621  QGAKLAKKQVRTLG  662
            QG KLAKKQVR LG
Sbjct  222  QGVKLAKKQVRVLG  235



>ref|XP_010505667.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Camelina sativa]
Length=711

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SGFLK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  104  VKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQS--G  161

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  162  DAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  221

Query  621  QGAKLAKKQVRTLG  662
            QG KLAKKQVR LG
Sbjct  222  QGVKLAKKQVRVLG  235



>ref|NP_564525.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
 sp|Q6R3K4.2|YSL8_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL8; 
AltName: Full=Protein YELLOW STRIPE LIKE 8; Short=AtYSL8 [Arabidopsis 
thaliana]
 gb|AAK62655.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AAQ65095.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AEE32281.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 167/194 (86%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS  +A Q    
Sbjct  116  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQS--G  173

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  174  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  233

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  234  QGAKLAKKQVRVLG  247



>ref|NP_001185468.1| yellow stripe-like transporter 12 [Zea mays]
 gb|ADO20999.1| yellow stripe-like transporter 12 [Zea mays]
 gb|AFW58896.1| hypothetical protein ZEAMMB73_279911 [Zea mays]
Length=718

 Score =   237 bits (604),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 145/194 (75%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  59   VERAFADQAVPSWREQLTVRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  118

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G L+ PFTRQENTVIQTCVVA+  IAFSGGFG+Y+FGMSE++AKQ T A
Sbjct  119  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATEA  178

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +NP+N+KNP + WMIGFLF+VSF+GLF++VPLRKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  179  DNPQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKVMIVDYKLTYPSGTATAYLINGFHTP  238

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  239  EGAKLAKKQVKTLG  252



>ref|XP_004976283.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=718

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE + VPSWR QLT RAF VSF L V+F+ IVMKLNLTTGIIPSLNVSAGLL FFF
Sbjct  59   VERAFEGQPVPSWREQLTVRAFVVSFFLSVMFSVIVMKLNLTTGIIPSLNVSAGLLSFFF  118

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WTK +E  G L+ PFTRQENTVIQTCVVA+  IAFSGGFG+Y+FGMSE++AKQ T A
Sbjct  119  VRLWTKAIESMGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATEA  178

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NNP+N+KNP + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  179  NNPQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  238

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  239  EGAKLAKKQVKALG  252



>ref|XP_006393421.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
 gb|ESQ30707.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
Length=721

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 169/194 (87%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MSE +A Q    
Sbjct  116  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIAIQS--G  173

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  174  DVARGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  233

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  234  QGAKLAKKQVRVLG  247



>ref|XP_006297072.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
 gb|EOA29970.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
Length=714

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQS--G  164

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  165  DGYRGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVR LG
Sbjct  225  LGAKLAKKQVRVLG  238



>ref|NP_566584.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 sp|Q9LUN2.1|YSL5_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL5; 
AltName: Full=Protein YELLOW STRIPE LIKE 5; Short=AtYSL5 [Arabidopsis 
thaliana]
 dbj|BAB02055.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS00694.1| metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 gb|AEE75985.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
Length=714

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWKKQLTVRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQS--G  164

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  165  DVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  225  QGAKLAKKQVRVLG  238



>ref|XP_010549024.1| PREDICTED: probable metal-nicotianamine transporter YSL8 isoform 
X1 [Tarenaya hassleriana]
Length=703

 Score =   235 bits (600),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 157/194 (81%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  41   VERIFESREVPSWKKQLTVRAFVVSFGLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  100

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMS+ VAK     
Sbjct  101  LKTWTKVLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSQRVAKHA--G  158

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++    K+P + W++GFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  159  DSYLGFKDPSLGWIMGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  218

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  219  QGAKLAKKQVRVLG  232



>ref|XP_008436975.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL5 [Cucumis melo]
Length=693

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 171/194 (88%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  37   IEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  96

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WTKFLE+SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A +   A
Sbjct  97   VKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHK---A  153

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +   + K+P + WMIGF FVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  154  SGSRDFKDPSLGWMIGFXFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  213

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQVR LG
Sbjct  214  RGAALAKKQVRLLG  227



>ref|XP_002446809.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
 gb|EES11137.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
Length=722

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  + VPSWR QLT RAF VSF L V+F+ IVMKL LTTGIIPSLNVSAGLLGFFF
Sbjct  63   VERVFAEQAVPSWREQLTVRAFVVSFFLAVMFSIIVMKLGLTTGIIPSLNVSAGLLGFFF  122

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G LK PFTRQENTVIQTCVVA+  IAFSGGFG+Y+FGMSE++AKQ T A
Sbjct  123  VRLWTAAIERVGLLKQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATEA  182

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++P+N+KNP + WMIGFLF+ SF+GLF++VPLRKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  183  DDPQNVKNPHIGWMIGFLFLASFIGLFALVPLRKVMIVDYKLTYPSGTATAYLINGFHTP  242

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  243  EGAKLAKKQVKTLG  256



>ref|XP_011035385.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
Length=704

 Score =   235 bits (600),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 154/194 (79%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIF  + VPSWRNQLT RAF VSF+L VLF+FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  39   VERIFAKQGVPSWRNQLTRRAFGVSFILSVLFSFIVMKLNLTAGIIPSLNVSAGLLGFFF  98

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWT+FLE  G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS  +A++    
Sbjct  99   VKTWTRFLESCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGRIAQESADQ  158

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + ++IK+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKL YPSGTATAHLINSFHTP
Sbjct  159  PSAKDIKDPALGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLIYPSGTATAHLINSFHTP  218

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVR LG
Sbjct  219  EGAKLAKKQVRALG  232



>ref|XP_004515282.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Cicer arietinum]
Length=709

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 173/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VEKVFKHLLVPSWRNQLTIRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKS  LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE VAKQ   +
Sbjct  109  VKTWTKFLEKSDMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEHVAKQ---S  165

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  + K+P + W+I FLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  166  SDTSDFKDPKLVWIIAFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  225

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  226  QGAKLAKKQVKVLG  239



>ref|XP_002883075.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59334.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
Length=714

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW  QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWTKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQS--G  164

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  165  DVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  225  QGAKLAKKQVRVLG  238



>ref|XP_003580167.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Brachypodium 
distachyon]
Length=717

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE K VP+WR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  57   VERAFEGKAVPTWREQLTLRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  116

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ GFL+ PFTRQENTVIQTCVVA+  IAFSGGFG+Y+F MS+++A Q T A
Sbjct  117  VRLWTGAIERMGFLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLFAMSDTIANQTTEA  176

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +NIKNP V WMI FLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  177  KDAQNIKNPHVGWMIAFLFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  236

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  237  EGAKLAKKQVKTLG  250



>gb|KGN64213.1| hypothetical protein Csa_1G043160 [Cucumis sativus]
Length=693

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  37   IEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  96

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WTKFLE+SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A +   A
Sbjct  97   VKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHK---A  153

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +   + K+P + WMIGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  154  SGSRDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  213

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQVR LG
Sbjct  214  RGAALAKKQVRLLG  227



>ref|XP_004165464.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=698

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  42   IEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  101

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WTKFLE+SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A +   A
Sbjct  102  VKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHK---A  158

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +   + K+P + WMIGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  159  SGSRDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  218

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQVR LG
Sbjct  219  RGAALAKKQVRLLG  232



>gb|AAS00697.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 167/194 (86%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IFES+EVPSW+ QLT RAF VSF L +LF+F+VMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFVVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS  +A Q    
Sbjct  116  VETWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQS--G  173

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  174  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  233

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  234  QGAKLAKKQVRVLG  247



>ref|XP_009420946.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   234 bits (597),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  F+ + VP WR QLT RAF VS VLG +F+ IVMKLNLTTG+IPSLNVSAGLLGFFF
Sbjct  37   IESEFDGERVPPWREQLTARAFAVSLVLGAMFSVIVMKLNLTTGVIPSLNVSAGLLGFFF  96

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWT  L ++G L+ PFTRQENTVIQTCVVA+SGIA SGGFGSY+F MSE++AKQ T A
Sbjct  97   VRTWTVALGRAGLLRQPFTRQENTVIQTCVVATSGIASSGGFGSYLFAMSETIAKQSTEA  156

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIKNP + WMIGFLFVVSFLGLFS+VPLRK+MI+D+KL YPSGTATAHLINSFHTP
Sbjct  157  NDSQNIKNPKLGWMIGFLFVVSFLGLFSLVPLRKIMIVDYKLIYPSGTATAHLINSFHTP  216

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVRTLG
Sbjct  217  QGAKLAKKQVRTLG  230



>ref|XP_004137637.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=723

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  67   IEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  126

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WTKFLE+SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A +   A
Sbjct  127  VKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHK---A  183

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +   + K+P + WMIGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  184  SGSRDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  243

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQVR LG
Sbjct  244  RGAALAKKQVRLLG  257



>ref|XP_009107360.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Brassica 
rapa]
 emb|CDY41835.1| BnaA08g03300D [Brassica napus]
Length=718

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  53   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  112

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MSE +A      
Sbjct  113  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIANHS--G  170

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  171  DAARGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  230

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAK+QVR LG
Sbjct  231  QGAKLAKEQVRVLG  244



>ref|XP_006441429.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
 gb|ESR54669.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
Length=703

 Score =   234 bits (596),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 158/194 (81%), Positives = 169/194 (87%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F+ KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLE S  L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+ GMS+ +A Q    
Sbjct  103  VKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIALQSEDT  162

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N     KN  + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LINSFHTP
Sbjct  163  N--LGYKNLSLTWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTP  220

Query  621  QGAKLAKKQVRTLG  662
            +GA+LAKKQVRTLG
Sbjct  221  EGARLAKKQVRTLG  234



>gb|KFK36098.1| hypothetical protein AALP_AA4G077100 [Arabis alpina]
Length=713

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  90   IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  269
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIP+LNVSAGLLGFFFVKT
Sbjct  51   IFESREVPSWKKQLTIRAFVVSFFLSILFSFIVMKLNLTTGIIPTLNVSAGLLGFFFVKT  110

Query  270  WTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNP  449
            WTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MSE +A Q    +  
Sbjct  111  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIANQS--GDAA  168

Query  450  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGA  629
              IK+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTPQGA
Sbjct  169  RGIKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPQGA  228

Query  630  KLAKKQVRTLG  662
            KLAKKQVR LG
Sbjct  229  KLAKKQVRVLG  239



>ref|XP_010501891.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=627

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  90   IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  269
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  59   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  118

Query  270  WTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNP  449
            WTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS+ +A Q    +  
Sbjct  119  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQS--GDAF  176

Query  450  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGA  629
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTPQGA
Sbjct  177  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  236

Query  630  KLAKKQVRTLG  662
            KLAKKQVR LG
Sbjct  237  KLAKKQVRVLG  247



>ref|XP_003620154.1| Yellow stripe-like protein 2.1 [Medicago truncatula]
 gb|AES76372.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=712

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E++F+   VPSWRNQLT RAF VSF L VLF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  54   IEKVFKHLLVPSWRNQLTIRAFVVSFFLSVLFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  113

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLEKS  LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE VA Q   +
Sbjct  114  VKTWTKFLEKSDMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEHVATQ---S  170

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  + K+P + W+I FLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHTP
Sbjct  171  SDTSDFKDPKLGWIIAFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  230

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  231  QGAKLAKKQVKLLG  244



>ref|XP_007210334.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
 gb|EMJ11533.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
Length=731

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE + VPSW+ QLT RAF +S VL VLF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  67   VERIFEQQTVPSWKEQLTVRAFFISLVLSVLFSLIVMKLNLTTGIIPSLNVSAGLLGFFF  126

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTKFL++ G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS  +A+Q +  
Sbjct  127  VRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSARIAQQ-SAD  185

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  +IK PG+ W IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  186  SSTSDIKEPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  245

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  246  QGAKLAKKQVKELG  259



>ref|XP_010933277.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=727

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE K VP+WR QLT RAF VSF L VLF+ IVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  61   MEKAFEGKRVPTWREQLTLRAFVVSFFLSVLFSIIVMKLNLTTGIIPSLNVAAGLLGFFF  120

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTK LEK+G L+ PFTRQENTVIQTC VA+  IAFSGGFGSY+FGMS  +AKQ + A
Sbjct  121  IKTWTKALEKTGLLRLPFTRQENTVIQTCCVAAYDIAFSGGFGSYLFGMSGRIAKQASEA  180

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN ++IK+P + WMIGFLFVVSFLGLFS+VPLRK+MIID+KL YPSGTATA LIN FHTP
Sbjct  181  NNEQDIKDPKLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  240

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  241  EGAKLAKKQVRTLG  254



>dbj|BAE44205.1| hypothetical protein [Oryza sativa Japonica Group]
Length=727

 Score =   233 bits (593),  Expect = 6e-68, Method: Composition-based stats.
 Identities = 145/194 (75%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  64   VERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  123

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G LK PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMSE++AKQ T A
Sbjct  124  VRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETIAKQATEA  183

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  184  KDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  243

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  244  EGAKLAKKQVKTLG  257



>ref|XP_006653608.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Oryza brachyantha]
Length=693

 Score =   232 bits (592),  Expect = 6e-68, Method: Composition-based stats.
 Identities = 143/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  32   VERVFADRPVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  91

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G L+ PFTRQENTVIQTCVVA+  IAFSGGFG+Y+FGMSE++AKQ T A
Sbjct  92   VRLWTAAIERLGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATEA  151

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +N+KNP + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  152  NDAQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  211

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  212  EGAKLAKKQVKTLG  225



>ref|XP_008801345.1| PREDICTED: probable metal-nicotianamine transporter YSL12 isoform 
X1 [Phoenix dactylifera]
Length=729

 Score =   233 bits (593),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 147/194 (76%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E++F+ K +P WR QLTFRA  VSF L V+F+FIVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  63   IEKLFDGKPLPGWREQLTFRAMVVSFFLSVMFSFIVMKLNLTTGIIPSLNVAAGLLGFFF  122

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTW+K LEK+G L+  FTRQENTVIQTCVVA+SG+AFSGGFGSY+FGMSE++AKQ T A
Sbjct  123  IKTWSKALEKTGLLRQAFTRQENTVIQTCVVAASGVAFSGGFGSYLFGMSETIAKQATEA  182

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +N +N+K+PG+ WMIGFLFVVSFLGLFS+VPLRK+MI+D+KL YPSGTATA LIN FHTP
Sbjct  183  DNAQNVKDPGLGWMIGFLFVVSFLGLFSLVPLRKIMIVDYKLIYPSGTATAFLINGFHTP  242

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV  LG
Sbjct  243  QGAKLAKKQVSILG  256



>sp|Q5JQD7.2|YSL12_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL12; 
AltName: Full=Protein YELLOW STRIPE LIKE 12; Short=OsYSL12 
[Oryza sativa Japonica Group]
 emb|CAH67886.1| OSIGBa0153E02-OSIGBa0093I20.15 [Oryza sativa Indica Group]
Length=717

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VERAFVDRAVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G L+ PFTRQENTVIQTCVVA+ GIAFSGGFG+Y+FGMSE++AKQ T A
Sbjct  116  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQATEA  175

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +N+KNP + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  176  NNAQNVKNPHIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  235

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  236  EGAKLAKKQVKELG  249



>ref|XP_006648859.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like, 
partial [Oryza brachyantha]
Length=694

 Score =   232 bits (591),  Expect = 9e-68, Method: Composition-based stats.
 Identities = 143/194 (74%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  31   VERVFADKAVPSWREQLTLRAFVVSALLSVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  90

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G L+ PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMSE++AKQ T A
Sbjct  91   VRLWTSAVERMGLLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETIAKQATEA  150

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +NIK+P + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  151  KDAQNIKDPHLGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  210

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  211  EGAKLAKKQVKTLG  224



>gb|AAL09744.1| AT3g17650/MKP6_20 [Arabidopsis thaliana]
 gb|AAN46868.1| At3g17650/MKP6_20 [Arabidopsis thaliana]
Length=714

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWKKQLTVRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L +SG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQS--G  164

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLINSFHT 
Sbjct  165  DVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTT  224

