BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048O24

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09917.1|  unnamed protein product                                347   3e-115   Coffea canephora [robusta coffee]
ref|XP_009626614.1|  PREDICTED: probable transaldolase                  345   2e-114   Nicotiana tomentosiformis
ref|XP_011081206.1|  PREDICTED: probable transaldolase                  342   3e-113   Sesamum indicum [beniseed]
ref|XP_009788658.1|  PREDICTED: probable transaldolase                  342   4e-113   Nicotiana sylvestris
ref|NP_001234076.1|  transaldolase ToTAL2                               341   9e-113   
ref|XP_006355489.1|  PREDICTED: probable transaldolase-like             338   8e-112   Solanum tuberosum [potatoes]
ref|XP_002266734.2|  PREDICTED: probable transaldolase                  327   3e-107   Vitis vinifera
ref|XP_003631434.1|  PREDICTED: probable transaldolase isoform X2       323   1e-105   Vitis vinifera
gb|EYU30507.1|  hypothetical protein MIMGU_mgv1a007833mg                318   9e-104   Erythranthe guttata [common monkey flower]
ref|XP_003631436.1|  PREDICTED: probable transaldolase isoform X1       311   8e-101   Vitis vinifera
ref|XP_008238614.1|  PREDICTED: probable transaldolase                  309   2e-100   Prunus mume [ume]
ref|XP_010053436.1|  PREDICTED: probable transaldolase                  309   4e-100   Eucalyptus grandis [rose gum]
ref|XP_010259018.1|  PREDICTED: probable transaldolase                  308   4e-100   Nelumbo nucifera [Indian lotus]
ref|XP_009343901.1|  PREDICTED: probable transaldolase                  307   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_006440370.1|  hypothetical protein CICLE_v10020501mg             306   3e-99    Citrus clementina [clementine]
gb|KDO48369.1|  hypothetical protein CISIN_1g016178mg                   306   5e-99    Citrus sinensis [apfelsine]
ref|XP_007209231.1|  hypothetical protein PRUPE_ppa006960mg             305   5e-99    Prunus persica
gb|KDO48370.1|  hypothetical protein CISIN_1g016178mg                   305   5e-99    Citrus sinensis [apfelsine]
ref|XP_008437125.1|  PREDICTED: probable transaldolase                  301   4e-97    Cucumis melo [Oriental melon]
ref|XP_006477245.1|  PREDICTED: probable transaldolase-like             300   8e-97    Citrus sinensis [apfelsine]
ref|XP_004298660.1|  PREDICTED: probable transaldolase                  299   1e-96    Fragaria vesca subsp. vesca
ref|XP_004147589.1|  PREDICTED: transaldolase-like                      300   1e-96    
gb|KGN50221.1|  hypothetical protein Csa_5G160240                       298   1e-95    Cucumis sativus [cucumbers]
gb|KJB37607.1|  hypothetical protein B456_006G212700                    295   5e-95    Gossypium raimondii
gb|AFK49390.1|  unknown                                                 295   7e-95    Lotus japonicus
ref|XP_011018260.1|  PREDICTED: probable transaldolase                  294   2e-94    Populus euphratica
gb|AAQ17460.1|  transaldolase                                           293   3e-94    Gossypium hirsutum [American cotton]
ref|XP_006368174.1|  hypothetical protein POPTR_0001s00260g             294   3e-94    Populus trichocarpa [western balsam poplar]
ref|XP_003525805.1|  PREDICTED: transaldolase-like                      293   4e-94    Glycine max [soybeans]
gb|ACU24347.1|  unknown                                                 290   5e-93    Glycine max [soybeans]
gb|KEH31659.1|  transaldolase total2 protein                            288   6e-93    Medicago truncatula
gb|KHN09791.1|  Transaldolase                                           290   9e-93    Glycine soja [wild soybean]
ref|XP_004516847.1|  PREDICTED: transaldolase-like                      289   2e-92    Cicer arietinum [garbanzo]
ref|XP_003608757.1|  Transaldolase                                      288   4e-92    Medicago truncatula
ref|XP_008794812.1|  PREDICTED: probable transaldolase                  287   6e-92    Phoenix dactylifera
ref|XP_007155630.1|  hypothetical protein PHAVU_003G218000g             287   1e-91    Phaseolus vulgaris [French bean]
ref|NP_001242359.1|  uncharacterized protein LOC100800377               286   3e-91    Glycine max [soybeans]
gb|KEH31658.1|  transaldolase total2 protein                            284   2e-90    Medicago truncatula
ref|XP_009407153.1|  PREDICTED: probable transaldolase                  283   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010093688.1|  hypothetical protein L484_019027                   283   5e-90    Morus notabilis
gb|KDP25631.1|  hypothetical protein JCGZ_20787                         282   7e-90    Jatropha curcas
ref|XP_007039918.1|  Transaldolase isoform 1                            282   9e-90    
ref|XP_010941128.1|  PREDICTED: probable transaldolase                  282   9e-90    Elaeis guineensis
ref|XP_010919480.1|  PREDICTED: probable transaldolase                  279   2e-88    Elaeis guineensis
ref|XP_006840956.1|  hypothetical protein AMTR_s00085p00019560          278   2e-88    Amborella trichopoda
gb|ADG27842.1|  transaldolase                                           278   3e-88    Gossypium hirsutum [American cotton]
ref|XP_006307691.1|  hypothetical protein CARUB_v10009318mg             278   5e-88    Capsella rubella
gb|EPS67513.1|  hypothetical protein M569_07263                         275   7e-88    Genlisea aurea
gb|AAL65634.1|  transaldolase-like protein                              276   9e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KHG09888.1|  Transaldolase                                           277   9e-88    Gossypium arboreum [tree cotton]
gb|AAL65624.1|  transaldolase-like protein                              276   1e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAL65627.1|  transaldolase-like protein                              276   1e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAL65638.1|  transaldolase-like protein                              276   1e-87    Arabidopsis lyrata [lyrate rockcress]
ref|XP_008787008.1|  PREDICTED: probable transaldolase                  276   2e-87    Phoenix dactylifera
ref|XP_006417257.1|  hypothetical protein EUTSA_v10007790mg             273   2e-87    
ref|XP_008778383.1|  PREDICTED: probable transaldolase                  275   3e-87    
gb|AAL65623.1|  transaldolase-like protein                              274   5e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KFK43488.1|  hypothetical protein AALP_AA1G131500                    275   5e-87    Arabis alpina [alpine rockcress]
gb|AAL65605.1|  transaldolase-like protein                              274   5e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAL65612.1|  transaldolase-like protein                              274   5e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAL65620.1|  transaldolase-like protein                              274   5e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAL65622.1|  transaldolase-like protein                              274   7e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382350.1|  PREDICTED: probable transaldolase                  275   8e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_563900.1|  transaldolase-like protein                            274   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAM66063.1|  transaldolase ToTAL2                                    274   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417256.1|  hypothetical protein EUTSA_v10007790mg             273   6e-86    Eutrema salsugineum [saltwater cress]
ref|XP_010458643.1|  PREDICTED: probable transaldolase                  271   3e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010533770.1|  PREDICTED: probable transaldolase                  270   4e-85    Tarenaya hassleriana [spider flower]
emb|CDX98081.1|  BnaA06g08320D                                          269   1e-84    
ref|XP_010676173.1|  PREDICTED: probable transaldolase                  269   1e-84    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAG95062.1|  unnamed protein product                                263   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009148608.1|  PREDICTED: probable transaldolase                  268   4e-84    Brassica rapa
ref|XP_010906619.1|  PREDICTED: probable transaldolase                  267   5e-84    Elaeis guineensis
ref|XP_010476185.1|  PREDICTED: probable transaldolase isoform X1       268   5e-84    Camelina sativa [gold-of-pleasure]
emb|CDY30055.1|  BnaC05g09650D                                          267   5e-83    Brassica napus [oilseed rape]
gb|EAZ05627.1|  hypothetical protein OsI_27846                          263   3e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001061014.1|  Os08g0154300                                       262   4e-82    
ref|NP_001184971.1|  transaldolase-like protein                         262   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006659843.1|  PREDICTED: probable transaldolase-like             260   1e-81    
dbj|BAJ97939.1|  predicted protein                                      260   3e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573490.1|  PREDICTED: probable transaldolase                  260   3e-81    
gb|ABK26234.1|  unknown                                                 259   6e-81    Picea sitchensis
gb|ACN40140.1|  unknown                                                 259   6e-81    Picea sitchensis
gb|AIN39832.1|  hypothetical protein                                    253   5e-80    Zoysia matrella [Japanese carpet grass]
ref|XP_002532577.1|  transaldolase total2, putative                     255   1e-79    
ref|XP_002445069.1|  hypothetical protein SORBIDRAFT_07g003600          256   2e-79    Sorghum bicolor [broomcorn]
gb|EMS49842.1|  Transaldolase                                           252   2e-79    Triticum urartu
ref|NP_001131550.1|  hypothetical protein                               253   2e-78    Zea mays [maize]
ref|XP_004972823.1|  PREDICTED: transaldolase-like                      249   6e-77    Setaria italica
ref|XP_001780973.1|  predicted protein                                  239   8e-73    
ref|XP_008364532.1|  PREDICTED: probable transaldolase                  221   6e-69    
gb|AFK41264.1|  unknown                                                 218   2e-67    Medicago truncatula
gb|EMT17151.1|  Transaldolase                                           220   3e-66    
ref|XP_002889922.1|  hypothetical protein ARALYDRAFT_888542             222   4e-62    
ref|XP_007039919.1|  Transaldolase isoform 2                            194   8e-57    
gb|KJB37609.1|  hypothetical protein B456_006G212700                    187   2e-54    Gossypium raimondii
dbj|BAD94458.1|  hypothetical protein                                   183   7e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493866.1|  PREDICTED: probable transaldolase isoform X1       178   1e-50    Camelina sativa [gold-of-pleasure]
ref|XP_010493869.1|  PREDICTED: probable transaldolase isoform X2       150   2e-40    
ref|XP_010493876.1|  PREDICTED: probable transaldolase isoform X3       148   1e-39    
ref|XP_006574169.1|  PREDICTED: uncharacterized protein LOC102659644    146   3e-39    
gb|AFW61221.1|  hypothetical protein ZEAMMB73_046549                    145   3e-38    
ref|XP_005651138.1|  aldolase                                           135   1e-33    Coccomyxa subellipsoidea C-169
gb|KJB20856.1|  hypothetical protein B456_003G169200                    125   4e-32    Gossypium raimondii
ref|WP_005647616.1|  transaldolase                                      124   5e-31    
ref|WP_032093096.1|  transaldolase                                      126   8e-31    Necropsobacter rosorum
ref|WP_032093091.1|  transaldolase                                      125   1e-30    Necropsobacter rosorum
ref|WP_011608357.1|  transaldolase                                      125   2e-30    Histophilus somni
ref|WP_012341545.1|  transaldolase                                      125   2e-30    Histophilus somni
ref|WP_042611678.1|  transaldolase                                      124   5e-30    Haemophilus influenzae
ref|WP_012054488.1|  transaldolase                                      124   7e-30    Haemophilus influenzae
ref|WP_005689370.1|  transaldolase                                      124   7e-30    Haemophilus
ref|WP_040976877.1|  transaldolase                                      124   7e-30    Necropsobacter massiliensis
ref|WP_005667515.1|  transaldolase                                      124   7e-30    Haemophilus influenzae
ref|WP_005693444.1|  transaldolase                                      123   1e-29    Haemophilus influenzae
ref|WP_005651803.1|  transaldolase                                      123   1e-29    
ref|WP_038440031.1|  transaldolase                                      123   1e-29    Haemophilus influenzae
ref|WP_042602002.1|  transaldolase                                      123   1e-29    Haemophilus influenzae
ref|WP_005686423.1|  transaldolase                                      122   2e-29    Haemophilus influenzae
ref|WP_021034924.1|  transaldolase B                                    122   3e-29    Haemophilus influenzae
ref|WP_011272395.1|  transaldolase                                      122   3e-29    Haemophilus influenzae
ref|WP_005690695.1|  transaldolase                                      122   3e-29    Haemophilus
ref|WP_012055411.1|  transaldolase                                      122   3e-29    
ref|WP_005670786.1|  transaldolase                                      122   3e-29    
ref|WP_005662742.1|  transaldolase                                      122   3e-29    Haemophilus influenzae
ref|WP_011201500.1|  transaldolase [                                    122   4e-29    Basfia
ref|WP_015702599.1|  transaldolase                                      122   4e-29    Pasteurella multocida
ref|WP_015702071.1|  transaldolase                                      122   4e-29    Haemophilus influenzae
ref|WP_006996542.1|  MULTISPECIES: transaldolase                        122   4e-29    Haemophilus
ref|WP_040034674.1|  transaldolase                                      121   4e-29    Haemophilus influenzae
ref|WP_012440450.1|  transaldolase                                      121   5e-29    Erwinia tasmaniensis
ref|WP_005697398.1|  transaldolase                                      121   6e-29    Haemophilus
ref|WP_014064668.1|  transaldolase                                      121   6e-29    Haemophilus parainfluenzae
ref|WP_005661288.1|  transaldolase                                      121   6e-29    Haemophilus influenzae
ref|WP_032107818.1|  transaldolase                                      120   7e-29    Haemophilus massiliensis
ref|WP_007242430.1|  transaldolase                                      120   1e-28    Haemophilus pittmaniae
ref|WP_005700118.1|  transaldolase                                      120   1e-28    Haemophilus parainfluenzae
ref|WP_038441373.1|  transaldolase                                      120   1e-28    Haemophilus influenzae
ref|WP_032824638.1|  transaldolase                                      120   1e-28    Haemophilus influenzae
ref|WP_005704791.1|  transaldolase                                      120   1e-28    Aggregatibacter aphrophilus
ref|WP_005702343.1|  transaldolase                                      120   1e-28    Aggregatibacter aphrophilus
ref|WP_005636292.1|  transaldolase                                      120   2e-28    Haemophilus haemolyticus
ref|WP_005626807.1|  transaldolase                                      119   2e-28    Haemophilus haemolyticus
ref|WP_005643167.1|  transaldolase                                      119   2e-28    Haemophilus quentini
ref|WP_005694697.1|  transaldolase                                      119   3e-28    Haemophilus
ref|WP_005657273.1|  transaldolase                                      119   3e-28    Haemophilus influenzae
gb|EJS86902.1|  transaldolase B                                         119   4e-28    Pasteurella multocida subsp. multocida str. Anand1_buffalo
ref|WP_005718405.1|  transaldolase                                      118   6e-28    Pasteurella multocida
ref|WP_005752148.1|  transaldolase                                      118   6e-28    Pasteurella multocida
ref|WP_005757802.1|  transaldolase                                      118   6e-28    Pasteurella multocida
ref|WP_010907246.1|  transaldolase                                      118   6e-28    Pasteurella multocida