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVR LG
Sbjct  225  QGAKLAKKQVRVLG  238



>sp|Q6H7J6.1|YSL14_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL14; 
AltName: Full=Protein YELLOW STRIPE LIKE 14; Short=OsYSL14 
[Oryza sativa Japonica Group]
 dbj|BAD25303.1| oligopeptide transporter OPT-like [Oryza sativa Japonica Group]
Length=727

 Score =   232 bits (592),  Expect = 9e-68, Method: Composition-based stats.
 Identities = 145/194 (75%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  64   VERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  123

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G LK PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMSE++AKQ T A
Sbjct  124  VRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETIAKQATEA  183

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  184  KDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  243

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  244  EGAKLAKKQVKTLG  257



>ref|XP_008240337.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Prunus 
mume]
Length=735

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE + VPSW+ QLT RAF +S VL VLF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  69   VERIFEKQTVPSWKEQLTVRAFFISLVLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  128

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTKFL++ G LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMS  +A+Q +  
Sbjct  129  VRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSARIAQQ-SAD  187

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  +IK PG+ W IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  188  RSTRDIKEPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  247

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQV+ LG
Sbjct  248  QGAKLAKKQVKELG  261



>gb|AEQ28190.1| yellow stripe-like protein 5 [Malus baccata var. xiaojinensis]
Length=733

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 174/194 (90%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++FE++ VPSWR QLTFRAF +SFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  69   VEKLFENQPVPSWREQLTFRAFFISFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  128

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTKFLE+ G L  PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +A+Q   +
Sbjct  129  VRTWTKFLERCGLLNQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQ---S  185

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  + K+PG+ W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  186  KDRSDTKDPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  245

Query  621  QGAKLAKKQVRTLG  662
            +G KLAKKQVR LG
Sbjct  246  EGVKLAKKQVRELG  259



>ref|XP_010461657.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=721

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  90   IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  269
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  58   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  117

Query  270  WTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNP  449
            WTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS+ +A Q    +  
Sbjct  118  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQS--GDAF  175

Query  450  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGA  629
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTPQGA
Sbjct  176  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  235

Query  630  KLAKKQVRTLG  662
            KLAKKQVR LG
Sbjct  236  KLAKKQVRVLG  246



>ref|XP_010479258.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=722

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  90   IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  269
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  58   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  117

Query  270  WTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNP  449
            WTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS+ +A Q    +  
Sbjct  118  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQS--GDAF  175

Query  450  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGA  629
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTPQGA
Sbjct  176  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  235

Query  630  KLAKKQVRTLG  662
            KLAKKQVR LG
Sbjct  236  KLAKKQVRVLG  246



>ref|XP_008676713.1| PREDICTED: uncharacterized protein LOC100272237 isoform X1 [Zea 
mays]
 gb|ACN34648.1| unknown [Zea mays]
 gb|ADG21035.1| oligopeptide transporter [Zea mays]
 gb|ADO21000.1| yellow stripe-like transporter 14A [Zea mays]
 gb|AFW63091.1| transposon protein [Zea mays]
Length=716

 Score =   231 bits (590),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 144/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  52   VERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  111

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT   E+ GFL+ PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMS+ +AKQ T A
Sbjct  112  VRMWTAAAERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATEA  171

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  172  KDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  231

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  232  EGAKLAKKQVKTLG  245



>ref|NP_001152285.1| yellow stripe-like transporter 14A [Zea mays]
 gb|ACG46801.1| transposon protein [Zea mays]
Length=716

 Score =   231 bits (590),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 144/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  52   VERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  111

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT   E+ GFL+ PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMS+ +AKQ T A
Sbjct  112  VRMWTAAAERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATEA  171

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  172  KDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  231

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  232  EGAKLAKKQVKTLG  245



>gb|KDO46150.1| hypothetical protein CISIN_1g005295mg [Citrus sinensis]
Length=703

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 169/194 (87%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F+ KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLE S  L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+ GMS+ +A Q    
Sbjct  103  VKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIALQSEDT  162

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N     KN  + W+IGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LINSFHTP
Sbjct  163  N--LGYKNLSLTWIIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  220

Query  621  QGAKLAKKQVRTLG  662
            +GA+LAKKQVRTLG
Sbjct  221  EGARLAKKQVRTLG  234



>ref|XP_008645969.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Zea 
mays]
 gb|AFW72448.1| hypothetical protein ZEAMMB73_917654 [Zea mays]
Length=721

 Score =   231 bits (590),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 142/194 (73%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER+F  K VPSWR QLT RAF VS +L V+F  IVMKLNLTTGI+PSLNVSAGLLGFFF
Sbjct  57   LERVFADKAVPSWREQLTLRAFVVSALLAVMFNVIVMKLNLTTGIVPSLNVSAGLLGFFF  116

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ GFL HPFTRQENT+IQTCVV++ GIAFSGGFGSY+FGMS+ +AKQ T A
Sbjct  117  VRMWTAAVERMGFLCHPFTRQENTIIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATEA  176

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  177  KDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  236

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  237  EGAKLAKKQVKTLG  250



>ref|XP_006306886.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
 gb|EOA39784.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
Length=723

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  90   IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  269
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  60   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  119

Query  270  WTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNP  449
            WTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS+ +A Q    +  
Sbjct  120  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQS--GDAF  177

Query  450  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGA  629
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTPQGA
Sbjct  178  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  237

Query  630  KLAKKQVRTLG  662
            KLAKKQVR LG
Sbjct  238  KLAKKQVRVLG  248



>ref|XP_008393519.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Malus 
domestica]
Length=733

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 174/194 (90%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++FE++ VPSWR QLTFRAF +SFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  69   VEKLFENQPVPSWREQLTFRAFFISFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  128

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTKFLE+ G L  PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE +A+Q   +
Sbjct  129  VRTWTKFLERCGLLNQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQ---S  185

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  + K+PG+ W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LINSFHTP
Sbjct  186  KDRSDTKDPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTP  245

Query  621  QGAKLAKKQVRTLG  662
            +G KLAKKQVR LG
Sbjct  246  EGVKLAKKQVRELG  259



>ref|XP_006493428.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Citrus sinensis]
Length=703

 Score =   229 bits (585),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 158/194 (81%), Positives = 167/194 (86%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F+ KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTKFLE S  L+ PFTRQENTVIQTCVVASSGIAFSGGFGSY+ GMS+ +A Q    
Sbjct  103  VKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIAIQSEDT  162

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N     KN  + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LINSFHT 
Sbjct  163  N--LGYKNLSLTWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTT  220

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQVRTLG
Sbjct  221  AGAKLAKKQVRTLG  234



>gb|AET00398.2| OPT family oligopeptide transporter [Medicago truncatula]
Length=682

 Score =   229 bits (584),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE K VPSW+ Q+T RA  VS +L V+FTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  22   IEKGFEGKSVPSWQKQVTVRAIVVSIMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  81

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEK+G+L  PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS ++AKQ+  A
Sbjct  82   VKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSPTIAKQIPEA  141

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
                ++K+ G+ WMI FLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFHT 
Sbjct  142  GTANDVKSLGLGWMIAFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHTS  201

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  202  EGAKLAKKQVKALG  215



>ref|XP_009383038.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   229 bits (584),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 145/194 (75%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE + VP+WR QLT RAF VSF L V+F+ IVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  26   VERVFEGQRVPAWREQLTVRAFVVSFFLAVMFSVIVMKLNLTTGIIPSLNVAAGLLGFFF  85

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WTK LE +G L+ PFTRQENTVIQTCVVA+ G+AFSGG+GSY+FGMS  VA Q T  
Sbjct  86   VKLWTKGLESTGLLRTPFTRQENTVIQTCVVAAYGLAFSGGYGSYLFGMSSRVAAQATDD  145

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++ +NIK+P + WMIGF+FVVSFLGLFSVVPLRK+M+ID+KL YPSGTATA+LIN FHTP
Sbjct  146  DDSQNIKDPRLGWMIGFMFVVSFLGLFSVVPLRKIMVIDYKLIYPSGTATAYLINGFHTP  205

Query  621  QGAKLAKKQVRTLG  662
            QG KLAK+QVRTLG
Sbjct  206  QGEKLAKQQVRTLG  219



>ref|XP_003617439.1| Yellow stripe-like protein 2.8 [Medicago truncatula]
Length=690

 Score =   229 bits (584),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE K VPSW+ Q+T RA  VS +L V+FTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  22   IEKGFEGKSVPSWQKQVTVRAIVVSIMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  81

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEK+G+L  PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS ++AKQ+  A
Sbjct  82   VKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSPTIAKQIPEA  141

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
                ++K+ G+ WMI FLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLINSFHT 
Sbjct  142  GTANDVKSLGLGWMIAFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHTS  201

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  202  EGAKLAKKQVKALG  215



>ref|XP_010276313.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=268

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            ER FE KE+P W+NQLT RAF VSF+LG+LFTFIVMK+NLTTGIIPSLNVSAGLLGFFFV
Sbjct  38   ERTFECKEIPPWQNQLTLRAFVVSFLLGILFTFIVMKINLTTGIIPSLNVSAGLLGFFFV  97

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            K+WTK LEKSG L+ PFTRQENT+IQTCVVA SGIAFSGG  SY+ GMS    KQ   AN
Sbjct  98   KSWTKLLEKSGMLRQPFTRQENTIIQTCVVAISGIAFSGGVESYILGMSLFEVKQSAEAN  157

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
              +N+KNP + WMIGFLFVV FLGLFS+VPL K++I+DFKL Y  GTATAHL+NSFH+ Q
Sbjct  158  AAQNVKNPELGWMIGFLFVVLFLGLFSIVPLHKIVIVDFKLAYSCGTATAHLMNSFHSSQ  217

Query  624  GAKLAKKQVRTL  659
              + AK QV+ L
Sbjct  218  DVEFAKNQVKAL  229



>ref|XP_008802875.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Phoenix 
dactylifera]
Length=392

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER FE K VP+WR QLT RA  VSF L V+ + IV KLNLTTGIIPSLNV+AGLLGFFF
Sbjct  72   IERAFEGKRVPTWREQLTLRALVVSFFLSVMLSIIVTKLNLTTGIIPSLNVAAGLLGFFF  131

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +KTWTK LEK+G L+ PFTRQENTVIQTC VA+ GIAFSGGFG+Y+FGMS  +A Q + A
Sbjct  132  IKTWTKALEKTGLLRLPFTRQENTVIQTCCVAAYGIAFSGGFGNYLFGMSGRIANQASEA  191

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +NIK+P + WMIGFLF VSFLGLFSVVPLRK+MIID+KL YPSGTATA LIN FHTP
Sbjct  192  NNEQNIKDPKLGWMIGFLFAVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  251

Query  621  QGAKLAKKQVRTLG  662
            +GAK AKKQVR LG
Sbjct  252  EGAKKAKKQVRALG  265



>ref|XP_002520094.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF42283.1| oligopeptide transporter, putative [Ricinus communis]
Length=694

 Score =   228 bits (581),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 156/194 (80%), Positives = 170/194 (88%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+IFE +EVPSWR QLT RAF VSFVL +LF+FIVMKLNLTTGI+P LNVSAGLLGFFF
Sbjct  34   VEQIFEEQEVPSWRKQLTVRAFLVSFVLSILFSFIVMKLNLTTGILPLLNVSAGLLGFFF  93

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WT FL K   L  PFTRQENTVIQTCVVASSGIAFSGGFGSY+FGMSE++AKQ   A
Sbjct  94   LKIWTSFLSKFRLLSQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETIAKQS--A  151

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  + KNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  152  EDKIDHKNPSLPWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  211

Query  621  QGAKLAKKQVRTLG  662
             GAKLAKKQV+TLG
Sbjct  212  AGAKLAKKQVKTLG  225



>ref|XP_006653609.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like, 
partial [Oryza brachyantha]
Length=670

 Score =   227 bits (579),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  + VP+WR QLT RAF V F+L V+F  IVMKL+LTTG+IPSLNVSA LLGFF 
Sbjct  9    VERVFADRPVPAWREQLTVRAFVVGFLLSVMFNVIVMKLSLTTGVIPSLNVSASLLGFFL  68

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ GFLK PFTRQENTVIQTCVV++ G+AFSGGFGSY+FGMSE++AKQ T A
Sbjct  69   VRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATEA  128

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P N+KNP + W+IGFLF+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  129  NDPLNVKNPHIGWIIGFLFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHTP  188

Query  621  QGAKLAKKQVRTLG  662
            +GA+LAKKQVRTLG
Sbjct  189  EGAELAKKQVRTLG  202



>ref|NP_001276131.1| uncharacterized protein LOC100809484 [Glycine max]
 gb|AFD96645.1| YSL1 [Glycine max]
Length=682

 Score =   228 bits (580),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 149/194 (77%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ FE KEVP W  Q+T R+  VS VLGV+FTFIVMKLNLTTGIIPSLN+SAGLLGFFF
Sbjct  23   VEKAFEGKEVPPWERQVTVRSMVVSLVLGVMFTFIVMKLNLTTGIIPSLNISAGLLGFFF  82

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WTK L KSG L  P+TRQENTVIQTCVVASSGIAFSGGFGSY+FGMS  +AKQ   A
Sbjct  83   VKAWTKLLAKSGMLMQPYTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSSDIAKQSPEA  142

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               ++IK+PG+ WMI F FVVSFLGLFS+VPLRK+MI+DFKLTYPSGTATAHLINSFHT 
Sbjct  143  -TAQDIKDPGLGWMIAFAFVVSFLGLFSLVPLRKIMIVDFKLTYPSGTATAHLINSFHTT  201

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV  LG
Sbjct  202  EGAKLAKKQVNLLG  215



>gb|EMT06635.1| Putative metal-nicotianamine transporter YSL14 [Aegilops tauschii]
Length=711

 Score =   228 bits (581),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  50   VEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT   E+ G + HPFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMS+++AKQ T A
Sbjct  110  VRLWTNAFERMGLVGHPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIAKQATEA  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P NIK P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  170  NDPWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  230  EGAKLAKKQVKILG  243



>ref|XP_002452492.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
 gb|EES05468.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
Length=728

 Score =   228 bits (581),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 142/194 (73%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  K +PSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  64   VERVFADKALPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  123

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ GFL+ PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMS+ +A Q T A
Sbjct  124  VRMWTAAVERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIANQATEA  183

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  184  KDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  243

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  244  EGAKLAKKQVKTLG  257



>ref|XP_002446810.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
 gb|EES11138.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
Length=723

 Score =   228 bits (581),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 142/194 (73%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ FE K VPSWR QLT RAF V F+L +LF+ IVMKLNLTTGIIPSLNVSA LLGFF 
Sbjct  61   VEQAFEDKPVPSWREQLTVRAFVVGFILSILFSVIVMKLNLTTGIIPSLNVSASLLGFFL  120

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WTK +E  G LK PFTRQENTVIQTCVV++ G+AFSGGFGSY+FGMS S+A+Q T A
Sbjct  121  VRLWTKAIESMGLLKQPFTRQENTVIQTCVVSAYGLAFSGGFGSYLFGMSRSIAEQATEA  180

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIK+P + WMIGF+F+VSF+GLF +VPLRKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  181  NDAQNIKDPHLGWMIGFMFLVSFVGLFVLVPLRKVMIVDYKLTYPSGTATAYLINGFHTP  240

Query  621  QGAKLAKKQVRTLG  662
            QGA+ +KKQVRTLG
Sbjct  241  QGAERSKKQVRTLG  254



>ref|XP_004978143.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like 
[Setaria italica]
Length=733

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F  + VPSWR QLT RAF VSF L VLF+ IVMKLNLTTGIIPSLN+SAGLLGFFF
Sbjct  68   VERAFAGQPVPSWREQLTVRAFVVSFFLAVLFSIIVMKLNLTTGIIPSLNISAGLLGFFF  127

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WTK +E  G LK PFTRQENTVIQTCVVAS G+AFSGGFGSY+  MS+ +A   T A
Sbjct  128  VRLWTKAIESVGLLKQPFTRQENTVIQTCVVASYGLAFSGGFGSYLLAMSDKIAAMSTEA  187