ref|WP_005724444.1|  transaldolase                                      118   6e-28    
ref|WP_005755204.1|  transaldolase                                      118   7e-28    Pasteurella multocida
ref|WP_014167508.1|  transaldolase                                      118   7e-28    
ref|WP_005635758.1|  transaldolase                                      118   7e-28    Haemophilus haemolyticus
gb|KIY99632.1|  transaldolase                                           119   7e-28    Monoraphidium neglectum
ref|WP_032998029.1|  transaldolase                                      118   7e-28    Aggregatibacter segnis
gb|EFU66896.1|  transaldolase A                                         119   7e-28    Aggregatibacter segnis ATCC 33393
ref|WP_009500796.1|  transaldolase                                      118   8e-28    Haemophilus sp. oral taxon 851
ref|WP_005571405.1|  transaldolase                                      118   1e-27    Aggregatibacter actinomycetemcomitans
ref|WP_005555763.1|  transaldolase                                      118   1e-27    Aggregatibacter actinomycetemcomitans
ref|WP_042890069.1|  transaldolase                                      118   1e-27    Aggregatibacter actinomycetemcomitans
ref|WP_021616992.1|  transaldolase                                      117   1e-27    Aggregatibacter sp. oral taxon 458
ref|WP_004580540.1|  transaldolase B                                    117   1e-27    Marinobacter nanhaiticus
ref|WP_005544407.1|  transaldolase                                      117   1e-27    Aggregatibacter actinomycetemcomitans
ref|WP_041160763.1|  transaldolase                                      117   1e-27    Aggregatibacter actinomycetemcomitans
ref|WP_039708898.1|  transaldolase                                      117   1e-27    Actinobacillus pleuropneumoniae
ref|WP_012262678.1|  transaldolase                                      117   1e-27    Actinobacillus pleuropneumoniae
ref|WP_028831304.1|  transaldolase                                      117   2e-27    
ref|WP_005594644.1|  transaldolase                                      117   2e-27    Aggregatibacter actinomycetemcomitans
ref|WP_005600018.1|  transaldolase                                      117   2e-27    Actinobacillus pleuropneumoniae
ref|WP_005616549.1|  transaldolase                                      117   2e-27    Actinobacillus pleuropneumoniae
ref|WP_005611143.1|  transaldolase                                      117   2e-27    Actinobacillus pleuropneumoniae
ref|WP_005595691.1|  transaldolase                                      117   2e-27    Actinobacillus pleuropneumoniae
ref|WP_014992075.1|  MULTISPECIES: transaldolase                        117   2e-27    Actinobacillus
ref|WP_034787030.1|  transaldolase                                      117   2e-27    Ewingella americana
ref|WP_044024249.1|  transaldolase                                      117   2e-27    Actinobacillus ureae
ref|WP_006986706.1|  transaldolase                                      117   3e-27    Cardiobacterium valvarum
ref|WP_005603232.1|  transaldolase                                      117   3e-27    Actinobacillus pleuropneumoniae
ref|WP_018357226.1|  transaldolase                                      117   3e-27    Rodentibacter pneumotropicus
gb|EFA77817.1|  transaldolase                                           116   3e-27    Heterostelium album PN500
ref|WP_017806641.1|  transaldolase                                      116   4e-27    Avibacterium paragallinarum
ref|WP_005564349.1|  transaldolase                                      116   4e-27    Aggregatibacter actinomycetemcomitans
ref|WP_017345614.1|  transaldolase                                      116   4e-27    Pantoea sp. A4
ref|WP_023091623.1|  transaldolase                                      116   4e-27    Pseudomonas
gb|EFX92188.1|  transaldolase                                           116   4e-27    Actinobacillus ureae ATCC 25976
ref|WP_025901184.1|  MULTISPECIES: transaldolase                        116   5e-27    Tatumella
ref|WP_012072337.1|  transaldolase                                      116   5e-27    Actinobacillus succinogenes
ref|WP_029684573.1|  transaldolase                                      116   5e-27    Tatumella saanichensis
ref|WP_004173248.1|  transaldolase B                                    115   6e-27    
ref|XP_004528663.1|  PREDICTED: transaldolase B-like                    115   6e-27    
ref|WP_018650945.1|  transaldolase                                      115   7e-27    Actinobacillus capsulatus
ref|WP_043086091.1|  transaldolase                                      115   7e-27    Pluralibacter gergoviae
emb|CCP04221.1|  transaldolase B                                        115   7e-27    Erwinia amylovora Ea644
ref|WP_011848304.1|  transaldolase                                      115   7e-27    Actinobacillus pleuropneumoniae
ref|WP_005763792.1|  transaldolase                                      115   7e-27    Pasteurella
emb|CBA22729.1|  transaldolase B                                        115   7e-27    Erwinia amylovora CFBP1430
gb|ERL83343.1|  hypothetical protein D910_00243                         115   7e-27    Dendroctonus ponderosae
ref|WP_009634748.1|  transaldolase                                      115   7e-27    Serratia sp. M24T3
emb|CAY73102.1|  transaldolase B                                        115   7e-27    Erwinia pyrifoliae DSM 12163
ref|WP_024496084.1|  transaldolase                                      115   8e-27    Candidatus Schmidhempelia bombi
ref|WP_033477301.1|  transaldolase                                      115   8e-27    Erwinia amylovora
ref|WP_013035857.1|  transaldolase                                      115   9e-27    Erwinia amylovora
ref|XP_005097705.1|  PREDICTED: transaldolase-like isoform X1           115   9e-27    Aplysia californica
ref|WP_023656116.1|  transaldolase B                                    115   9e-27    
ref|WP_012667047.1|  transaldolase                                      115   9e-27    Erwinia pyrifoliae
ref|WP_014542223.1|  transaldolase                                      115   1e-26    Erwinia sp. Ejp617
ref|WP_044696429.1|  transaldolase                                      112   1e-26    
ref|WP_017493003.1|  transaldolase                                      115   1e-26    Rouxiella badensis
ref|WP_013445814.1|  transaldolase                                      115   1e-26    Paludibacter propionicigenes
ref|WP_019616015.1|  transaldolase                                      115   1e-26    Psychromonas ossibalaenae
ref|XP_002595826.1|  hypothetical protein BRAFLDRAFT_115715             115   1e-26    Branchiostoma floridae
ref|WP_027071547.1|  transaldolase                                      115   1e-26    Luteimonas sp. J29
ref|WP_011768519.1|  transaldolase                                      115   1e-26    Psychromonas ingrahamii
ref|WP_009092233.1|  transaldolase                                      115   1e-26    Pantoea
ref|WP_019682663.1|  transaldolase                                      113   2e-26    Pseudomonas aeruginosa
ref|XP_005097706.1|  PREDICTED: transaldolase-like isoform X2           114   2e-26    Aplysia californica
ref|WP_038023177.1|  transaldolase                                      114   2e-26    Tatumella morbirosei
ref|WP_027947678.1|  transaldolase                                      114   2e-26    Halomonas anticariensis
emb|CBK21823.2|  unnamed protein product                                114   2e-26    Blastocystis hominis
gb|EEF57116.1|  transaldolase                                           114   2e-26    Pedosphaera parvula Ellin514
ref|WP_044469606.1|  transaldolase                                      114   2e-26    Mannheimia massilioguelmaensis
ref|WP_005760753.1|  MULTISPECIES: transaldolase                        114   2e-26    Pasteurellaceae
ref|WP_017517514.1|  transaldolase                                      114   2e-26    Pseudomonas nitroreducens
gb|EJS86828.1|  transaldolase B                                         112   2e-26    Pasteurella multocida subsp. multocida str. Anand1_buffalo
ref|XP_640977.1|  hypothetical protein DDB_G0280909                     114   2e-26    Dictyostelium discoideum AX4
ref|WP_039159310.1|  transaldolase                                      114   2e-26    Gallibacterium anatis
ref|WP_021461212.1|  transaldolase                                      114   3e-26    Gallibacterium anatis
gb|AAX47112.1|  transaldolase B                                         111   3e-26    Pantoea stewartii subsp. stewartii
ref|WP_013746700.1|  transaldolase                                      114   3e-26    Gallibacterium anatis
ref|WP_039136836.1|  transaldolase                                      114   3e-26    Gallibacterium
ref|WP_016955785.1|  transaldolase                                      114   3e-26    Catenovulum agarivorans
ref|WP_039166912.1|  transaldolase                                      114   3e-26    Gallibacterium anatis
ref|WP_033892102.1|  transaldolase                                      113   3e-26    Pseudomonas aeruginosa
ref|WP_039163815.1|  transaldolase                                      114   3e-26    Gallibacterium anatis
ref|WP_031766810.1|  transaldolase                                      113   3e-26    
ref|WP_032805206.1|  transaldolase                                      110   3e-26    
ref|WP_040218947.1|  transaldolase                                      114   3e-26    Haemophilus parahaemolyticus
ref|WP_024916994.1|  transaldolase                                      113   3e-26    Pseudomonas aeruginosa
ref|WP_034001939.1|  transaldolase                                      113   3e-26    Pseudomonas aeruginosa
ref|WP_033749420.1|  MULTISPECIES: transaldolase                        114   3e-26    Pantoea
ref|XP_002117651.1|  expressed hypothetical protein                     114   4e-26    Trichoplax adhaerens
ref|WP_031773824.1|  transaldolase                                      112   4e-26    
gb|AAT51194.1|  PA2796                                                  113   4e-26    synthetic construct
ref|WP_006117626.1|  transaldolase                                      113   4e-26    Pantoea
ref|WP_034083943.1|  transaldolase                                      113   4e-26    
ref|WP_034008330.1|  transaldolase                                      113   4e-26    Pseudomonas aeruginosa
ref|WP_027348602.1|  transaldolase                                      113   4e-26    Halotalea alkalilenta
ref|WP_033740221.1|  transaldolase                                      113   4e-26    Pantoea stewartii
ref|WP_039026892.1|  transaldolase                                      113   4e-26    Pseudomonas aeruginosa
ref|WP_042164877.1|  transaldolase                                      113   4e-26    Pseudomonas
ref|WP_039086517.1|  transaldolase                                      113   4e-26    Gallibacterium anatis
ref|WP_034035654.1|  transaldolase                                      113   4e-26    Pseudomonas aeruginosa
ref|WP_019371665.1|  transaldolase                                      113   4e-26    Pseudomonas aeruginosa
ref|WP_003090868.1|  MULTISPECIES: transaldolase                        113   4e-26    Pseudomonas
ref|WP_039088471.1|  transaldolase                                      113   4e-26    Gallibacterium anatis
ref|WP_033966707.1|  transaldolase                                      113   4e-26    Pseudomonas aeruginosa
ref|WP_012613934.1|  transaldolase                                      113   4e-26    Pseudomonas
ref|WP_023911959.1|  transaldolase                                      113   4e-26    Pseudomonas aeruginosa
ref|WP_039153813.1|  transaldolase                                      113   4e-26    Gallibacterium anatis
ref|WP_039080933.1|  transaldolase                                      113   4e-26    Gallibacterium anatis
ref|WP_019106399.1|  transaldolase                                      113   5e-26    Pantoea ananatis
ref|WP_039700083.1|  transaldolase                                      113   5e-26    Pseudomonas aeruginosa
ref|WP_033988500.1|  transaldolase                                      113   5e-26    Pseudomonas aeruginosa
ref|WP_010253690.1|  MULTISPECIES: transaldolase                        113   5e-26    Pantoea
ref|WP_033756511.1|  transaldolase                                      113   5e-26    Pantoea agglomerans
ref|WP_034055042.1|  transaldolase                                      113   5e-26    Pseudomonas aeruginosa
ref|WP_023113160.1|  transaldolase                                      113   5e-26    Pseudomonas
ref|WP_023111615.1|  transaldolase                                      113   5e-26    Pseudomonas aeruginosa
ref|WP_039149448.1|  transaldolase                                      113   5e-26    Gallibacterium anatis
ref|WP_039145321.1|  transaldolase                                      113   5e-26    Gallibacterium anatis
ref|WP_025423530.1|  transaldolase                                      113   5e-26    Sodalis praecaptivus
ref|WP_018346304.1|  transaldolase                                      113   5e-26    Gallibacterium anatis
ref|WP_024763891.1|  transaldolase                                      113   5e-26    Pseudomonas
ref|WP_015700986.1|  transaldolase                                      113   6e-26    Pantoea
ref|WP_028724643.1|  transaldolase                                      113   6e-26    Pantoea ananatis
ref|WP_003218917.1|  transaldolase                                      113   6e-26    Pseudomonas fluorescens
ref|WP_013024554.1|  transaldolase                                      113   6e-26    Pantoea
ref|WP_008437618.1|  transaldolase                                      113   6e-26    Pseudomonas
ref|WP_036844282.1|  transaldolase                                      113   6e-26    
ref|XP_009050740.1|  hypothetical protein LOTGIDRAFT_142681             113   7e-26    
ref|WP_010176330.1|  transaldolase                                      112   7e-26    
ref|WP_040262635.1|  transaldolase                                      113   7e-26    
ref|WP_006709608.1|  transaldolase                                      112   7e-26    
ref|WP_039382472.1|  transaldolase                                      112   7e-26    
ref|WP_005709800.1|  transaldolase                                      112   8e-26    
ref|WP_017373948.1|  transaldolase                                      112   8e-26    
ref|WP_036110219.1|  transaldolase                                      112   8e-26    
ref|WP_015965996.1|  transaldolase                                      112   8e-26    
ref|WP_014668506.1|  transaldolase                                      112   8e-26    
ref|XP_004356352.1|  transaldolase                                      112   8e-26    
ref|WP_025865704.1|  transaldolase                                      112   9e-26    
ref|WP_027014098.1|  transaldolase                                      112   9e-26    
ref|WP_033886266.1|  transaldolase                                      112   9e-26    
ref|WP_021701580.1|  transaldolase                                      112   1e-25    
ref|WP_040550941.1|  transaldolase                                      112   1e-25    
ref|WP_017477222.1|  transaldolase                                      112   1e-25    
ref|WP_025315786.1|  transaldolase                                      112   1e-25    
ref|WP_039083631.1|  transaldolase                                      112   1e-25    
ref|WP_003854842.1|  MULTISPECIES: transaldolase                        112   1e-25    
ref|WP_007526258.1|  transaldolase                                      112   1e-25    
ref|WP_005705396.1|  transaldolase                                      112   1e-25    
ref|WP_010130084.1|  transaldolase                                      112   1e-25    
ref|WP_015477812.1|  transaldolase B                                    112   1e-25    
ref|WP_037033577.1|  transaldolase                                      112   1e-25    
ref|WP_023472223.1|  Transaldolase                                      112   1e-25    
ref|WP_010907268.1|  transaldolase                                      112   1e-25    
ref|WP_025271159.1|  transaldolase                                      112   1e-25    
ref|WP_035686395.1|  transaldolase                                      112   1e-25    
ref|WP_039091116.1|  transaldolase                                      112   1e-25    
ref|XP_005844288.1|  hypothetical protein CHLNCDRAFT_59034              113   1e-25    