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIKNP + W+IGFLF+VSF+GLF +VPLRKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  188  NDAQNIKNPQLGWIIGFLFLVSFIGLFGLVPLRKVMIVDYKLTYPSGTATAYLINGFHTP  247

Query  621  QGAKLAKKQVRTLG  662
            QGAKLA+KQV+ LG
Sbjct  248  QGAKLARKQVKKLG  261



>ref|XP_004500424.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cicer arietinum]
Length=670

 Score =   227 bits (578),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 149/194 (77%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE K VP+W+ Q+T RA  VS VL VLF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  10   VERGFEGKSVPTWQKQVTVRAIFVSMVLSVLFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  69

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG L  PFTRQENTVIQTCVVA+SGIAFSGGFGSY+F MS ++A Q   A
Sbjct  70   VKTWTKLLAKSGLLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFAMSPAIADQSPDA  129

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +   + K+PG+ WMI FLFVVSFLGLFSVVPLRK+MI+DF+LTYPSGTATAHLINSFHT 
Sbjct  130  STAIDTKSPGLGWMISFLFVVSFLGLFSVVPLRKIMIVDFRLTYPSGTATAHLINSFHTT  189

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  190  EGAKLAKKQVKALG  203



>ref|XP_010666835.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=672

 Score =   226 bits (576),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 137/199 (69%), Positives = 154/199 (77%), Gaps = 11/199 (6%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE+ EVP W+ QLT RAF VSF+L +LFTFIVMKLNLTTGIIPSLN+SAGLLGFFF
Sbjct  22   IEKNFEATEVPPWQQQLTLRAFVVSFLLSILFTFIVMKLNLTTGIIPSLNISAGLLGFFF  81

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WTK LEKSGFLK PFTRQENTVIQTC+V       S G        S  +     IA
Sbjct  82   VKCWTKLLEKSGFLKQPFTRQENTVIQTCIV------ASSGIAFSGGAASYVLGMSERIA  135

Query  441  NNPE-----NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIN  605
            N  E     + KNP + WMIGFLFVVSF+GLFSVVPLRK+MIIDFKLTYPSGTATAHLIN
Sbjct  136  NLGEKAYLLDTKNPSLGWMIGFLFVVSFIGLFSVVPLRKIMIIDFKLTYPSGTATAHLIN  195

Query  606  SFHTPQGAKLAKKQVRTLG  662
            SFHTP+GA +AKK+V+ LG
Sbjct  196  SFHTPEGAIIAKKKVKVLG  214



>ref|XP_002449540.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
 gb|EES08528.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
Length=722

 Score =   226 bits (577),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 146/224 (65%), Positives = 181/224 (81%), Gaps = 5/224 (2%)
 Frame = +3

Query  3    RRGEPESGEDL----GIdskknedsseseCVERIFESKEVPSWRNQLTFRAFCVSFVLGV  170
            RRG+P SG+D     G  +++ + ++    VER F  + VPSWR QLT RAF VSF L V
Sbjct  30   RRGKP-SGDDRAARDGPGAEEEDAAAAPSSVERAFADQPVPSWREQLTVRAFVVSFFLAV  88

Query  171  LFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCV  350
            +F+ IVMKLNLTTGIIPSLN+SAGLLGFFFV+ WT+ +E  G L+ PFTRQENTVIQTCV
Sbjct  89   MFSIIVMKLNLTTGIIPSLNISAGLLGFFFVRLWTRAIESVGLLRQPFTRQENTVIQTCV  148

Query  351  VassgiafsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvv  530
            VAS G+AFSGGFGSY+  MS+ +A  +T ANN +NIK+P + W+IGFLF+VSF+GLF +V
Sbjct  149  VASYGLAFSGGFGSYLLAMSDKIAAMVTEANNAQNIKDPQLGWIIGFLFLVSFIGLFGLV  208

Query  531  plRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            PLRK+MI+D+KLTYPSGTATA+LIN FHTPQGA+LA+KQV+ LG
Sbjct  209  PLRKIMIVDYKLTYPSGTATAYLINGFHTPQGARLARKQVKKLG  252



>emb|CAH67887.1| OSIGBa0153E02-OSIGBa0093I20.16 [Oryza sativa Indica Group]
 gb|EAY94901.1| hypothetical protein OsI_16701 [Oryza sativa Indica Group]
Length=712

 Score =   226 bits (577),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  K VPSWR QLT RAF V F+L ++F  IVMKL+LTTG+IPSLNVSA LLGFF 
Sbjct  50   VEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFFL  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ GFLK PFTRQENTVIQTCVV++ G+AFSGGFGSY+FGMSE++AKQ T A
Sbjct  110  VRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATEA  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P NIKNP + W+IGF+F+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  170  NDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQVRTLG
Sbjct  230  EGADLAKKQVRTLG  243



>gb|EMT14396.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=723

 Score =   226 bits (577),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 136/194 (70%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER+F  + VPSWR QLT RAF  SF L V+F  IVMKLNLT G+IPSLNVSAGLLGFFF
Sbjct  59   LERVFADQRVPSWREQLTVRAFVASFFLAVMFNIIVMKLNLTIGVIPSLNVSAGLLGFFF  118

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G LK PFTRQENTVIQTCVVA+ GI +SGGFG+Y+  MS  +A Q T A
Sbjct  119  VRLWTSAIERMGLLKQPFTRQENTVIQTCVVAAYGIPYSGGFGNYLLAMSGRIASQTTEA  178

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NNP+NIKNP + W+IGFLF+VSF+GLF +VPLRK+MIID+KLTYPSGTATA+LIN FHTP
Sbjct  179  NNPQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKIMIIDYKLTYPSGTATAYLINGFHTP  238

Query  621  QGAKLAKKQVRTLG  662
             GAK+A+KQV+ LG
Sbjct  239  HGAKIAEKQVKKLG  252



>ref|NP_001185810.1| yellow stripe-like transporter 11 [Zea mays]
 gb|ADO20998.1| yellow stripe-like transporter 11 [Zea mays]
Length=714

 Score =   226 bits (576),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  + VPSWR QLT RAF V F+L VLF+ IVMKLNLTTG+IPSLNVSA LLG+F 
Sbjct  52   VEQAFADEPVPSWREQLTVRAFVVGFILAVLFSVIVMKLNLTTGVIPSLNVSASLLGYFL  111

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WTK +E  G LKHPFTRQENTVIQTCVV++ G+AFSGGFGSY+FGMS ++A Q T A
Sbjct  112  VRLWTKAIESVGLLKHPFTRQENTVIQTCVVSAYGLAFSGGFGSYLFGMSRTIAIQATEA  171

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIK+P + WMIGF+F+VSF+GLF +VPLRKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  172  NDAQNIKDPQLGWMIGFMFLVSFVGLFVLVPLRKVMIVDYKLTYPSGTATAYLINGFHTP  231

Query  621  QGAKLAKKQVRTLG  662
            QGA+ AKKQVRTLG
Sbjct  232  QGAERAKKQVRTLG  245



>sp|Q7X660.1|YSL11_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL11; 
AltName: Full=Protein YELLOW STRIPE LIKE 11; Short=OsYSL11 
[Oryza sativa Japonica Group]
 emb|CAE05635.1| OSJNBa0038O10.1 [Oryza sativa Japonica Group]
 emb|CAI44638.1| OSJNBb0065J09.18 [Oryza sativa Japonica Group]
 gb|EAZ31387.1| hypothetical protein OsJ_15515 [Oryza sativa Japonica Group]
Length=712

 Score =   226 bits (576),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  K VPSWR QLT RAF V F+L ++F  IVMKL+LTTG+IPSLNVSA LLGFF 
Sbjct  50   VEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFFL  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ GFLK PFTRQENTVIQTCVV++ G+AFSGGFGSY+FGMSE++AKQ T A
Sbjct  110  VRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATEA  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P NIKNP + W+IGF+F+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  170  NDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQVRTLG
Sbjct  230  EGADLAKKQVRTLG  243



>ref|XP_003575422.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Brachypodium 
distachyon]
Length=715

 Score =   226 bits (576),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  54   VERVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  113

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT   E+ G    PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMSE++AKQ T A
Sbjct  114  VRLWTSAFERMGLFHQPFTRQENTVIQTCVVSAYGIAFSGGFGSYIFGMSETIAKQATEA  173

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             + +NIK+P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  174  KDAQNIKDPHLGWMIGFLFLVSFVGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHTP  233

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+TLG
Sbjct  234  EGAKLAKKQVKTLG  247



>ref|XP_009384580.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   225 bits (574),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 144/194 (74%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE + VP WR QLT RA  VSF+L V+F+ IVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  33   VERTFERQRVPPWREQLTARALAVSFLLSVMFSVIVMKLNLTTGIIPSLNVAAGLLGFFF  92

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WTK LE +G L+ PFTRQENTVIQT VVA+ G+AFSGGFGSY+FGMS  +A Q T A
Sbjct  93   VKVWTKALEHAGLLRTPFTRQENTVIQTSVVAAYGLAFSGGFGSYLFGMSSKIANQTTEA  152

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIK+P + WMIGF+FVVSFLGLFS+VPLR++MIID+KL YPSGTATA+LIN FHTP
Sbjct  153  NDSQNIKDPKLGWMIGFMFVVSFLGLFSLVPLREIMIIDYKLIYPSGTATAYLINGFHTP  212

Query  621  QGAKLAKKQVRTLG  662
            QG KLAKKQVRT+G
Sbjct  213  QGEKLAKKQVRTMG  226



>ref|XP_004299460.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Fragaria 
vesca subsp. vesca]
Length=711

 Score =   225 bits (573),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 150/194 (77%), Positives = 171/194 (88%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++F  +EVPSW  QLTFRAF +S +L VLF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  51   VEKLFAKQEVPSWTRQLTFRAFIISGMLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  110

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V TWTK + K+GFL  PFTRQENTVIQTC+VASSGIAFSGGFGSY+FGMS+ +A Q   +
Sbjct  111  VSTWTKIVTKAGFLTQPFTRQENTVIQTCIVASSGIAFSGGFGSYLFGMSDRIAAQ---S  167

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  + KNPG+ W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLINSFHTP
Sbjct  168  SDRGDTKNPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  227

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  228  EGAKLAKKQVKELG  241



>ref|XP_008669136.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Zea 
mays]
 tpg|DAA36870.1| TPA: hypothetical protein ZEAMMB73_694828 [Zea mays]
Length=725

 Score =   224 bits (572),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 137/192 (71%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = +3

Query  87   RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  266
            R F  + VPSWR QLT RAF VSF L V+F+ IVMKLNLTTGIIPSLN+SAGLLGFFFV+
Sbjct  64   RAFADQPVPSWREQLTLRAFVVSFFLAVMFSVIVMKLNLTTGIIPSLNISAGLLGFFFVR  123

Query  267  TWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANN  446
             WTK +E  G L+ PFTRQENTVIQTCVVAS G++FSGGFG+Y+  MS+ +A  +T ANN
Sbjct  124  LWTKAIESVGLLRQPFTRQENTVIQTCVVASYGLSFSGGFGNYLLAMSDKIAAMVTEANN  183

Query  447  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQG  626
             +NIKNP + W+IGFLF+VSF+GLF +VPLRK+MI+D+KLTYPSGTATA+LIN FHTPQG
Sbjct  184  AQNIKNPQLGWIIGFLFLVSFIGLFGLVPLRKIMIVDYKLTYPSGTATAYLINGFHTPQG  243

Query  627  AKLAKKQVRTLG  662
            AKLA+KQV+ LG
Sbjct  244  AKLARKQVKKLG  255



>dbj|BAE91892.1| hypothetical protein [Oryza sativa Japonica Group]
Length=716

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +3

Query  96   ESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWT  275
              + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFFV+ WT
Sbjct  60   SGQGVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFFVRLWT  119

Query  276  KFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNPEN  455
              +E+ G L+ PFTRQENTVIQTCVVA+ GIAFSGGFG+Y+FGMSE++AKQ T ANN +N
Sbjct  120  AAIERVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQATEANNAQN  179

Query  456  IKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKL  635
            +KNP + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP+GAKL
Sbjct  180  VKNPHIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTPEGAKL  239

Query  636  AKKQVRTLG  662
            AKKQV+ LG
Sbjct  240  AKKQVKELG  248



>dbj|BAE91891.1| hypothetical protein [Oryza sativa Japonica Group]
Length=712

 Score =   224 bits (570),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 139/194 (72%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  K VPSWR QLT RAF V F+L ++F  IVMKL+LTTG+IPSLNVSA LLGFF 
Sbjct  50   VEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFFL  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ GFLK P TRQENTVIQTCVV++ G+AFSGGFGSY+FGMSE++AKQ T A
Sbjct  110  VRLWTAAIERVGFLKQPLTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATEA  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P NIKNP + W+IGF+F+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LIN FHTP
Sbjct  170  NDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQVRTLG
Sbjct  230  EGADLAKKQVRTLG  243



>emb|CAI44637.1| OSJNBb0065J09.17 [Oryza sativa Japonica Group]
Length=672

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VERAFVDRAVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G L+ PFTRQENTVIQTCVVA+ GIAFSGGFG+Y+FGMSE++AKQ T A
Sbjct  116  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQATEA  175

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +N+KNP + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  176  NNAQNVKNPHIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  235

Query  621  QGAKLAK  641
            +GAKLAK
Sbjct  236  EGAKLAK  242



>ref|XP_009413131.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER FE + VP WR QLT RA  VSF L V+F+ IVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  25   VERAFEGQRVPGWREQLTARALVVSFFLSVMFSVIVMKLNLTTGIIPSLNVAAGLLGFFF  84

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WTK LE +G L+ PFTRQENTVIQTCVVA+ G+AFSGGFGSY+FGMS  +A Q T  
Sbjct  85   VKLWTKGLESTGLLRTPFTRQENTVIQTCVVAAYGLAFSGGFGSYIFGMSSRIADQATEE  144

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +NIK P + WMIGF+FVVSFLGLFS+VPLRK+MIID+KL YPSGTATA+LIN FHTP
Sbjct  145  NNSQNIKEPKLGWMIGFMFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAYLINGFHTP  204

Query  621  QGAKLAKKQVRTLG  662
            QG KLAKKQV TLG
Sbjct  205  QGEKLAKKQVWTLG  218



>ref|XP_010675190.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=683

 Score =   223 bits (567),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 150/194 (77%), Positives = 167/194 (86%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++F SK V  W+ QLT RAF VSF L +LFTFIVMKLNLTTG+IPSLNVSAGLLG+FF
Sbjct  31   VEKVFSSKPVLPWKQQLTVRAFVVSFFLSILFTFIVMKLNLTTGVIPSLNVSAGLLGYFF  90

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WTKFLEK GFLK PFTRQENTVIQTCVVA+SGIAFSGGFGSY+ GMSE +AKQ    
Sbjct  91   VKVWTKFLEKFGFLKQPFTRQENTVIQTCVVAASGIAFSGGFGSYILGMSERIAKQADRG  150

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
               ++ KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATA+LINSFHTP
Sbjct  151  YQHDS-KNPHLGWLIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAYLINSFHTP  209

Query  621  QGAKLAKKQVRTLG  662
            +GA LAKKQV  LG
Sbjct  210  KGAILAKKQVEALG  223



>dbj|BAJ89062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   222 bits (566),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 138/194 (71%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  50   VEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT   E+ G +  PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMS+++AKQ T A
Sbjct  110  VRLWTSAFERMGLIGQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIAKQATEA  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+  NIK P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  170  NDAWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  230  EGAKLAKKQVKILG  243



>dbj|BAJ92335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   222 bits (566),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 138/194 (71%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  50   VEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT   E+ G +  PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMS+++AKQ T A
Sbjct  110  VRLWTSAFERMGLIGQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIAKQATEA  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+  NIK P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  170  NDAWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  230  EGAKLAKKQVKILG  243



>gb|AAD49762.2|AC007932_10 F11A17.8 [Arabidopsis thaliana]
Length=803

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  168  VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  227

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L KSG LK PFTRQENTVIQTCVVASSGIAFSGGFG+Y+F MS  +A Q    
Sbjct  228  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQS--G  285

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLINSFHTP
Sbjct  286  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  345

Query  621  QGAKLA  638
            QGAKLA
Sbjct  346  QGAKLA  351



>ref|XP_008779403.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Phoenix 
dactylifera]
Length=680

 Score =   221 bits (562),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 143/194 (74%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E++FE KEVP WR QLTFRA  V+  L ++F+FIVMKL LTTGI+PSLN++AGLLGFFF
Sbjct  13   IEKVFEGKEVPPWREQLTFRALAVAAFLAIMFSFIVMKLGLTTGIVPSLNIAAGLLGFFF  72

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WTK L+ +G L+ PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS  +A Q T  
Sbjct  73   VRLWTKALQMTGCLQKPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSGRIAGQATED  132

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIK+P + W+IGFLFVVSFLGLFS+VPLRK+MIID+KL YPSGTATA LIN FHTP
Sbjct  133  NDAQNIKDPRLGWIIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  192

Query  621  QGAKLAKKQVRTLG  662
            QGAKLAKKQVRTLG
Sbjct  193  QGAKLAKKQVRTLG  206



>ref|XP_002448760.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
 gb|EES13088.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
Length=688

 Score =   221 bits (562),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 145/195 (74%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE  EVP WR Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  19   VERVFEGWEVPGWREQVTVRALMVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  78

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI  437
            + +WTK L ++GF    PFTRQENTV+QTCVVA SGIAFSGGFGSYMF MS+ +++Q   
Sbjct  79   LTSWTKLLAQAGFTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSDRISEQSGE  138

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
              +P NIKNPG+ WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLINSFHT
Sbjct  139  TWDPHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHT  198

Query  618  PQGAKLAKKQVRTLG  662
            PQGAKLAK+QV+TLG
Sbjct  199  PQGAKLAKRQVKTLG  213



>emb|CAN70906.1| hypothetical protein VITISV_043868 [Vitis vinifera]
Length=697

 Score =   220 bits (560),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +3

Query  129  LTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKH  308
            LT RAF VSFVLGVL TFIVMKLNLTTGIIPSLNVSAGLLGFFFVK+W KF+EKSG LK 
Sbjct  54   LTIRAFVVSFVLGVLLTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKSWAKFMEKSGMLKQ  113

Query  309  PFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIg  488
            PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS  VA Q   + + +N K+P + W+IG
Sbjct  114  PFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSIVAGQSAKSIDAQNTKDPRLPWIIG  173

Query  489  flfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            FLF VSFLGLFSV+PLRK+M+ID+KLTYPSGTATAHLINSFHTPQGAKLAK+QVRTLG
Sbjct  174  FLFAVSFLGLFSVLPLRKIMVIDYKLTYPSGTATAHLINSFHTPQGAKLAKQQVRTLG  231



>emb|CAH67885.1| OSIGBa0153E02-OSIGBa0093I20.14 [Oryza sativa Indica Group]
 gb|EAY94898.1| hypothetical protein OsI_16698 [Oryza sativa Indica Group]
Length=724

 Score =   220 bits (560),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 139/194 (72%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  60   VERVFADRPVPSWREQLTVRAFVVSFFLVIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  119

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G L+ PFTRQENTVIQTCVVA   IAFSGGFG+Y+  MSE +A   T A
Sbjct  120  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDIAFSGGFGNYILSMSERIAGLGTEA  179

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +NIKNP + W+IGFLF+VSF+GLF +VPLRKVMIID+KLTYPSGTATA LIN FHTP
Sbjct  180  NNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVMIIDYKLTYPSGTATAFLINGFHTP  239

Query  621  QGAKLAKKQVRTLG  662
             GAK+A KQV+ LG
Sbjct  240  HGAKIAAKQVKKLG  253



>ref|XP_007146944.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
 gb|ESW18938.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
Length=680

 Score =   219 bits (558),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 145/190 (76%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  93   FESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTW  272
            FE K VP W  Q+T RA  VS VL VLFTFIVMKLNLTTGIIPSLN+SAGLLGFFFVK W
Sbjct  26   FEGKVVPRWEKQITLRAMVVSLVLAVLFTFIVMKLNLTTGIIPSLNISAGLLGFFFVKIW  85

Query  273  TKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNPE  452
            T  L K G L  PFTRQENTVIQTCVVASSGIAFSGGFGSY+F MS  +A Q   AN P 
Sbjct  86   TSLLTKMGMLVQPFTRQENTVIQTCVVASSGIAFSGGFGSYIFAMSSEIANQSPEANGPL  145

Query  453  NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAK  632
            +IKNP + WMI F+ VVSFLGLFSVVPLRK+MI+DFKL YPSGTATAHLINSFHT +GAK
Sbjct  146  DIKNPTLGWMIAFVSVVSFLGLFSVVPLRKIMIVDFKLIYPSGTATAHLINSFHTTEGAK  205

Query  633  LAKKQVRTLG  662
            LAKKQV  LG
Sbjct  206  LAKKQVSVLG  215



>sp|Q7XKF4.2|YSL13_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL13; 
AltName: Full=Protein YELLOW STRIPE LIKE 13; Short=OsYSL13 
[Oryza sativa Japonica Group]
 emb|CAE05719.2| OSJNBb0065J09.15 [Oryza sativa Japonica Group]
 dbj|BAE44204.1| hypothetical protein [Oryza sativa Japonica Group]
Length=724

 Score =   220 bits (560),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 139/194 (72%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  60   VERVFADRPVPSWREQLTVRAFVVSFFLVIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  119

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +E+ G L+ PFTRQENTVIQTCVVA   IAFSGGFG+Y+  MSE +A   T A
Sbjct  120  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDIAFSGGFGNYILSMSERIAGLGTEA  179

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +NIKNP + W+IGFLF+VSF+GLF +VPLRKVMIID+KLTYPSGTATA LIN FHTP
Sbjct  180  NNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVMIIDYKLTYPSGTATAFLINGFHTP  239

Query  621  QGAKLAKKQVRTLG  662
             GAK+A KQV+ LG
Sbjct  240  HGAKIAAKQVKKLG  253



>ref|XP_004976284.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=712

 Score =   219 bits (559),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  K VPSWR QLT RAF V  +L VLF+ IVMKLNLTTGIIPSLNVSA LL +F 
Sbjct  50   VEQAFAGKPVPSWREQLTVRAFVVGALLSVLFSVIVMKLNLTTGIIPSLNVSASLLSYFL  109

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V  WTK +E  G LK PFTRQENTVIQTCVV++ GIAFSGGFGSY+FGMS ++AKQ T A
Sbjct  110  VSLWTKAIESMGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSSTIAKQATEA  169

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+  NIK+P + WMIGF+F+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHTP
Sbjct  170  NDALNIKDPHLGWMIGFMFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  229

Query  621  QGAKLAKKQVRTLG  662
            +GA+LAKKQVRTLG
Sbjct  230  EGAELAKKQVRTLG  243



>gb|KEH34582.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=690

 Score =   219 bits (558),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 144/194 (74%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ FE   VP+W+ Q+T RA   S +L V+FTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  30   VEKGFEGTSVPTWQKQVTVRAIFASLMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  89

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEK+G+L  PFTRQENTVIQTCVVA+SGIAFSGGFGSY+FGMS ++AKQ+   
Sbjct  90   VKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSPTIAKQIPEF  149

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            ++  ++K+ G+ WMI FLFVVSFLGLFSV+PLRK+MI+DF LTYPSGTATAHLINSFHT 
Sbjct  150  DSANDVKSLGLGWMIAFLFVVSFLGLFSVLPLRKIMIVDFGLTYPSGTATAHLINSFHTS  209

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  210  EGAKLAKKQVKALG  223



>ref|XP_003581442.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Brachypodium 
distachyon]
Length=724

 Score =   219 bits (559),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 133/194 (69%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  + VP+WR QLT RAF VSF L V+F+ IVMKLNLT G+IPSLNVSAGLL FFF
Sbjct  60   VEQAFADQRVPTWREQLTVRAFVVSFFLAVMFSVIVMKLNLTIGVIPSLNVSAGLLSFFF  119

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  ++K G L+ PFTRQENTVIQTCVVA+  IAFSGGFG+Y+  MS+ +A Q T A
Sbjct  120  VRLWTAAIQKVGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLLAMSDRIASQSTEA  179

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +NP+NIKNP + W+IGFL +VSF+GLF +VPLRK+MIID+KLTYPSGTATA+LIN FHTP
Sbjct  180  DNPQNIKNPHLGWIIGFLLLVSFIGLFGLVPLRKIMIIDYKLTYPSGTATAYLINGFHTP  239

Query  621  QGAKLAKKQVRTLG  662
             GAK+A KQV+ LG
Sbjct  240  HGAKIAGKQVKKLG  253



>gb|EMT24509.1| Putative metal-nicotianamine transporter YSL12 [Aegilops tauschii]
Length=723

 Score =   219 bits (558),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 137/195 (70%), Positives = 164/195 (84%), Gaps = 7/195 (4%)
 Frame = +3

Query  99   SKEVPSWRNQ-------LTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  257
            +K VP+WR         LT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFF
Sbjct  61   AKPVPTWREAADAPRLVLTLRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  120

Query  258  FVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI  437
            FV+ WT  +E+ GFL+ PFTRQENTVIQTCVVA+  IAFSGGFG+Y+F MS +VA Q T 
Sbjct  121  FVRLWTSAIERMGFLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLFAMSGTVASQATE  180

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
            AN+ +N+K+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LIN FHT
Sbjct  181  ANDAQNVKDPHIGWMIGFLFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  240

Query  618  PQGAKLAKKQVRTLG  662
            P+GAKLAKKQVRTLG
Sbjct  241  PEGAKLAKKQVRTLG  255



>gb|KEH34580.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=696

 Score =   219 bits (557),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 144/194 (74%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE K VP+W+ Q+T RA  VS +L V+FTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  36   IEKGFEGKLVPTWQKQVTVRALFVSLMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  95

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEK+G+L  PF+RQENTVIQTCVVASSGIAFSGGFGSY+FGM+ ++AKQ+   
Sbjct  96   VKTWTKLLEKAGWLTQPFSRQENTVIQTCVVASSGIAFSGGFGSYLFGMTPTIAKQIPEF  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +   ++K  G+ WMI FLFVVSFLGLFSV+PLRK+MI+DF LTYPSGTATAHLINSFHT 
Sbjct  156  DGSNDVKILGLGWMIAFLFVVSFLGLFSVLPLRKIMIVDFGLTYPSGTATAHLINSFHTS  215

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  216  EGAKLAKKQVKALG  229



>gb|AFW59877.1| hypothetical protein ZEAMMB73_955581 [Zea mays]
Length=695

 Score =   215 bits (547),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = +3

Query  87   RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  266
            R+FE +EVP WR Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF + 
Sbjct  22   RVFEGREVPGWREQVTARALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLT  81

Query  267  TWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            +WTK L K+G     PFTRQENTV+QTCVVA SGIAFSGGFGSYMF MSE +++Q     
Sbjct  82   SWTKLLAKAGLTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSERISEQSGETW  141

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
            +  NIKNPG+ WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLINSFHTPQ
Sbjct  142  DAHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHTPQ  201

Query  624  GAKLAKKQVRTLG  662
            GAKLAK+QV+TLG
Sbjct  202  GAKLAKRQVKTLG  214



>ref|XP_010032362.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=688

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE + VPSWR QL FRAF VSF L V+  F  MKLNLTTGI PSLNVSAGLLGFFF
Sbjct  28   VERIFEGQGVPSWRRQLKFRAFAVSFALSVMLAF--MKLNLTTGINPSLNVSAGLLGFFF  85

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEK G L+ PFT QENTVIQTCVVASSG  FSGGFGSY+F MSE VA Q T  
Sbjct  86   VKTWTKVLEKFGLLRVPFTWQENTVIQTCVVASSGSTFSGGFGSYLFAMSERVANQSTDP  145

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +    KNP + WMIGFLFVVSFLGLF+VVPLRK+MIIDFKL YPSGTATAHL NSFHTP
Sbjct  146  QSAYVYKNPSLPWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLMYPSGTATAHLRNSFHTP  205

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQV+ LG
Sbjct  206  EGAKLAKKQVKALG  219



>ref|XP_010940749.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Elaeis 
guineensis]
Length=690

 Score =   214 bits (545),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 138/193 (72%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E++FESKEVPSW +QLTFRAF VS +LG   +FIVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  17   MEQLFESKEVPSWSDQLTFRAFFVSSILGFFLSFIVMKLNLTTGIIPSLNVSAGLLGFFL  76

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK L+++ FL  PFTRQENTVIQTCVVA +G+AFSGGFGSY   MSE+VA     A
Sbjct  77   VKTWTKILQRADFLMQPFTRQENTVIQTCVVACAGVAFSGGFGSYFLAMSETVANDFNEA  136

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N   + K P   WM+ FLF+VSF+GLFSVVPLRK+MI+ +KLTYPSG ATA+LINSFHTP
Sbjct  137  NTKVDTKEPSFGWMVAFLFIVSFIGLFSVVPLRKIMILRYKLTYPSGMATAYLINSFHTP  196

Query  621  QGAKLAKKQVRTL  659
            QGA LA+KQV  L
Sbjct  197  QGALLARKQVSYL  209



>ref|XP_008805741.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Phoenix 
dactylifera]
Length=683

 Score =   213 bits (543),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FESKEVPSW +QLTFRAF VS +LG  F+FIV+KL+LTTGIIPSLNVSAGLLGFFF
Sbjct  18   LEQHFESKEVPSWTDQLTFRAFAVSLMLGFFFSFIVIKLSLTTGIIPSLNVSAGLLGFFF  77

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWTK LEK+G LK PFTRQENTVIQT VVA SGIAFSGGFGSY+ GMS++VA  +   
Sbjct  78   VKTWTKILEKAGLLKQPFTRQENTVIQTSVVALSGIAFSGGFGSYILGMSKNVANDLNEG  137

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
                  K P + WMIGFLF VSF+GLF++VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  138  YTARYTKEPSLGWMIGFLFTVSFVGLFTIVPLRKIMILGYKLTYPSGTATAYLINSFHTP  197

Query  621  QGAKLAKKQVRTL  659
            QGA  AKKQV  L
Sbjct  198  QGAMQAKKQVTFL  210



>sp|Q0J932.2|YSL10_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL10; 
AltName: Full=Protein YELLOW STRIPE LIKE 10; Short=OsYSL10 
[Oryza sativa Japonica Group]
 dbj|BAE91890.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG91535.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61895.1| hypothetical protein OsJ_16603 [Oryza sativa Japonica Group]
Length=686

 Score =   212 bits (540),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 140/195 (72%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  20   VERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  79

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI  437
            + +WTK L+K+G     PFTRQENTV+QTCVVA SGIAFSGGFGSY+F MS+ ++ Q   
Sbjct  80   LTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGE  139

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
            A +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLINSFHT
Sbjct  140  ARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHT  199

Query  618  PQGAKLAKKQVRTLG  662
            PQGAKLAK QV+ LG
Sbjct  200  PQGAKLAKMQVKMLG  214



>ref|NP_001054241.1| Os04g0674600 [Oryza sativa Japonica Group]
 dbj|BAF16155.1| Os04g0674600, partial [Oryza sativa Japonica Group]
Length=708

 Score =   213 bits (541),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 140/195 (72%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  42   VERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  101

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI  437
            + +WTK L+K+G     PFTRQENTV+QTCVVA SGIAFSGGFGSY+F MS+ ++ Q   
Sbjct  102  LTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGE  161

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
            A +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLINSFHT
Sbjct  162  ARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHT  221

Query  618  PQGAKLAKKQVRTLG  662
            PQGAKLAK QV+ LG
Sbjct  222  PQGAKLAKMQVKMLG  236



>ref|XP_009392235.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   212 bits (539),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 137/193 (71%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+F+ +EVP W  QLT R+  VS +LG   +FIVMKLNLT GIIPSLNVSAGLLGFF 
Sbjct  18   VERMFDCQEVPPWTQQLTLRSLAVSAILGFFLSFIVMKLNLTAGIIPSLNVSAGLLGFFM  77