ref|WP_039091768.1|  transaldolase                                      112   1e-25    
ref|WP_009876707.1|  transaldolase                                      112   1e-25    
ref|WP_007884940.1|  transaldolase                                      112   1e-25    
ref|WP_028862394.1|  transaldolase                                      112   1e-25    
ref|WP_013577072.1|  MULTISPECIES: transaldolase                        112   1e-25    
ref|WP_005724498.1|  transaldolase                                      112   1e-25    
ref|WP_013356716.1|  MULTISPECIES: transaldolase                        112   1e-25    
gb|KFS06977.1|  transaldolase                                           108   1e-25    
ref|WP_005752180.1|  transaldolase                                      112   2e-25    
ref|WP_015698727.1|  transaldolase                                      112   2e-25    
gb|ETJ26793.1|  Transaldolase 1                                         108   2e-25    
ref|WP_031376020.1|  transaldolase                                      112   2e-25    
ref|WP_005718516.1|  transaldolase                                      112   2e-25    
ref|WP_021179249.1|  Transaldolase                                      112   2e-25    
ref|WP_014820051.1|  MULTISPECIES: transaldolase                        112   2e-25    
ref|WP_034078609.1|  transaldolase                                      111   2e-25    
gb|KFF35650.1|  transaldolase                                           111   2e-25    
ref|WP_018715427.1|  hypothetical protein                               112   2e-25    
ref|WP_023480402.1|  transaldolase                                      112   2e-25    
ref|WP_031755740.1|  transaldolase                                      111   2e-25    
ref|WP_039803508.1|  transaldolase                                      111   2e-25    
ref|WP_042713423.1|  transaldolase                                      112   2e-25    
ref|WP_012075288.1|  transaldolase                                      111   2e-25    
gb|KHH45438.1|  transaldolase                                           110   2e-25    
ref|WP_008698808.1|  Transaldolase                                      108   2e-25    
gb|KHI31930.1|  transaldolase                                           110   2e-25    
ref|WP_025120438.1|  MULTISPECIES: transaldolase                        111   2e-25    
ref|WP_039084236.1|  transaldolase                                      111   2e-25    
emb|CDL64152.1|  Transaldolase                                          111   2e-25    
ref|WP_032736645.1|  transaldolase                                      111   2e-25    
ref|WP_027254269.1|  hypothetical protein                               108   2e-25    
ref|WP_004098458.1|  MULTISPECIES: transaldolase                        111   2e-25    
ref|WP_004204228.1|  MULTISPECIES: transaldolase                        111   2e-25    
ref|WP_009149584.1|  transaldolase                                      111   2e-25    
ref|WP_039078279.1|  transaldolase                                      111   2e-25    
ref|WP_024483582.1|  transaldolase                                      111   2e-25    
ref|WP_001556756.1|  transaldolase                                      111   2e-25    
ref|WP_002887897.1|  MULTISPECIES: transaldolase                        111   2e-25    
ref|WP_004177463.1|  transaldolase                                      111   2e-25    
ref|WP_027959479.1|  MULTISPECIES: transaldolase                        111   2e-25    
ref|WP_023312646.1|  transaldolase 1                                    111   2e-25    
ref|WP_004108412.1|  MULTISPECIES: transaldolase                        111   2e-25    
ref|XP_003285987.1|  transaldolase                                      111   2e-25    
ref|WP_028866189.1|  transaldolase                                      111   3e-25    
gb|EGI42733.1|  transaldolase                                           111   3e-25    
ref|WP_039329426.1|  transaldolase                                      111   3e-25    
ref|WP_001299188.1|  transaldolase                                      111   3e-25    
ref|WP_001298493.1|  transaldolase                                      111   3e-25    
gb|KEP72173.1|  transaldolase                                           108   3e-25    
ref|WP_006535243.1|  transaldolase                                      108   3e-25    
ref|WP_033000370.1|  transaldolase                                      111   3e-25    
gb|EGI43377.1|  transaldolase                                           111   3e-25    
gb|EGJ07005.1|  transaldolase                                           111   3e-25    
ref|WP_034897781.1|  transaldolase                                      111   3e-25    
ref|WP_023618640.1|  transaldolase                                      108   3e-25    
ref|WP_031639143.1|  transaldolase                                      111   3e-25    
ref|WP_023414268.1|  transaldolase                                      111   3e-25    
ref|WP_005013191.1|  transaldolase                                      112   3e-25    
ref|WP_024228108.1|  transaldolase                                      111   3e-25    
ref|WP_017800552.1|  transaldolase                                      111   3e-25    
ref|WP_013367675.1|  transaldolase                                      111   3e-25    
ref|XP_004348455.1|  transaldolase                                      111   3e-25    
ref|WP_042421274.1|  transaldolase                                      111   3e-25    
ref|WP_032254716.1|  transaldolase                                      111   3e-25    
ref|WP_032715979.1|  transaldolase                                      111   3e-25    
ref|WP_015670844.1|  transaldolase                                      111   3e-25    
emb|CDG48251.1|  Transaldolase B                                        111   3e-25    
ref|WP_034826122.1|  MULTISPECIES: transaldolase                        111   3e-25    
ref|WP_015368356.1|  transaldolase                                      111   3e-25    
ref|WP_034029805.1|  transaldolase                                      110   3e-25    
ref|WP_032107817.1|  transaldolase                                      110   3e-25    
ref|WP_013507805.1|  MULTISPECIES: transaldolase                        111   3e-25    
ref|WP_024238233.1|  transaldolase                                      111   3e-25    
ref|WP_001660700.1|  transaldolase                                      111   3e-25    
ref|WP_034912157.1|  transaldolase                                      111   3e-25    
ref|WP_004222589.1|  transaldolase                                      111   3e-25    
ref|WP_025856970.1|  transaldolase                                      110   4e-25    
ref|WP_026741649.1|  transaldolase                                      110   4e-25    
ref|XP_005706833.1|  transaldolase                                      111   4e-25    
ref|WP_020236556.1|  transaldolase                                      110   4e-25    
ref|WP_032107809.1|  transaldolase                                      110   4e-25    
dbj|GAM60950.1|  transaldolase                                          110   4e-25    
ref|WP_032224196.1|  transaldolase                                      110   4e-25    
ref|WP_037398545.1|  MULTISPECIES: transaldolase                        110   4e-25    
ref|WP_033882910.1|  transaldolase                                      110   4e-25    
dbj|GAM66792.1|  transaldolase                                          110   4e-25    
ref|WP_000130190.1|  transaldolase                                      110   4e-25    
ref|WP_000130186.1|  MULTISPECIES: transaldolase                        110   4e-25    
ref|WP_042974067.1|  transaldolase                                      110   4e-25    
ref|WP_036139117.1|  transaldolase                                      110   4e-25    
ref|WP_001706759.1|  transaldolase                                      110   4e-25    
ref|WP_026739052.1|  transaldolase                                      110   4e-25    
ref|WP_019614057.1|  transaldolase                                      110   4e-25    
ref|WP_042106862.1|  transaldolase                                      107   4e-25    