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWT  LEK+G L  PFTRQENTVIQTCVVA SGIAFSGGFGSY+ GMS+ VA Q   A
Sbjct  78   VKTWTTLLEKTGLLNQPFTRQENTVIQTCVVACSGIAFSGGFGSYILGMSKKVADQFGEA  137

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +   N+K P + W+I FL  VSF+GLFSVVPLR++MII +KLTYPSGTATAHLINSFHTP
Sbjct  138  DTGVNMKEPSLGWLICFLLAVSFVGLFSVVPLRRIMIIAYKLTYPSGTATAHLINSFHTP  197

Query  621  QGAKLAKKQVRTL  659
            QGA LA+KQV  L
Sbjct  198  QGALLARKQVSLL  210



>ref|XP_006653020.1| PREDICTED: probable metal-nicotianamine transporter YSL10-like 
[Oryza brachyantha]
Length=694

 Score =   212 bits (539),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 141/195 (72%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE + VP W+ Q+T RA  VS VLG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  20   VERVFEGRVVPEWKEQVTVRALAVSAVLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  79

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI  437
            + +WTK L K+G     PFTRQENTV+QTCVVA SGIAFSGGFGSY+F MS+ ++ Q   
Sbjct  80   LTSWTKLLHKAGVAGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGE  139

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
              +  NIKNP ++WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLINSFHT
Sbjct  140  VRDEHNIKNPSLSWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHT  199

Query  618  PQGAKLAKKQVRTLG  662
            PQGAKLAK QV+TLG
Sbjct  200  PQGAKLAKMQVKTLG  214



>emb|CBG76262.1| OO_Ba0005L10-OO_Ba0081K17.13 [Oryza officinalis]
Length=691

 Score =   211 bits (538),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 140/195 (72%), Positives = 161/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  21   VERVFEGRVVPEWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  80

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI  437
            + +WTK L K+G     PFTRQENTV+QTCVVA SGIAFSGGFGSY+F MS+ ++ Q   
Sbjct  81   LTSWTKLLHKAGVAGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGE  140

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
            A +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLINSFHT
Sbjct  141  ARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHT  200

Query  618  PQGAKLAKKQVRTLG  662
            PQGAKLAK QV+ LG
Sbjct  201  PQGAKLAKMQVKMLG  215



>gb|EMT24510.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=727

 Score =   211 bits (537),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 135/208 (65%), Positives = 158/208 (76%), Gaps = 14/208 (7%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER F  + VPSWR QLT RAF  SF L  +F+ IVMKLNLT GIIPSLNVSAGLL FFF
Sbjct  49   VERAFADQRVPSWREQLTVRAFVASFFLATMFSVIVMKLNLTVGIIPSLNVSAGLLSFFF  108

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WT  +EK G L+ PFTRQENTVIQTCVVA+ GI+FSGGFG+Y+  MS+ +A Q   A
Sbjct  109  VRLWTAAMEKVGLLRQPFTRQENTVIQTCVVAAYGISFSGGFGNYLLAMSDRIASQADEA  168

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRK--------------VMIIDFKLTYPS  578
            NNP+NIKNP + W+IGFL +VSF+GLF +VPLRK              +MIID+KLTYPS
Sbjct  169  NNPQNIKNPHLGWIIGFLLLVSFIGLFGLVPLRKQPCAYHFNQISTVQIMIIDYKLTYPS  228

Query  579  GTATAHLINSFHTPQGAKLAKKQVRTLG  662
            GTATA+LIN FHTP GAK+A KQV+ LG
Sbjct  229  GTATAYLINGFHTPHGAKIAVKQVKKLG  256



>ref|XP_008441627.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL5 [Cucumis melo]
Length=590

 Score =   209 bits (531),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 164/194 (85%), Gaps = 2/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERIFE++EVPSW+NQLT RAF +SF L VLFTFIVMKLNLTTGIIPSLNVSAG LGFFF
Sbjct  39   VERIFEAQEVPSWQNQLTVRAFAMSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGFLGFFF  98

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+TWTK L+KSG LK PFTRQENTVIQTCVVASSGIAFSGGFGSY+  MS+ + K     
Sbjct  99   VETWTKLLKKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLAMSQRINKLSEAK  158

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             N  + KN  + W+IGFLF+VSFLG   V+ L K+MIIDFKLTYPSGTATAHLINSFHT 
Sbjct  159  GN--DFKNLSLGWIIGFLFIVSFLGPLLVLHLPKIMIIDFKLTYPSGTATAHLINSFHTS  216

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  217  RGAKLAKKQVRTLG  230



>ref|XP_011072202.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=691

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VERI E  EVPSWR QLT RAF VSF+L V+F F+VMKL+LTTGIIPS NVSAGLLGFFF
Sbjct  30   VERISEG-EVPSWRKQLTLRAFAVSFLLSVMFCFVVMKLSLTTGIIPSFNVSAGLLGFFF  88

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            ++TWTK + +SG L+ PFT QENTVIQTCV+ASSG+AFSGGFGSY+FGMSE +A+Q    
Sbjct  89   IQTWTKLIAQSGMLRQPFTCQENTVIQTCVIASSGVAFSGGFGSYLFGMSERIAEQSEDR  148

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
             +  + KNP + WMI FLFVVSF+GLF+VVP+RK++I+DFKL Y  GT TAHLINSFHTP
Sbjct  149  KDAFDYKNPALGWMISFLFVVSFIGLFAVVPMRKIIILDFKLKYARGTETAHLINSFHTP  208

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVR LG
Sbjct  209  EGAKLAKKQVRALG  222



>emb|CDP01725.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  189  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgi  368
            MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSG LK PFTRQENTVIQTCVVA+SGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGLLKQPFTRQENTVIQTCVVATSGI  60

Query  369  afsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  548
            AFSGGFGSY+FGMSE VAKQ    N  +NIK P + WM GFLF+VSFLGLFSVVPLRK+M
Sbjct  61   AFSGGFGSYIFGMSEVVAKQSGEDNFAQNIKIPSLGWMFGFLFLVSFLGLFSVVPLRKIM  120

Query  549  IIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            IIDFKLTYPSGTATA+LINSFHTPQGAKLAKKQVRTLG
Sbjct  121  IIDFKLTYPSGTATAYLINSFHTPQGAKLAKKQVRTLG  158



>ref|XP_008461864.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Cucumis 
melo]
Length=684

 Score =   206 bits (524),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 136/193 (70%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++ EVPSWRNQ+TFRA   SFVL ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  27   VEDAFKNLEVPSWRNQITFRALFTSFVLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K +T  LE+ G +K PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  87   LKGYTSILEQLGLMKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQAEEG  146

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK   V WMIGFLFVVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  147  NMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  206

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  207  KGAKLAKKQVAVL  219



>emb|CAJ86097.1| H0103C06.1 [Oryza sativa Indica Group]
 emb|CAH68189.1| H0403D02.17 [Oryza sativa Indica Group]
Length=700

 Score =   206 bits (524),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 137/204 (67%), Positives = 158/204 (77%), Gaps = 10/204 (5%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  21   VERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  80

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfg---------symfgms  410
            + +WTKFL+K G     PFTRQENTV+QTCVVA SGIAFS             SY+F MS
Sbjct  81   LTSWTKFLDKVGVASVRPFTRQENTVVQTCVVACSGIAFSDADLCTGGTGGFGSYIFAMS  140

Query  411  esVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTAT  590
            + ++ Q   A +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTAT
Sbjct  141  DRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTAT  200

Query  591  AHLINSFHTPQGAKLAKKQVRTLG  662
            AHLINSFHTPQGAKLAK QV+ LG
Sbjct  201  AHLINSFHTPQGAKLAKMQVKMLG  224



>emb|CAE03239.2| OSJNBa0018M05.14 [Oryza sativa Japonica Group]
Length=695

 Score =   206 bits (523),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 136/204 (67%), Positives = 158/204 (77%), Gaps = 10/204 (5%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  20   VERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  79

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfg---------symfgms  410
            + +WTK L+K+G     PFTRQENTV+QTCVVA SGIAFS             SY+F MS
Sbjct  80   LTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSDADLCTGGTGGFGSYIFAMS  139

Query  411  esVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTAT  590
            + ++ Q   A +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTAT
Sbjct  140  DRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTAT  199

Query  591  AHLINSFHTPQGAKLAKKQVRTLG  662
            AHLINSFHTPQGAKLAK QV+ LG
Sbjct  200  AHLINSFHTPQGAKLAKMQVKMLG  223



>ref|XP_004148573.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
 gb|KGN58517.1| hypothetical protein Csa_3G654470 [Cucumis sativus]
Length=684

 Score =   205 bits (521),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 135/193 (70%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++ EVPSWRNQ+TFRA   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  27   VEDAFKNLEVPSWRNQITFRALFTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K +T  L++ G +K PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  87   LKGYTSILDQLGLMKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQAEEG  146

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK   V WMIGFLFVVSF+GLFS+VPLRK+MII +KLTYPSGTATA+LINSFHTP
Sbjct  147  NMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMIIKYKLTYPSGTATAYLINSFHTP  206

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  207  KGAKLAKKQVAVL  219



>ref|XP_004163304.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=691

 Score =   204 bits (520),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 135/193 (70%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++ EVPSWRNQ+TFRA   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  27   VEDAFKNLEVPSWRNQITFRALFTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K +T  L++ G +K PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  87   LKGYTSILDQLGLMKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQAEEG  146

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK   V WMIGFLFVVSF+GLFS+VPLRK+MII +KLTYPSGTATA+LINSFHTP
Sbjct  147  NMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMIIKYKLTYPSGTATAYLINSFHTP  206

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  207  KGAKLAKKQVAVL  219



>ref|XP_007043321.1| YELLOW STRIPE like 7 [Theobroma cacao]
 gb|EOX99152.1| YELLOW STRIPE like 7 [Theobroma cacao]
Length=694

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F + +VPSW NQ+T RA   S +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  29   VEDAFRNTQVPSWTNQITLRAVVTSLLLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  88

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WT  L K GFLK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  VA Q    
Sbjct  89   VKAWTTTLAKVGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPLVAGQGDSG  148

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N PEN+K   + WM+GFLFVVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  149  NTPENVKKLSIGWMMGFLFVVSFVGLFSIVPLRKIMILKYKLTYPSGTATAYLINSFHTP  208

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  209  KGAKLAKKQVVYL  221



>ref|XP_006484556.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Citrus sinensis]
Length=669

 Score =   201 bits (511),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 133/193 (69%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++  VP W  Q+TFRA   S VL V+F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  2    VEEAFKNVPVPPWTKQITFRAMATSAVLSVIFNFIVCKLNLTTGVIPSLNVAAGLLGFAL  61

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WT  LEK G LK PFTRQENTVIQTC+VASSGIAFS G  SYM GMS  +A Q    
Sbjct  62   VKSWTTLLEKFGLLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPKIASQADGG  121

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK+  + WM+ FLF VSFLGLFS+VPLRKVMI+ +KLTYPSGTATA+LINSFHTP
Sbjct  122  NTPANIKSLSIGWMMAFLFAVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTP  181

Query  621  QGAKLAKKQVRTL  659
            +GA+LAKKQV  L
Sbjct  182  KGAQLAKKQVAML  194



>gb|KDO52778.1| hypothetical protein CISIN_1g044922mg [Citrus sinensis]
Length=684

 Score =   201 bits (511),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 131/193 (68%), Positives = 149/193 (77%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  F+  EVPSWR Q+TFRA   S +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  27   MEDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WT  LEK G LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  VA      
Sbjct  87   VKAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSTRVAALADSG  146

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+K   + WM GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  147  NTPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  206

Query  621  QGAKLAKKQVRTL  659
            +GAKLA KQV  L
Sbjct  207  KGAKLAVKQVAVL  219



>ref|XP_008663726.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL10 [Zea mays]
Length=722

 Score =   201 bits (512),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 144/220 (65%), Positives = 163/220 (74%), Gaps = 28/220 (13%)
 Frame = +3

Query  87   RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  266
            R+FE +EVP WR Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF + 
Sbjct  22   RVFEGREVPGWREQVTARALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLT  81

Query  267  TWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            +WTK L K+G     PFTRQENTV+QTCVVA SGIAFSGGFGSYMF MSE +++Q     
Sbjct  82   SWTKLLAKAGLTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSERISEQSGETW  141

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKV--------------------------  545
            +  NIKNPG+ WMIGFLF+VSFLGLFSVVPLRKV                          
Sbjct  142  DAHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKVRTHAHPNSVSDVYSSHHDMMPAGCVQ  201

Query  546  -MIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
             MIID+KL YPSGTATAHLINSFHTPQGAKLAK+QV+TLG
Sbjct  202  IMIIDYKLIYPSGTATAHLINSFHTPQGAKLAKRQVKTLG  241



>ref|XP_006484586.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Citrus sinensis]
Length=684

 Score =   201 bits (511),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 131/193 (68%), Positives = 149/193 (77%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  F+  EVPSWR Q+TFRA   S +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  27   MEDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WT  LEK G LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  VA      
Sbjct  87   VKAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSTRVAALADSG  146

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+K   + WM GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  147  NTPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  206

Query  621  QGAKLAKKQVRTL  659
            +GAKLA KQV  L
Sbjct  207  KGAKLAVKQVAVL  219



>ref|XP_006437555.1| hypothetical protein CICLE_v10030879mg [Citrus clementina]
 gb|ESR50795.1| hypothetical protein CICLE_v10030879mg [Citrus clementina]
Length=684

 Score =   201 bits (511),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 131/193 (68%), Positives = 149/193 (77%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E  F+  EVPSWR Q+TFRA   S +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  27   MEDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WT  LEK G LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  VA      
Sbjct  87   VKAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSTRVAALADSG  146

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+K   + WM GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  147  NTPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  206

Query  621  QGAKLAKKQVRTL  659
            +GAKLA KQV  L
Sbjct  207  KGAKLAVKQVAVL  219



>ref|XP_009402082.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   201 bits (512),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 126/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  PSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEK  290
            P WR QLT RA  VSF L V+F+ IVMKLNLTTGIIPSLN +AGLLGFF VK WTK LE 
Sbjct  77   PPWREQLTVRAMVVSFALSVMFSVIVMKLNLTTGIIPSLNAAAGLLGFFLVKLWTKALEH  136

Query  291  SGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNPENIKNPG  470
             G L+ PFTRQEN VIQTCV+A+ G+ FSGGFG+Y+FGMS  +A Q   AN+ +NIK+P 
Sbjct  137  VGLLRTPFTRQENAVIQTCVIAAYGLVFSGGFGNYLFGMSSKIASQAAEANDSDNIKDPS  196

Query  471  VAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQV  650
            + WMIG++F++ FLGLFS+VPLRK++IID+KL YPSGTA A+LIN FHTPQG K AKKQV
Sbjct  197  LGWMIGYMFIIGFLGLFSLVPLRKILIIDYKLIYPSGTAAAYLINGFHTPQGEKQAKKQV  256

Query  651  RTLG  662
             TLG
Sbjct  257  WTLG  260



>ref|XP_006437556.1| hypothetical protein CICLE_v10030844mg [Citrus clementina]
 gb|ESR50796.1| hypothetical protein CICLE_v10030844mg [Citrus clementina]
Length=704

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++  VP W  Q+TFRA   S VL V+F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  37   VEEAFKNVPVPPWTKQITFRAMATSAVLSVIFNFIVCKLNLTTGVIPSLNVAAGLLGFAL  96

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK+WT  LEK G LK PFTRQENTVIQTC+VASSGIAFS G  SYM GMS  +A Q    
Sbjct  97   VKSWTTLLEKFGLLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPKIASQADGG  156

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK+  + WM+ FLF VSFLGLFS+VPLRKVMI+ +KLTYPSGTATA+LINSFHTP
Sbjct  157  NTPANIKSLSIGWMMAFLFAVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTP  216

Query  621  QGAKLAKKQVRTL  659
            +GA+LAKKQV  L
Sbjct  217  KGAQLAKKQVAML  229



>ref|XP_008340452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Malus 
domestica]
Length=705