ref|WP_034936449.1|  transaldolase                                      110   4e-25    
ref|WP_021508658.1|  transaldolase                                      110   4e-25    
ref|WP_001389213.1|  transaldolase                                      110   4e-25    
ref|WP_001615874.1|  transaldolase                                      110   4e-25    
gb|EGY44547.1|  transaldolase                                           110   4e-25    
ref|WP_000130189.1|  MULTISPECIES: transaldolase                        110   4e-25    
ref|WP_024168791.1|  transaldolase                                      110   4e-25    
ref|WP_037023037.1|  transaldolase                                      110   5e-25    
ref|WP_039030444.1|  transaldolase                                      110   5e-25    
ref|WP_033806418.1|  transaldolase                                      110   5e-25    
ref|WP_032267489.1|  transaldolase                                      110   5e-25    
gb|ESA07026.1|  hypothetical protein GLOINDRAFT_82179                   110   5e-25    
ref|WP_040064162.1|  transaldolase                                      110   5e-25    
ref|WP_000130191.1|  transaldolase                                      110   5e-25    
ref|WP_000130182.1|  transaldolase                                      110   5e-25    
ref|WP_020234673.1|  transaldolase                                      110   5e-25    
ref|WP_032361613.1|  transaldolase                                      110   5e-25    
ref|WP_009111375.1|  transaldolase                                      110   5e-25    
ref|WP_029093022.1|  transaldolase                                      110   5e-25    
ref|WP_044169375.1|  transaldolase                                      110   5e-25    
ref|WP_000130185.1|  MULTISPECIES: transaldolase B                      110   5e-25    
ref|WP_024172002.1|  transaldolase                                      110   5e-25    
ref|WP_039059992.1|  MULTISPECIES: transaldolase                        110   5e-25    
ref|WP_024254690.1|  transaldolase                                      110   5e-25    
ref|WP_024254189.1|  transaldolase                                      110   5e-25    
ref|WP_028684675.1|  transaldolase                                      110   5e-25    
ref|WP_000130187.1|  MULTISPECIES: transaldolase                        110   5e-25    
ref|WP_000130181.1|  transaldolase                                      110   5e-25    
ref|WP_000130188.1|  MULTISPECIES: transaldolase                        110   5e-25    
ref|WP_032229413.1|  transaldolase                                      110   5e-25    
ref|WP_000130183.1|  transaldolase A                                    110   5e-25    
ref|WP_024247111.1|  transaldolase                                      110   5e-25    
ref|WP_023281886.1|  transaldolase B                                    110   5e-25    
dbj|GAL04306.1|  transaldolase                                          110   5e-25    
ref|WP_000130184.1|  MULTISPECIES: transaldolase A                      110   5e-25    
ref|WP_000130192.1|  transaldolase A                                    110   5e-25    
ref|WP_032251001.1|  transaldolase                                      110   5e-25    
ref|WP_024169283.1|  transaldolase                                      110   5e-25    
ref|WP_000130196.1|  transaldolase A                                    110   5e-25    
ref|WP_021530293.1|  transaldolase B                                    110   5e-25    
ref|WP_000130195.1|  transaldolase                                      110   5e-25    
ref|WP_000130193.1|  transaldolase                                      110   5e-25    
gb|EGY38620.1|  transaldolase                                           110   6e-25    
ref|WP_001702734.1|  transaldolase                                      110   6e-25    
ref|WP_032200271.1|  transaldolase                                      110   6e-25    
ref|WP_038252234.1|  transaldolase                                      110   6e-25    
ref|WP_024912044.1|  transaldolase                                      110   6e-25    
ref|WP_006817066.1|  transaldolase                                      110   6e-25    
ref|WP_001540649.1|  transaldolase B                                    110   6e-25    
ref|WP_042388191.1|  transaldolase                                      110   6e-25    
ref|WP_023278179.1|  transaldolase B                                    110   6e-25    
ref|WP_024204588.1|  transaldolase                                      110   6e-25    
ref|WP_042927976.1|  transaldolase                                      110   6e-25    
ref|XP_001330346.1|  Transaldolase A                                    110   6e-25    
gb|EGY33880.1|  transaldolase                                           110   6e-25    
ref|XP_002287454.1|  transaldolase                                      110   6e-25    
ref|WP_001582253.1|  transaldolase                                      110   6e-25    
pdb|3KOF|A  Chain A, Crystal Structure Of The Double Mutant F178y...    110   6e-25    
pdb|3CWN|A  Chain A, Escherichia Coli Transaldolase B Mutant F178y      110   6e-25    
ref|WP_008568015.1|  transaldolase                                      110   6e-25    
gb|AFI87193.1|  transaldolase                                           110   6e-25    
ref|WP_001719461.1|  transaldolase                                      110   7e-25    
ref|WP_013200700.1|  transaldolase                                      110   7e-25    
ref|WP_016975287.1|  MULTISPECIES: transaldolase                        110   7e-25    
ref|WP_024205658.1|  transaldolase                                      110   7e-25    
ref|WP_035896212.1|  transaldolase                                      110   7e-25    
ref|WP_044181978.1|  transaldolase                                      110   7e-25    
ref|WP_043310651.1|  transaldolase                                      110   7e-25    
ref|WP_003162382.1|  Transaldolase                                      110   7e-25    
ref|XP_004341291.1|  transaldolase                                      110   7e-25    
ref|WP_010587486.1|  transaldolase                                      110   7e-25    
ref|WP_004237118.1|  MULTISPECIES: transaldolase                        110   7e-25    
ref|WP_043296231.1|  transaldolase                                      110   7e-25    
ref|WP_003292152.1|  transaldolase B                                    110   7e-25    
ref|WP_032237969.1|  transaldolase                                      110   7e-25    
ref|WP_001640218.1|  transaldolase                                      110   7e-25    
ref|WP_040152004.1|  transaldolase                                      110   7e-25    
ref|WP_006977443.1|  transaldolase                                      110   8e-25    
ref|WP_028237996.1|  transaldolase                                      110   8e-25    
ref|WP_006644397.1|  transaldolase                                      110   8e-25    
ref|WP_036812284.1|  transaldolase                                      110   8e-25    
ref|WP_043220393.1|  transaldolase                                      109   8e-25    
gb|KDQ51544.1|  hypothetical protein JAAARDRAFT_184912                  110   8e-25    
ref|WP_016504473.1|  transaldolase B                                    105   9e-25    
ref|WP_017444996.1|  transaldolase                                      110   9e-25    
ref|WP_028110405.1|  transaldolase                                      110   9e-25    
ref|WP_007225297.1|  transaldolase                                      110   9e-25    
ref|WP_000130194.1|  transaldolase A                                    110   9e-25    
ref|WP_041104765.1|  transaldolase                                      109   9e-25    
ref|WP_036777088.1|  transaldolase                                      110   9e-25    
emb|CCK10540.1|  Transaldolase                                          110   9e-25    
ref|WP_002434294.1|  MULTISPECIES: transaldolase                        109   9e-25    
ref|WP_033902559.1|  transaldolase                                      109   9e-25    
ref|WP_038628396.1|  transaldolase                                      109   1e-24    
ref|WP_044404194.1|  transaldolase                                      109   1e-24    