 Score =   201 bits (510),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 129/193 (67%), Positives = 152/193 (79%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++  VP W  Q+T R+   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  32   VEEAFKATAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  91

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK +T  ++K GFLK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q  + 
Sbjct  92   VKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQGDLG  151

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK   V WMIGFLF VSF+GLFS++PLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  152  NTPINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMILKYKLTYPSGTATAYLINSFHTP  211

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  212  KGAKLAKKQVAVL  224



>gb|KHG05118.1| putative metal-nicotianamine transporter YSL7 -like protein [Gossypium 
arboreum]
 gb|KHG05773.1| putative metal-nicotianamine transporter YSL7 -like protein [Gossypium 
arboreum]
Length=700

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+   VP W  Q+T RA   S VL ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  34   VEAAFKGTPVPPWNKQITVRAVVTSLVLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  93

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWT  LEK G LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  VA Q    
Sbjct  94   VKTWTTVLEKLGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPLVAGQGDSG  153

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N PEN+K   + WMIGFLF+VSF+GLFS+V LRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  154  NTPENVKRLSLGWMIGFLFIVSFVGLFSIVTLRKIMILKYKLTYPSGTATAYLINSFHTP  213

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  214  KGAKLAKKQVAVL  226



>ref|XP_009592956.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=384

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            E  F  KEVP W+ Q+T R+     +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  +
Sbjct  12   EYAFRDKEVPPWKKQITLRSMVTGLILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAMI  71

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            ++WT  +EK G LK PFTRQENTVIQTCVVASSGIAFS G  SYM GMS  +A Q    N
Sbjct  72   RSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPFIAAQADAGN  131

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
             P N K   ++WM+ FL VVSF GLFS+V LRK+MI+ +KLTYPSGTATA+LIN FHTP+
Sbjct  132  TPNNTKKLDISWMLPFLLVVSFAGLFSIVALRKLMIMKYKLTYPSGTATAYLINCFHTPK  191

Query  624  GAKLAKKQVRTL  659
            GAKLAKKQV +L
Sbjct  192  GAKLAKKQVGSL  203



>ref|XP_002446812.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
 gb|EES11140.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
Length=753

 Score =   200 bits (508),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 132/194 (68%), Positives = 158/194 (81%), Gaps = 3/194 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER+FES+ VP WR Q+T RA   S  L VLF+ IVMKL+LTTGIIPSLNVSAGLLGFF 
Sbjct  61   IERVFESEPVPPWREQVTVRALVTSLFLAVLFSVIVMKLSLTTGIIPSLNVSAGLLGFFL  120

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            ++ WT  ++     K PFTRQENTV+QTCVVA+ GIAFSGGFGSY+FGMSE++A Q    
Sbjct  121  LRVWTAAVKDP---KRPFTRQENTVVQTCVVAAYGIAFSGGFGSYLFGMSETIASQAAEE  177

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +N+K P +AWMIGFLF+VSF+GLF++VPLRKVMIID++LTYPSGTATAHLIN FHTP
Sbjct  178  NNADNVKEPRLAWMIGFLFLVSFVGLFALVPLRKVMIIDYRLTYPSGTATAHLINGFHTP  237

Query  621  QGAKLAKKQVRTLG  662
             G++ AK QVR L 
Sbjct  238  DGSERAKSQVRALA  251



>gb|KJB79884.1| hypothetical protein B456_013G070800 [Gossypium raimondii]
Length=700

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+   VP W  Q+T RA   S VL ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  34   VEAAFKGTPVPPWNKQITVRAVVTSLVLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  93

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VKTWT  LEK G LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  V+ Q    
Sbjct  94   VKTWTTVLEKLGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPLVSGQGDSG  153

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N PEN+K   + WMIGFLFVVSF+GLFS+V LRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  154  NTPENVKRLSLGWMIGFLFVVSFVGLFSIVTLRKIMILKYKLTYPSGTATAYLINSFHTP  213

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  214  KGAKLAKKQVAVL  226



>ref|XP_011463452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Fragaria 
vesca subsp. vesca]
Length=702

 Score =   199 bits (505),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 132/193 (68%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F ++ VP W  Q+T RA   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  24   VEAAFRNQAVPPWTKQITVRAMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  83

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K +T  L K G LK PFTRQEN VIQTCVVASSGIAFS G  SY+ GMS  +A Q   A
Sbjct  84   LKFYTAILTKIGLLKQPFTRQENCVIQTCVVASSGIAFSSGTASYVLGMSGVIAAQGDGA  143

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIKNP V WM+GFLF VSFLGLFS++PLRKVMI+ +KLTYPSGTATA+LINSFHTP
Sbjct  144  NTPLNIKNPHVGWMMGFLFAVSFLGLFSIMPLRKVMIMKYKLTYPSGTATAYLINSFHTP  203

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  204  KGAKLAKKQVAVL  216



>gb|EMS55053.1| putative metal-nicotianamine transporter YSL10 [Triticum urartu]
Length=706

 Score =   198 bits (504),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 141/214 (66%), Positives = 166/214 (78%), Gaps = 20/214 (9%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER+FE +EVP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  18   IERVFEGQEVPDWKEQVTARALAVSALLGFMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  77

Query  261  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI  437
            + +WT+ L+K+G     PFTRQENTV+QTCVVA SGIAFSGGFGSYMFGMSE +++Q   
Sbjct  78   LHSWTRLLDKAGIPGVKPFTRQENTVVQTCVVACSGIAFSGGFGSYMFGMSERISEQSGE  137

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRK-------------------VMIIDF  560
              + ++IKNP + WMIGFLF+VSFLGLFSVVPLRK                   +MIID+
Sbjct  138  VRDEDSIKNPSLGWMIGFLFIVSFLGLFSVVPLRKACTSHHSTDLYSQHFDFTNIMIIDY  197

Query  561  KLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            KL YPSGTATAHLINSFHTPQGAKLAK QV+TLG
Sbjct  198  KLIYPSGTATAHLINSFHTPQGAKLAKLQVKTLG  231



>ref|XP_008221041.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Prunus 
mume]
Length=700

 Score =   198 bits (503),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 129/193 (67%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++  VP W  Q+T RA   SF+L ++F FIV KLNLTTG+IPSLNV+AGL+GF  
Sbjct  28   VEEAFKTTPVPPWTKQITVRAMVTSFLLSIVFNFIVCKLNLTTGVIPSLNVAAGLMGFAV  87

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK +T  +EK G LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  88   VKGYTAMIEKCGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYILGMSPKIAAQGDEG  147

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK+  V WMIGFLF VSF+GLFS++ LRK+MII +KLTYPSGTATA+LINSFHTP
Sbjct  148  NTPINIKHLDVGWMIGFLFAVSFVGLFSIMALRKMMIIKYKLTYPSGTATAYLINSFHTP  207

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  208  KGAKLAKKQVSVL  220



>gb|EEC78242.1| hypothetical protein OsI_17899 [Oryza sativa Indica Group]
Length=691

 Score =   197 bits (502),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 134/183 (73%), Positives = 153/183 (84%), Gaps = 1/183 (1%)
 Frame = +3

Query  117  WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSG  296
            W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF + +WTKFL+K G
Sbjct  33   WKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLTSWTKFLDKVG  92

Query  297  FLK-HPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNPENIKNPGV  473
                 PFTRQENTV+QTCVVA SGIAFSGGFGSY+F MS+ ++ Q   A +  NIKNP +
Sbjct  93   VASVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGEARDEHNIKNPSL  152

Query  474  AWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVR  653
             WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLINSFHTPQGAKLAK QV+
Sbjct  153  GWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHTPQGAKLAKMQVK  212

Query  654  TLG  662
             LG
Sbjct  213  MLG  215



>ref|XP_002532101.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF30280.1| oligopeptide transporter, putative [Ricinus communis]
Length=694

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+   VP W  Q+TFRA   SF L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  30   VEEAFKDTVVPPWTKQITFRAIATSFFLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFGI  89

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WT  L K+GFLK PFTRQENTVIQTCVVASSGIAFS G  SY+ GM   +A Q    
Sbjct  90   LKFWTTLLGKTGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMIPRIAAQSDGG  149

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+K+  + WM+ FLF+VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  150  NTPANVKHLSLGWMMAFLFIVSFVGLFSIVPLRKLMILKYKLTYPSGTATAYLINSFHTP  209

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  210  KGAKLAKKQVGVL  222



>emb|CBI35268.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  189  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgi  368
            MKLNLTTGIIPSLNVSAGLLGFFFV  WTKFL+KSG LK PFTRQENTVIQTCVVASSGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFVSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGI  60

Query  369  afsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  548
            AFSGGFGSY+FGMS+++AKQ   A   E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+M
Sbjct  61   AFSGGFGSYLFGMSQAIAKQSENAGGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIM  120

Query  549  IIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            I+DFKLTYPSGTATAHLINSFHTPQGAKLAKKQVR LG
Sbjct  121  IVDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRVLG  158



>emb|CBI35280.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  189  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgi  368
            MKLNLTTGIIPSLNVSAGLLGFFFV  WTKFL+KSG LK PFTRQENTVIQTCVVASSGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFVSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGI  60

Query  369  afsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  548
            AFSGGFGSY+FGMS+++AKQ   A   E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+M
Sbjct  61   AFSGGFGSYLFGMSQAIAKQSENAGGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIM  120

Query  549  IIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            I+DFKLTYPSGTATAHLINSFHTPQGAKLAKKQVR LG
Sbjct  121  IVDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRVLG  158



>ref|XP_011022272.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
 ref|XP_011015703.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
Length=699

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+  EVP W  Q+T RA   S VL ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  36   VEEGFKDTEVPPWAKQITLRAMLTSLVLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  95

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WT  L K+GFLK PFTRQENTV+QTCVVASSGIAFS G  SY+ GM+  +A Q    
Sbjct  96   LKFWTSLLGKAGFLKQPFTRQENTVVQTCVVASSGIAFSSGTASYLLGMTPRIANQSEGG  155

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+K   + WMIGFLF VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  156  NTPANMKELHLGWMIGFLFAVSFVGLFSIVPLRKLMILKYKLTYPSGTATAYLINSFHTP  215

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  216  KGAKLAKKQVSVL  228



>ref|XP_007225160.1| hypothetical protein PRUPE_ppa002368mg [Prunus persica]
 gb|EMJ26359.1| hypothetical protein PRUPE_ppa002368mg [Prunus persica]
Length=680

 Score =   197 bits (500),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++  VP W  Q+T RA   SF+L ++F FIV KLNLTTG+IPSLNV+AGL+GF  
Sbjct  8    VEEAFKTTPVPPWTKQITVRAMVTSFLLSIVFNFIVCKLNLTTGVIPSLNVAAGLMGFAV  67

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK +T  +EK G LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  68   VKGYTAMIEKCGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYILGMSPKIAAQGDEG  127

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK+  + WMIGFLF VSF+GLFS++ LRK+MII +KLTYPSGTATA+LINSFHTP
Sbjct  128  NTPINIKHLDLGWMIGFLFAVSFVGLFSIMALRKMMIIKYKLTYPSGTATAYLINSFHTP  187

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  188  KGAKLAKKQVSVL  200



>ref|XP_008360015.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7 [Malus domestica]
Length=705

 Score =   197 bits (500),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 129/193 (67%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+   VP W  Q+T R+   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  33   VEEAFKYTAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  92

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK +T  ++K GFLK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  93   VKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQGDEG  152

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P NIK   V WMIGFLF VSF+GLFS++PLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  153  NTPINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMIMKYKLTYPSGTATAYLINSFHTP  212

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  213  KGAKLAKKQVAVL  225



>ref|XP_010245475.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=680

 Score =   196 bits (498),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 132/192 (69%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            E+ FE++ VPSW++Q+TFRA   S VL V F FIVMKLNLTTGIIPSLNV+AGLLGFFF+
Sbjct  22   EKAFENEIVPSWKDQVTFRAILASAVLSVAFCFIVMKLNLTTGIIPSLNVAAGLLGFFFI  81

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            + +T  LE+ G LK PFTRQENTVIQT VVA+SGIAFSGG+GSY+ GM   VA Q     
Sbjct  82   RVYTWVLERFGLLKQPFTRQENTVIQTAVVAASGIAFSGGYGSYILGMMPKVAAQAQDGA  141

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
               N+K+  + W+ GFLF VSF+GLFS+VPLRK+MIID+KLTYPSGTATA LINSFHTP+
Sbjct  142  TTNNVKHLSLGWLYGFLFAVSFVGLFSIVPLRKIMIIDYKLTYPSGTATAFLINSFHTPK  201

Query  624  GAKLAKKQVRTL  659
            GAKLAKKQV  L
Sbjct  202  GAKLAKKQVSKL  213



>ref|XP_009758111.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=659

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            E  F+ KEVP W+ Q+T RA     +L V+F FIV KLNLTTG+IPSLNV+AGLLGF  +
Sbjct  13   EYAFKDKEVPPWKKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAMI  72

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            ++WT  +EK G LK PFTRQENTVIQTCVVASSGIAFS G  SYM GMS  +A Q    N
Sbjct  73   RSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPLIAAQADAGN  132

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
             P N K   ++WM+ +L VVSF GLFS+V LRK+MI+ +KLTYPSGTATA+LIN FHTP+
Sbjct  133  TPNNTKKLAISWMLSYLLVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHTPK  192

Query  624  GAKLAKKQV  650
            GAKLAKKQV
Sbjct  193  GAKLAKKQV  201



>ref|XP_009351712.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Pyrus 
x bretschneideri]
Length=701

 Score =   196 bits (497),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 127/193 (66%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F++  VP W  Q+T R+   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  28   VEEAFKATAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  87

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK +T  ++K GFLK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q  + 
Sbjct  88   VKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQGDLG  147

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N   NIK   V WMIGFLF VSF+GLFS++PLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  148  NTLINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMILKYKLTYPSGTATAYLINSFHTP  207

Query  621  QGAKLAKKQVRTL  659
            +GAKLA+KQV  L
Sbjct  208  KGAKLARKQVAVL  220



>ref|XP_004978145.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=725

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F    VPSWR QLT RAF V  +L V+F  I+MK++LTTGI PSLNV A LL +F 
Sbjct  63   VEEAFADLPVPSWREQLTVRAFVVGSLLAVVFNVILMKIDLTTGINPSLNVCASLLSYFL  122

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            V+ WTK +E  G L+ PFTRQENT+IQTCVV++ GI F+GGF SY+FGMS ++A + T A
Sbjct  123  VRVWTKAIEGMGLLRQPFTRQENTMIQTCVVSAYGITFTGGFSSYLFGMSGTIANKATEA  182

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+ +NIK P + WMIGF+F+VSF+GLF++VPLRKVMI+D+KLTYPSGTATA+LIN FH P
Sbjct  183  NDAQNIKEPHLGWMIGFMFLVSFVGLFALVPLRKVMIVDYKLTYPSGTATAYLINGFHAP  242

Query  621  QGAKLAKKQVRTLG  662
             G++ AKKQVRTLG
Sbjct  243  HGSERAKKQVRTLG  256



>ref|XP_009593227.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=658

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            E  F+ KEVP W  Q+T RA     +L V+F FIV KLNLTTG+IPSLNV+AGLLGF  +
Sbjct  12   EYAFKDKEVPPWEKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAMI  71

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            ++WT  +EK G LK PFTRQENTVIQTCVVASSGIAFS G  SYM GM   +A Q    N
Sbjct  72   RSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMDPFIAAQADAGN  131

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
             P N K   + WM+ +L VVSF GLFS+V LRK+MI+ +KLTYPSGTATA+LIN FHTP+
Sbjct  132  TPNNTKKLAIGWMLPYLLVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHTPK  191

Query  624  GAKLAKKQVRTL  659
            GAKLAKKQV +L
Sbjct  192  GAKLAKKQVGSL  203



>gb|KDP43290.1| hypothetical protein JCGZ_24211 [Jatropha curcas]
Length=671

 Score =   195 bits (495),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 125/190 (66%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  ++  EVP W  Q+T RA   S +L ++FTFIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  29   VEEAYKHIEVPPWTQQVTVRAMVTSIILSLVFTFIVCKLNLTTGVIPSLNVAAGLLGFGM  88

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WTK LEK+GFLK  FTRQENTVIQT VVA+SGIAFS G  SY+ GMS  +A +    
Sbjct  89   LKFWTKLLEKTGFLKQQFTRQENTVIQTFVVAASGIAFSSGTASYILGMSPRMAAESEGG  148

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P+N+K   + WMIGF F+VSF+GLFS++ LRK+MI+D KLTYPSGTATA+LINSFHTP
Sbjct  149  NTPDNVKTLSLGWMIGFNFLVSFVGLFSILALRKIMILDLKLTYPSGTATAYLINSFHTP  208

Query  621  QGAKLAKKQV  650
            +GAKLAKKQV
Sbjct  209  KGAKLAKKQV  218



>ref|XP_002446811.1| hypothetical protein SORBIDRAFT_06g023030 [Sorghum bicolor]
 gb|EES11139.1| hypothetical protein SORBIDRAFT_06g023030 [Sorghum bicolor]
Length=744

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  + VPSWR QLT RAF V  VL V+F  I+MK++LTTGI PSLNV A LL +F 
Sbjct  62   VEQAFADQPVPSWREQLTVRAFVVGAVLSVVFNVILMKIDLTTGINPSLNVCASLLSYFL  121

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            ++TWT+ +  +G LK PFTRQENT+IQTCVV++ GI F+GGF SY++GMS ++AK+ T +
Sbjct  122  LRTWTRAIGCTGLLKQPFTRQENTMIQTCVVSAYGITFTGGFSSYLYGMSGAIAKK-TES  180

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P++IK+P + WMIGF+F+VSF+GLF++VPLRKVMI+D+KLTYPSG ATA+L+N FH P
Sbjct  181  NDPQDIKDPHLGWMIGFMFLVSFVGLFALVPLRKVMIVDYKLTYPSGAATAYLLNGFHAP  240

Query  621  QGAKLAKKQVRTLG  662
            QG + AKKQVRTLG
Sbjct  241  QGTERAKKQVRTLG  254



>ref|XP_010253872.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=710

 Score =   194 bits (494),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 129/192 (67%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            E+ FE++ VPSW+ QLTFRAF  S VL V F FIVMKL+LTTGIIPSLNV+AGLLGFFF+
Sbjct  40   EKAFENEIVPSWKEQLTFRAFLASAVLSVAFCFIVMKLSLTTGIIPSLNVAAGLLGFFFI  99

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            + ++  L+K G LK PF+RQENTVIQT VVA+SGIAFS G+GSY+ GM   +A Q    N
Sbjct  100  RVYSFALQKFGLLKQPFSRQENTVIQTAVVAASGIAFSSGYGSYILGMMPKIASQAEDGN  159

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
               N+K   + WM GF+F VSF+GLFS+VPLRK+MIID+KLTYPSGTATA LINSFHT +
Sbjct  160  TVNNMKPLSLGWMYGFVFAVSFVGLFSIVPLRKIMIIDYKLTYPSGTATAFLINSFHTSK  219

Query  624  GAKLAKKQVRTL  659
            GAKLAKKQV  L
Sbjct  220  GAKLAKKQVNKL  231



>emb|CBI27128.3| unnamed protein product [Vitis vinifera]
Length=532

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  189  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgi  368
            MKLNLTTGIIPSLNVSAGLLGFFF+K+WTK +EKSG LK PFTRQENTVIQTCVVA+SGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFLKSWTKLMEKSGLLKQPFTRQENTVIQTCVVATSGI  60

Query  369  afsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  548
            AFSGGFGSY+FGMS +VA Q +  N  +N K+P ++W+IGFLF VSFLGLFSV+PLRK+M
Sbjct  61   AFSGGFGSYLFGMSSTVAGQSSETNAAQNTKDPSLSWIIGFLFAVSFLGLFSVLPLRKIM  120

Query  549  IIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            IID+KLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG
Sbjct  121  IIDYKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  158



>ref|XP_002306389.2| hypothetical protein POPTR_0005s09670g [Populus trichocarpa]
 gb|EEE93385.2| hypothetical protein POPTR_0005s09670g [Populus trichocarpa]
Length=698

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 149/193 (77%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+  EVP W  Q+T RA   S VL ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  35   VEEGFKDTEVPPWAKQITLRAMLTSLVLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  94

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WT  L K+G LK PFTRQENTV+QTCVVASSGIAFS G  SY+ GM+  +A Q    
Sbjct  95   LKFWTSLLGKAGILKQPFTRQENTVVQTCVVASSGIAFSSGTASYLLGMTPRIANQSEGG  154

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+K   + WMIGFLF VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP
Sbjct  155  NTPANMKELHLGWMIGFLFAVSFVGLFSIVPLRKLMILKYKLTYPSGTATAYLINSFHTP  214

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  215  KGAKLAKKQVSVL  227



>ref|XP_006350378.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=650

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  266
            + F+ + +P+W+ Q+T RA     +L V+F FIV KLNLTTG+IPSLNV+AGLLGF  ++
Sbjct  13   KAFKEEYIPAWQKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAGIR  72

Query  267  TWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANN  446
            TWT  ++K G LK PFTRQENTVIQTCVVASSGIAFS G  SYM GMS  +A Q    N 
Sbjct  73   TWTAVIDKFGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPYIASQADAGNT  132

Query  447  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQG  626
            P N K   + WM+ +LFVVSF GLFS+V LRK+MI+ +KLTYPSGTATA+LIN FHTP+G
Sbjct  133  PNNTKKLSITWMLPYLFVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHTPKG  192

Query  627  AKLAKKQVRTL  659
            AKLAKKQVR+L
Sbjct  193  AKLAKKQVRSL  203



>gb|EYU39420.1| hypothetical protein MIMGU_mgv1a002450mg [Erythranthe guttata]
Length=673

 Score =   193 bits (491),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 125/193 (65%), Positives = 149/193 (77%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE   VPSW+NQ+T RA   S +L  +F  IV KLNL+TG+IPSLNV+AGLLGF  
Sbjct  16   LEKAFEETAVPSWQNQITIRAMVTSVLLSAVFNVIVCKLNLSTGVIPSLNVAAGLLGFAM  75

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK +T  ++K G+LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS   A Q    
Sbjct  76   VKGYTVLIQKCGYLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPITAAQAETG  135

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+K   + WM+ FLF VSF+GLFS+VPLRKVMI+ +KLTYPSGTATA+LINSFHTP
Sbjct  136  NTPINVKQLSIGWMMTFLFTVSFVGLFSIVPLRKVMILRYKLTYPSGTATAYLINSFHTP  195

Query  621  QGAKLAKKQVRTL  659
            +GA+LAKKQV  L
Sbjct  196  KGARLAKKQVWVL  208



>gb|EPS65244.1| hypothetical protein M569_09533, partial [Genlisea aurea]
Length=616

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  99   SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTK  278
            ++EVPSW+NQ+T RA  VS +L  LF  IV KLNL+TG+IPSLNV+AGLLGF  VK+WT 
Sbjct  8    AEEVPSWKNQITVRAVVVSVLLSFLFNVIVCKLNLSTGVIPSLNVAAGLLGFAMVKSWTY  67

Query  279  FLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANNPENI  458
             + K G LK PFTRQENTVIQTCVVASSGIAFS G  SY+  MS   A Q+   NNP N+
Sbjct  68   LISKFGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLAMSPYTAAQVDAGNNPINV  127

Query  459  KNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLA  638
            K   + WMI FLF++SF+GLFS+ P+RK+MI+ +KLTYPSGTATA LINSFHT +GAKLA
Sbjct  128  KPLSLGWMIAFLFIMSFVGLFSIAPMRKLMILKYKLTYPSGTATACLINSFHTSRGAKLA  187

Query  639  KKQVRTL  659
            KK+VR L
Sbjct  188  KKKVRVL  194



>ref|XP_004978146.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=705

 Score =   192 bits (488),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 132/193 (68%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E +FES+ VPSWR Q+T RA  VS +L V+F+ IVMKL+LTTGIIPSLNVSAGLLGFFF
Sbjct  35   IEWVFESEPVPSWREQVTPRALAVSLLLAVVFSLIVMKLSLTTGIIPSLNVSAGLLGFFF  94

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            ++ WT  ++  G  + PFTRQENTV+QTCVVA+ GIAFSGGFGSY+FGMSE++A Q    
Sbjct  95   LRVWTAPVKNPG--RRPFTRQENTVVQTCVVAAYGIAFSGGFGSYLFGMSETIAAQAAEE  152

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN +N+K P ++WMIGFLF+VSF+GLF++VPLRKVMI+D+KLTYPSGTATAHLIN FHTP
Sbjct  153  NNADNVKEPRLSWMIGFLFLVSFVGLFALVPLRKVMIVDYKLTYPSGTATAHLINGFHTP  212

Query  621  QGAKLAKKQVRTL  659
             G++ A+ QVRTL
Sbjct  213  DGSERAESQVRTL  225



>gb|KCW65044.1| hypothetical protein EUGRSUZ_G02568 [Eucalyptus grandis]
Length=674

 Score =   192 bits (487),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 128/193 (66%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+  EVP WR QLT RA     +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  11   VEEAFKDTEVPPWRQQLTVRALVSGLLLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAM  70

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK W   LE+ G L+ PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  71   VKAWASLLERCGLLRQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSSLIAAQSDGG  130

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+KN  + W+I FLF VSF+GLFS+VPLRK MI+ +KLTYPSGTATA LINSFHTP
Sbjct  131  NTPVNVKNLSLGWIIAFLFTVSFVGLFSIVPLRKTMIMKYKLTYPSGTATAFLINSFHTP  190

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  191  KGAKLAKKQVAVL  203



>ref|XP_009768859.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=656

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            E  F+ KEVP W+ Q+T R+     +L V+F FIV KLNLTTG+IPSLNV+AGLLGF  +
Sbjct  12   EYAFKDKEVPPWKKQITLRSMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAMI  71

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            ++WT  +EK G LK PFTRQENTVIQTCVVASSGIAFS G  SYM GMS  +A Q    N
Sbjct  72   RSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPFIAAQADAGN  131

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
             P N     ++WM+ FL VVSF GLFS+V LRK+MII +KLTYPSGTATA+LIN FHTP+
Sbjct  132  TPNNTMKLDISWMLPFLLVVSFAGLFSIVALRKLMIIKYKLTYPSGTATAYLINCFHTPK  191

Query  624  GAKLAKKQV  650
            GAKLAKKQV
Sbjct  192  GAKLAKKQV  200



>ref|XP_004231467.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=653

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  266
            + F+ + +P+W+ Q+T RA     +L V+F FIV KLNLTTG+IPSLNV+AGLLGF  ++
Sbjct  14   KAFKDEFIPAWQKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAGIR  73

Query  267  TWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIANN  446
            TWT  ++K G LK PFTRQENTVIQTC+VASSGIAFS G  SYM GMS  +A Q    N 
Sbjct  74   TWTAVIDKFGMLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPYIASQADAGNT  133

Query  447  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQG  626
            P N K   + W++ +LFVVSF GLFS+V LRK+MI+ +KLTYPSGTATA+LIN FHTP+G
Sbjct  134  PNNTKKLSITWILPYLFVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHTPKG  193

Query  627  AKLAKKQVRTL  659
            AKLAKKQVR+L
Sbjct  194  AKLAKKQVRSL  204



>emb|CDP18194.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   191 bits (485),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 129/188 (69%), Positives = 148/188 (79%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLE  287
            +P W++Q+TFR   VS +LGVLF  I  KLNLT GIIPSLNV+AGLLGFFFVK+WT FL 
Sbjct  38   IPDWKHQITFRGLLVSALLGVLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVKSWTAFLS  97

Query  288  KSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMT---IANNPENI  458
            K G   HPFTRQENTVIQTCVVA  G+AFSGGFGSYM  M E   K +      N  E++
Sbjct  98   KLGLSVHPFTRQENTVIQTCVVACYGLAFSGGFGSYMLSMDEKTYKLIGEDYPGNRAEDV  157

Query  459  KNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLA  638
            KNPG+ WM+GF FVVSFLGLFS+VPLRKVM++D+KLTYPSGTATA LINSFHT  GA+LA
Sbjct  158  KNPGLLWMMGFTFVVSFLGLFSLVPLRKVMVLDYKLTYPSGTATAMLINSFHTSSGAELA  217

Query  639  KKQVRTLG  662
            +KQV  LG
Sbjct  218  RKQVSCLG  225



>ref|XP_004158539.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=678

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 6/194 (3%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ +ES+E+  WR QLT RAF VS  L  LFTFIVM +NLTTG+IP LNVSA LLG+ F
Sbjct  8    VEKSYESEELLPWRXQLTARAFVVSLFLSALFTFIVMNINLTTGLIPPLNVSAALLGYVF  67

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WTKF  KS     PFTRQENTVIQTCVVAS  +AF+GGFGSY+  MS+ + +     
Sbjct  68   LKIWTKFHHKS----LPFTRQENTVIQTCVVASVSVAFTGGFGSYLLAMSQRINELSEAK  123

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +N  + KNP + WMIGFLF+VSFLG F V+  RK MI+DFKLTYPSGTATAHLINSFHT 
Sbjct  124  DN--DFKNPSLGWMIGFLFIVSFLGPFLVLLFRKRMIMDFKLTYPSGTATAHLINSFHTS  181

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  182  RGAKLAKKQVRTLG  195



>gb|AFW58894.1| hypothetical protein ZEAMMB73_605066 [Zea mays]
Length=737

 Score =   191 bits (485),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 128/193 (66%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +ER+FE++ VP W  Q+T RA   S  L VLF+ IVMKL+LTTGIIPSLNVSAGLLGFF 
Sbjct  71   IERVFEAEPVPPWPQQVTPRALVTSLFLAVLFSVIVMKLSLTTGIIPSLNVSAGLLGFFL  130

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            ++ WT  ++     + PFTRQENTV+QTCVV++ GIAFSGGFGSY+FGMSE++A Q    
Sbjct  131  LRVWTAAVKDP---RRPFTRQENTVVQTCVVSAYGIAFSGGFGSYLFGMSETIASQAAEE  187

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NN  N+K P +AWMIGFLF+VSF+GLF++VPLRKVMIID++LTYPSGTATAHLIN FHTP
Sbjct  188  NNAGNVKEPRLAWMIGFLFLVSFVGLFALVPLRKVMIIDYRLTYPSGTATAHLINGFHTP  247

Query  621  QGAKLAKKQVRTL  659
             G++ AK QV TL
Sbjct  248  DGSERAKSQVLTL  260



>ref|XP_010068802.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=697

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE  F+  EVP WR QLT RA     +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  34   VEEAFKDTEVPPWRQQLTVRALVSGLLLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAM  93

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK W   LE+ G L+ PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q    
Sbjct  94   VKAWASLLERCGLLRQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSSLIAAQSDGG  153

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+KN  + W+I FLF VSF+GLFS+VPLRK MI+ +KLTYPSGTATA LINSFHTP
Sbjct  154  NTPVNVKNLSLGWIIAFLFTVSFVGLFSIVPLRKTMIMKYKLTYPSGTATAFLINSFHTP  213

Query  621  QGAKLAKKQVRTL  659
            +GAKLAKKQV  L
Sbjct  214  KGAKLAKKQVAVL  226



>emb|CBI27129.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  189  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgi  368
            MKLNLTTGIIPSLNVSAGLLGFFFVK+W KF+EKSG LK PFTRQENTVIQTCVVA+SGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFVKSWAKFMEKSGMLKQPFTRQENTVIQTCVVATSGI  60

Query  369  afsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  548
            AFSGGFGSY+FGMS  VA Q   + + +N K+P + W+IGFLF VSFLGLFSV+PLRK+M
Sbjct  61   AFSGGFGSYLFGMSSIVAGQSAKSIDAQNTKDPRLPWIIGFLFAVSFLGLFSVLPLRKIM  120