>emb|CDP09917.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   347 bits (890),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q+ KLKFA QS KP L F     F +IRAS GFSSSLDTGL+TELDAVT+YSEIVPDTV+
Sbjct  22   QDNKLKFAVQSVKPPLIFKPSRSFSLIRASTGFSSSLDTGLSTELDAVTSYSEIVPDTVI  81

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSL+LGICSLPDTKF+SAVDTALAD ECYGLE+ D RMSCFFNKA
Sbjct  82   FDDFERFPPTAATVSSSLILGICSLPDTKFRSAVDTALADSECYGLENSDLRMSCFFNKA  141

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVN+G DLAKLVPGRVSTEVDARLAYDTHGIV KVH+LLKLY+  ++PPERLLFKIP+TW
Sbjct  142  LVNIGSDLAKLVPGRVSTEVDARLAYDTHGIVRKVHELLKLYDDFQVPPERLLFKIPSTW  201

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEAS LLE+ GIQTHLTFVY
Sbjct  202  QGIEASSLLESEGIQTHLTFVY  223



>ref|XP_009626614.1| PREDICTED: probable transaldolase [Nicotiana tomentosiformis]
Length=397

 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            QE+KL+ A   +K +L+F  +  FP+IRAS GFSSSLDTGL+TELDAVT++SEIVPDTV+
Sbjct  20   QEKKLRNAVNLSKSTLTFKPRRYFPLIRASTGFSSSLDTGLSTELDAVTSHSEIVPDTVI  79

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFEKFPPTAATVSSSLLLGIC LPDTKFKSAVD ALAD ECYGLE+ D +MSCFFNKA
Sbjct  80   FDDFEKFPPTAATVSSSLLLGICGLPDTKFKSAVDRALADSECYGLENSDLQMSCFFNKA  139

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            L +VGGDLAKLVPGRVSTEVDARLAYDTHGIV KVHDLLK YN IE+PPERLLFKIPATW
Sbjct  140  LAHVGGDLAKLVPGRVSTEVDARLAYDTHGIVRKVHDLLKAYNEIEVPPERLLFKIPATW  199

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASR+LEA GIQTHLTFVY
Sbjct  200  QGIEASRVLEAEGIQTHLTFVY  221



>ref|XP_011081206.1| PREDICTED: probable transaldolase [Sesamum indicum]
Length=397

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            QE+KL+   QS KP L       FP IRA+  FSSSLDTGL+TELDAVT+YSEIVPDTVV
Sbjct  20   QEKKLRIPIQSAKPGLILKPLRSFPSIRAATDFSSSLDTGLSTELDAVTSYSEIVPDTVV  79

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSL+LGICSLPDTKF+SAVDTALAD +CYGLE+ D RMSCF NKA
Sbjct  80   FDDFERFPPTAATVSSSLILGICSLPDTKFRSAVDTALADTQCYGLENSDDRMSCFVNKA  139

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVN+GGDLAKLVPGRVSTEVDARLAYDTH IV KVHDLLKLY GI++PPERLLFKIP+TW
Sbjct  140  LVNIGGDLAKLVPGRVSTEVDARLAYDTHAIVEKVHDLLKLYRGIDVPPERLLFKIPSTW  199

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTH+TFVY
Sbjct  200  QGIEASRLLESEGIQTHMTFVY  221



>ref|XP_009788658.1| PREDICTED: probable transaldolase [Nicotiana sylvestris]
Length=397

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            QE+KL+ A    K +L+F  +   P+IRAS GFSSSLDTGL+TELDAVT++SEIVPDTV+
Sbjct  20   QEKKLRNAVNLAKSTLTFKPRRYIPLIRASTGFSSSLDTGLSTELDAVTSHSEIVPDTVI  79

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFEKFPPTAATVSSSLLLGIC LPDTKFKSAVD ALAD ECYGLE+ D +MSCFFNKA
Sbjct  80   FDDFEKFPPTAATVSSSLLLGICGLPDTKFKSAVDRALADSECYGLENSDLQMSCFFNKA  139

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            L +VGGDLAKLVPGRVSTEVDARLAYDTHGIV KVHDLLK YN IE+PPERLLFKIPATW
Sbjct  140  LAHVGGDLAKLVPGRVSTEVDARLAYDTHGIVRKVHDLLKAYNEIEVPPERLLFKIPATW  199

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASR+LEA GIQTHLTFVY
Sbjct  200  QGIEASRVLEAEGIQTHLTFVY  221



>ref|NP_001234076.1| transaldolase ToTAL2 [Solanum lycopersicum]
 gb|AAG34725.1| transaldolase ToTAL2 [Solanum lycopersicum]
Length=397

 Score =   341 bits (874),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q+RKL+ A    KP+L F  +  FP+IRASAGFSSSLDTGL+TELDAV N+SEIVPDTV+
Sbjct  20   QDRKLRNAVNFAKPNLIFKPRRSFPLIRASAGFSSSLDTGLSTELDAVANHSEIVPDTVI  79

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFEKFPPTA T SSSLLLGIC LPDTKFKSAVD AL+D ECYGLE  D +MSCFFNKA
Sbjct  80   FDDFEKFPPTAGTASSSLLLGICGLPDTKFKSAVDRALSDSECYGLESSDLQMSCFFNKA  139

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            L +VGGDLAKLVPGRVSTEVDARLAYDTHGIV KVHDLLK Y  IE+PPERLLFKIPATW
Sbjct  140  LAHVGGDLAKLVPGRVSTEVDARLAYDTHGIVRKVHDLLKAYTEIEVPPERLLFKIPATW  199

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASR+LEA GIQTHLTFVY
Sbjct  200  QGIEASRVLEAEGIQTHLTFVY  221



>ref|XP_006355489.1| PREDICTED: probable transaldolase-like [Solanum tuberosum]
Length=397

 Score =   338 bits (868),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q+RKL  A    KP+L F  +  FP+IRASAGFSSSLDTGL+TELDAV ++SEIVPDTV+
Sbjct  20   QDRKLINAVNFAKPNLIFKPRRSFPLIRASAGFSSSLDTGLSTELDAVASHSEIVPDTVI  79

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFEKFPPTA TVSSSLLLGIC LPDTKFKSAVD AL+D ECYGLE  D +MSCFFNKA
Sbjct  80   FDDFEKFPPTAGTVSSSLLLGICGLPDTKFKSAVDRALSDSECYGLESSDLQMSCFFNKA  139

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            L +VGGDLAKLVPGRVSTEVDARLAYDTHGIV KVHDLLK Y  IE+PPERLLFKIPATW
Sbjct  140  LAHVGGDLAKLVPGRVSTEVDARLAYDTHGIVRKVHDLLKAYTEIEVPPERLLFKIPATW  199

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASR+LEA GIQTHLTFVY
Sbjct  200  QGIEASRVLEAEGIQTHLTFVY  221