Query  549  IIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            +ID+KLTYPSGTATAHLINSFHTPQGAKLAK+QVRTLG
Sbjct  121  VIDYKLTYPSGTATAHLINSFHTPQGAKLAKQQVRTLG  158



>ref|XP_004138639.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=678

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 150/194 (77%), Gaps = 6/194 (3%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ +ES+E+  WR QLT RAF VS  L  LFTFIVM +NLTTG+IP LNVSA LLG+ F
Sbjct  8    VEKSYESEELLPWRKQLTARAFVVSLFLSALFTFIVMNINLTTGLIPPLNVSAALLGYVF  67

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            +K WTKF  KS     PFTRQENTVIQTCVVAS  +AF+GGFGSY+  MS+ + +     
Sbjct  68   LKIWTKFHHKS----LPFTRQENTVIQTCVVASVSVAFTGGFGSYLLAMSQRINELSEAK  123

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            +N  + KNP + W+IGFLF+VSFLG F V+  RK MI+DFKLTYPSGTATAHLINSFHT 
Sbjct  124  DN--DFKNPSLGWIIGFLFIVSFLGPFLVLLFRKRMIMDFKLTYPSGTATAHLINSFHTS  181

Query  621  QGAKLAKKQVRTLG  662
            +GAKLAKKQVRTLG
Sbjct  182  RGAKLAKKQVRTLG  195



>emb|CDP16865.1| unnamed protein product [Coffea canephora]
Length=688

 Score =   189 bits (481),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 126/193 (65%), Positives = 150/193 (78%), Gaps = 0/193 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E++F++ EVP WR Q+TFR+   S VL  +F  +V KLNLTTG+IPSLNV+AGLLGF F
Sbjct  28   IEQVFKNIEVPPWRKQITFRSVFTSAVLSFVFNVVVCKLNLTTGVIPSLNVAAGLLGFGF  87

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK +T  ++K G LK PFTRQENTVIQTCVVASSGIAFS G  SYM  MS  VA Q  + 
Sbjct  88   VKFYTTLVQKWGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLAMSSRVAAQADVG  147

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N P N+    + W+ GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA LINSFHTP
Sbjct  148  NAPINVMKLELGWIYGFLFAVSFIGLFSIVPLRKMMIMKYKLTYPSGTATAFLINSFHTP  207

Query  621  QGAKLAKKQVRTL  659
            +GAKLA KQVR L
Sbjct  208  KGAKLAVKQVRAL  220



>ref|XP_008669135.1| PREDICTED: probable metal-nicotianamine transporter YSL11 [Zea 
mays]
Length=727

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 120/194 (62%), Positives = 156/194 (80%), Gaps = 1/194 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE+ F  + VPSWR QLT RAF V  +L V+F  I+MK++LTTGI PSLNV A LL +F 
Sbjct  66   VEQAFADQPVPSWREQLTVRAFVVGALLSVVFNVILMKIDLTTGINPSLNVCASLLSYFL  125

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            ++TWT+ +   G L+ PFTRQENT+IQTCVV++ GI F+GGF SY+FGMS  +A + T  
Sbjct  126  LRTWTRAIGCMGLLRQPFTRQENTMIQTCVVSAYGITFTGGFSSYLFGMSAKIANK-TEV  184

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            N+P++IK+P + WM+GF+F+VSFLGLF++VPLRKVMI+D+KLTYPSG ATA+LIN FH P
Sbjct  185  NDPQDIKDPHLGWMMGFMFLVSFLGLFALVPLRKVMIVDYKLTYPSGAATAYLINGFHAP  244

Query  621  QGAKLAKKQVRTLG  662
            +G++ AKKQVRTLG
Sbjct  245  EGSERAKKQVRTLG  258



>ref|XP_006359441.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=655

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 145/192 (76%), Gaps = 0/192 (0%)
 Frame = +3

Query  84   ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  263
            E  F+ + VP W+ Q+  RA     +L V+F FIV KLNLTTG+IPSLNV+AGLLGF  V
Sbjct  21   EDAFKDEYVPPWQKQIALRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAGV  80

Query  264  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIAN  443
            ++WT  ++K G LK PFTRQENTVIQTCVVASSGIAFS G  SYM GMS  +A Q    N
Sbjct  81   RSWTVVIDKFGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPYIATQSGAGN  140

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
             P N K   ++WM  +LFVVSF GLFS+V LRK+MII +KLTYPSGTATA+LIN FHTP+
Sbjct  141  TPNNTKTLSISWMFPYLFVVSFAGLFSIVALRKLMIIKYKLTYPSGTATAYLINCFHTPK  200

Query  624  GAKLAKKQVRTL  659
            GAKLAKKQV +L
Sbjct  201  GAKLAKKQVGSL  212



>emb|CBI35270.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  189  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgi  368
            MKLNLTTGIIPSLNVSAGLLGFFF   WTKFL+ SG LK PFTRQENTVIQTCVVA SGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFTSGWTKFLDNSGLLKQPFTRQENTVIQTCVVAISGI  60

Query  369  afsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  548
            AFSGGFGSY+FGMSE VAK+     + ++ KNP + WMIGFLFVVSFLGLFSV+PLRK+M
Sbjct  61   AFSGGFGSYLFGMSEVVAKESEDVQSSQDYKNPAIGWMIGFLFVVSFLGLFSVLPLRKIM  120

Query  549  IIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            IIDFKLTYPSGTATAHLINSFHTP+GA+LAKKQVR LG
Sbjct  121  IIDFKLTYPSGTATAHLINSFHTPEGARLAKKQVRVLG  158



>gb|EYU27872.1| hypothetical protein MIMGU_mgv1a019282mg [Erythranthe guttata]
Length=681

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            +E+ FE   VPSWRNQ+T R+  VS +L  +F  IV KLNL+TG+IPSLNV+AGLLGF  
Sbjct  25   LEKEFEEMAVPSWRNQITIRSVVVSVILSAVFNVIVCKLNLSTGVIPSLNVAAGLLGFAM  84

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK WT  +EK+G+LK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS   A Q    
Sbjct  85   VKGWTVLMEKAGYLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPITAAQADTG  144

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            NNP NIK   + WM+ +LF VSFLGLFS+VPLRKVMI+ +KLTYPSGTATA+LINSFHTP
Sbjct  145  NNPMNIKQLSIGWMMAYLFTVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTP  204



>emb|CBI27130.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = +3

Query  81   VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  260
            VE++F++ EVPSWR Q+T RA   S VL  +F F++ KL+LTTGIIPS NV+AGLLGF F
Sbjct  44   VEQVFKNLEVPSWRKQITIRAMVTSIVLSFVFNFVICKLSLTTGIIPSFNVAAGLLGFAF  103

Query  261  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTIA  440
            VK W   +EK G LK PFTRQENTVIQTCVVA+SGIAF+ G  SY+  MS  VA Q    
Sbjct  104  VKAWVSLIEKFGLLKQPFTRQENTVIQTCVVAASGIAFNNGTSSYLLAMSSIVADQAD-R  162

Query  441  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTP  620
            + P N+K+  + W+IGFL  VSF+GLF +VPL ++MII +KLTYP+GTATA+LINSFHTP
Sbjct  163  DIPTNVKSLSLGWIIGFLLTVSFVGLFLMVPLTEMMIIKYKLTYPTGTATAYLINSFHTP  222

Query  621  QGAKLAKKQVRTL  659
            +GAKLA +QV  L
Sbjct  223  RGAKLAGQQVSAL  235



>ref|XP_010249085.1| PREDICTED: probable metal-nicotianamine transporter YSL6 [Nelumbo 
nucifera]
Length=677

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 131/193 (68%), Positives = 150/193 (78%), Gaps = 5/193 (3%)
 Frame = +3

Query  99   SKE--VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTW  272
            SKE  +P W++Q+T R   VS  LG LF  I  KLNLT GIIPSLNV+AGLLGFFFVK+W
Sbjct  29   SKEMPIPPWKDQITIRGLVVSMFLGTLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVKSW  88

Query  273  TKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI---AN  443
            T FL K GF   PFTRQENTVIQTCVVA  G+AFSGGFGSYM  M E   K + +    N
Sbjct  89   TGFLSKLGFSIAPFTRQENTVIQTCVVACYGLAFSGGFGSYMLAMDERTYKLIGVDYPGN  148

Query  444  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQ  623
              E+IKNP ++WMIGF+FVVSFLGLFS+VPLRKVM++D+KLTYPSGTATA LINSFHT +
Sbjct  149  RAEDIKNPALSWMIGFMFVVSFLGLFSLVPLRKVMVMDYKLTYPSGTATAMLINSFHTTK  208

Query  624  GAKLAKKQVRTLG  662
            GA+LA KQV  LG
Sbjct  209  GAELAGKQVHCLG  221



>gb|EEE57430.1| hypothetical protein OsJ_07631 [Oryza sativa Japonica Group]
Length=697

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 124/160 (78%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  183  IVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVass  362
            IVMKLNLTTGIIPSLNVSAGLLGFFFV+ WT  +E+ G LK PFTRQENTVIQTCVV++ 
Sbjct  68   IVMKLNLTTGIIPSLNVSAGLLGFFFVRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAY  127

Query  363  giafsggfgsymfgmsesVAKQMTIANNPENIKNPGVAWMIgflfvvsflglfsvvplRK  542
            GIAFSGGFGSY+FGMSE++AKQ T A + +NIK+P + WMIGFLF+VSF+GLF++VPLRK
Sbjct  128  GIAFSGGFGSYLFGMSETIAKQATEAKDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRK  187

Query  543  VMIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRTLG  662
            +MI+D+KLTYPSGTATA+LIN FHTP+GAKLAKKQV+TLG
Sbjct  188  IMIVDYKLTYPSGTATAYLINGFHTPEGAKLAKKQVKTLG  227



>gb|KJB70679.1| hypothetical protein B456_011G086700 [Gossypium raimondii]
Length=671

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 130/192 (68%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = +3

Query  96   ESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWT  275
            ES+ VP W++Q+T R   VS +LG LF  I  KLNLT GIIPSLNV AGLLGFFFVK+WT
Sbjct  23   ESELVPEWKDQITIRGLVVSALLGTLFCIITHKLNLTVGIIPSLNVGAGLLGFFFVKSWT  82

Query  276  KFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI---ANN  446
             FL K GF   PFT+QENTVIQTCVVA  G+AFSGGFGSYM  M E   K +      N 
Sbjct  83   GFLTKLGFQVSPFTKQENTVIQTCVVACYGLAFSGGFGSYMIAMDERTYKLIGADYPGNR  142

Query  447  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQG  626
             E+IKNPG+ WM GFLFVVSFLGLFS+ PLRKVM++D+KLTYPSGTATA LINSFHT  G
Sbjct  143  AEDIKNPGLGWMTGFLFVVSFLGLFSLTPLRKVMVLDYKLTYPSGTATAMLINSFHTHSG  202

Query  627  AKLAKKQVRTLG  662
            A+LA KQV+ LG
Sbjct  203  AELAGKQVKCLG  214



>ref|XP_010556294.1| PREDICTED: probable metal-nicotianamine transporter YSL6 [Tarenaya 
hassleriana]
Length=676

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 130/195 (67%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = +3

Query  90   IFESKE-VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  266
            +F+S E VP W+ Q+T R   VS +LG LF  I  KLNLT GIIPSLNV+AGLLGFFFVK
Sbjct  25   VFDSDERVPGWKEQITVRGLAVSALLGTLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVK  84

Query  267  TWTKFLEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI---  437
            +WT FL K GF   PFT+QENTVIQTCVVA  G+AFSGGFGSY+  M E   K + +   
Sbjct  85   SWTGFLSKLGFSVKPFTKQENTVIQTCVVACYGLAFSGGFGSYLIAMDEKTYKLIGVDYP  144

Query  438  ANNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHT  617
             N+ E++KNPG+ WM GFLFVVSFLGLFS+VPLRKVM++D+KLTYPSGTATA LINSFHT
Sbjct  145  GNHAEDVKNPGLWWMTGFLFVVSFLGLFSLVPLRKVMVLDYKLTYPSGTATAMLINSFHT  204

Query  618  PQGAKLAKKQVRTLG  662
              GA+LA KQV+ LG
Sbjct  205  NTGAELAGKQVKCLG  219



>ref|XP_003549112.1| PREDICTED: probable metal-nicotianamine transporter YSL6 isoform 
1 [Glycine max]
Length=674

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 125/188 (66%), Positives = 144/188 (77%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLE  287
            VP W+ Q+T R   VS VLG LF  I  KLNLT GIIPSLNV+AGLLGFFFV+TWT FL 
Sbjct  32   VPEWKEQITIRGLVVSAVLGTLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVRTWTGFLT  91

Query  288  KSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI---ANNPENI  458
            K GF   PFTRQENTVIQTCVVA  G+AFSGGFGS +  M +   + +      N  E++
Sbjct  92   KMGFFTKPFTRQENTVIQTCVVACYGLAFSGGFGSSLIAMDQRTYELIGPDYPGNRAEDV  151

Query  459  KNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLA  638
            KNPG+ WM+GF+FVVSFLGLFS+VPLRKVM++D+KLTYPSGTATA LINSFHT  GA+LA
Sbjct  152  KNPGLGWMMGFMFVVSFLGLFSLVPLRKVMVLDYKLTYPSGTATAMLINSFHTKTGAELA  211

Query  639  KKQVRTLG  662
              QVR LG
Sbjct  212  GNQVRQLG  219



>ref|XP_007161672.1| hypothetical protein PHAVU_001G088900g [Phaseolus vulgaris]
 gb|ESW33666.1| hypothetical protein PHAVU_001G088900g [Phaseolus vulgaris]
Length=676

 Score =   187 bits (474),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 124/190 (65%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  102  KEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKF  281
            +EVP W+ Q+T R   VS VLG LF  I  KLNLT GIIPSLNV+AGLLGFFFV+TWT F
Sbjct  30   EEVPEWKEQITIRGLVVSAVLGTLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVRTWTGF  89

Query  282  LEKSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI---ANNPE  452
            L K GF   PFTRQENTVIQTCVVA  G+AFSGGFGS +  M +   + +      N  E
Sbjct  90   LTKMGFFAKPFTRQENTVIQTCVVACYGLAFSGGFGSSLIAMDQRTYELIGPDYPGNRAE  149

Query  453  NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAK  632
            ++KNP + WM+GF+FVVSFLGLFS+VPLRKVM++D+KLTYPSGTAT+ LINSFHT  GA+
Sbjct  150  DVKNPALGWMMGFMFVVSFLGLFSLVPLRKVMVLDYKLTYPSGTATSMLINSFHTKTGAE  209

Query  633  LAKKQVRTLG  662
            LA  QVR LG
Sbjct  210  LAGNQVRQLG  219



>ref|XP_011000961.1| PREDICTED: probable metal-nicotianamine transporter YSL6 [Populus 
euphratica]
Length=669

 Score =   186 bits (473),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 126/188 (67%), Positives = 146/188 (78%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLE  287
            +P W++Q+T R   VS VLGVLF  I  KLNLT GIIPSLNV+AGLLGFFFVK+WT FL 
Sbjct  26   IPEWKDQITIRGLVVSAVLGVLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVKSWTGFLS  85

Query  288  KSGFLKHPFTRQENTVIQTCVVassgiafsggfgsymfgmsesVAKQMTI---ANNPENI  458
            + GF   PFT+QENTVIQTCVVA  G+AFSGGFGSY+  + E   K +      N  E++
Sbjct  86   RLGFSVSPFTKQENTVIQTCVVACYGLAFSGGFGSYLIALDEKTYKLIGTDYPGNRAEDV  145

Query  459  KNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLINSFHTPQGAKLA  638
            KNPG+ WMIGFLFVVSFLGLFS+ PLRKVM++D+KLTYPSGTATA LINSFHT  GA+LA
Sbjct  146  KNPGLGWMIGFLFVVSFLGLFSLAPLRKVMVMDYKLTYPSGTATAMLINSFHTNTGAELA  205

Query  639  KKQVRTLG  662
             KQV  LG
Sbjct  206  GKQVSCLG  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320