>ref|XP_002266734.2| PREDICTED: probable transaldolase [Vitis vinifera]
 emb|CBI25778.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q+ +L+F A+S  P  + + +  FP IRASA FSSSLD GL+TE DAV++ SEIVPDTV+
Sbjct  19   QKGRLRFLARSATPRFALSFQRSFPQIRASANFSSSLDKGLSTEFDAVSDLSEIVPDTVI  78

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGICSLPDT F+SAV+TALAD  CYGLE  DARMSCFFNKA
Sbjct  79   FDDFERFPPTAATVSSSLLLGICSLPDTIFRSAVETALADSVCYGLESPDARMSCFFNKA  138

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LV VG DL KLVPGRVSTEVDARLAYDTHGI+ KVHDLL LYN I++PPERLLFKIP+TW
Sbjct  139  LVKVGSDLVKLVPGRVSTEVDARLAYDTHGIIRKVHDLLTLYNEIDVPPERLLFKIPSTW  198

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  199  QGIEASRLLESEGIQTHLTFVY  220



>ref|XP_003631434.1| PREDICTED: probable transaldolase isoform X2 [Vitis vinifera]
 emb|CBI31886.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q+ +L+F A+S  P  + + +  FP IRASA FSSSLD GL+TE DAV++ SEIVPDTV+
Sbjct  19   QDGRLRFLARSAAPRFALSFQRSFPQIRASANFSSSLDKGLSTEFDAVSDLSEIVPDTVI  78

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGICSLPDT F+SAV+TALAD  CYGLE  DARMSCFFNKA
Sbjct  79   FDDFERFPPTAATVSSSLLLGICSLPDTIFRSAVETALADSVCYGLESPDARMSCFFNKA  138

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LV VG DL KLVPGRVSTEVDARLAYDTHGI+ KVHDLL LYN I++P ERLLFKIP+TW
Sbjct  139  LVKVGSDLVKLVPGRVSTEVDARLAYDTHGIIRKVHDLLTLYNEIDVPLERLLFKIPSTW  198

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  199  QGIEASRLLESEGIQTHLTFVY  220



>gb|EYU30507.1| hypothetical protein MIMGU_mgv1a007833mg [Erythranthe guttata]
Length=394

 Score =   318 bits (814),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = +3

Query  126  STKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPT  305
            S KPS  F  +  F +I A+  FSSSLDTG +TELD VT YSEIVPDTVVFDDFE+FPPT
Sbjct  27   SAKPSPVFKHQRFFSLISAATNFSSSLDTGFSTELDVVTGYSEIVPDTVVFDDFERFPPT  86

Query  306  AATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAK  485
            AATVSSSLLLGICSLPDTKF+SA+DTALA  ECY LE  D RM+CFFNKALVNVGGDLA+
Sbjct  87   AATVSSSLLLGICSLPDTKFRSAIDTALAGSECYNLEQSDDRMTCFFNKALVNVGGDLAR  146

Query  486  LVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE  665
            LVPGRVSTEVDARLAYDT GIV +VH+LLKLY+ IE+PP+RLLFKIP+TWQGIEASRLLE
Sbjct  147  LVPGRVSTEVDARLAYDTQGIVRRVHELLKLYHDIEVPPQRLLFKIPSTWQGIEASRLLE  206

Query  666  AXGIQTHLTFVY  701
            + GIQTH+TFVY
Sbjct  207  SEGIQTHMTFVY  218



>ref|XP_003631436.1| PREDICTED: probable transaldolase isoform X1 [Vitis vinifera]
Length=414

 Score =   311 bits (796),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 174/220 (79%), Gaps = 18/220 (8%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q+ +L+F A+S  P  + + +  FP IRASA FSSSLD GL+TE DAV++ SEIVPDTV+
Sbjct  19   QDGRLRFLARSAAPRFALSFQRSFPQIRASANFSSSLDKGLSTEFDAVSDLSEIVPDTVI  78

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGICSLPDT F+SAV+TALAD  CYGLE  DARMSCFFNKA
Sbjct  79   FDDFERFPPTAATVSSSLLLGICSLPDTIFRSAVETALADSVCYGLESPDARMSCFFNKA  138

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLK------------------VHDLLKLY  581
            LV VG DL KLVPGRVSTEVDARLAYDTHGI+ K                  VHDLL LY
Sbjct  139  LVKVGSDLVKLVPGRVSTEVDARLAYDTHGIIRKFPKFGSLLVMNYPKNFGLVHDLLTLY  198

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N I++P ERLLFKIP+TWQGIEASRLLE+ GIQTHLTFVY
Sbjct  199  NEIDVPLERLLFKIPSTWQGIEASRLLESEGIQTHLTFVY  238



>ref|XP_008238614.1| PREDICTED: probable transaldolase [Prunus mume]
Length=389

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 171/202 (85%), Gaps = 5/202 (2%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q  +L+F+  S   +L FN +  FPVIRASA     LDTG TTELD V+++SEIVPDTV+
Sbjct  17   QGTRLRFSNGSPASNLLFNFQRSFPVIRASA-----LDTGSTTELDLVSSFSEIVPDTVI  71

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGICSLPDT F++AVD ALAD EC   E+ + R+SCF NKA
Sbjct  72   FDDFERFPPTAATVSSSLLLGICSLPDTIFRNAVDMALADSECNKHENSELRLSCFSNKA  131

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVGGDLAKLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLYN + +PPERLLFKIP+TW
Sbjct  132  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYNEVNVPPERLLFKIPSTW  191

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  192  QGIEASRLLESEGIQTHLTFVY  213



>ref|XP_010053436.1| PREDICTED: probable transaldolase [Eucalyptus grandis]
 gb|KCW77733.1| hypothetical protein EUGRSUZ_D02030 [Eucalyptus grandis]
Length=407

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 176/205 (86%), Gaps = 6/205 (3%)
 Frame = +3

Query  105  KLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSS------LDTGLTTELDAVTNYSEIVPD  266
            KL+  A+S  P L+F S+P  P IRAS+  SSS      LDTGL+TELDAV+++SEIVPD
Sbjct  27   KLRLLARSASPKLAFRSRPPLPRIRASSSSSSSSSSSSSLDTGLSTELDAVSSFSEIVPD  86

Query  267  TVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFF  446
            TV+FDDFEKFPPTAATVSSSLLLGICSLPDT F++AV+ ALAD+ CYGL + + R+SCF 
Sbjct  87   TVIFDDFEKFPPTAATVSSSLLLGICSLPDTIFRNAVEMALADRGCYGLANNEMRLSCFV  146

Query  447  NKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIP  626
            NKALVNVG DLAKLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLY  +++PPERLLFKIP
Sbjct  147  NKALVNVGSDLAKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYGEVDVPPERLLFKIP  206

Query  627  ATWQGIEASRLLEAXGIQTHLTFVY  701
            +TWQGIEASRLLE+ GIQTHLTFVY
Sbjct  207  STWQGIEASRLLESEGIQTHLTFVY  231



>ref|XP_010259018.1| PREDICTED: probable transaldolase [Nelumbo nucifera]
Length=396

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            QE    F  +S+  +  F     +P +RAS+  +SS++TGL+TELDAV+++SEIVPDTV+
Sbjct  19   QEGNCSFPIRSSTANFIFKLHRTYPQLRASSSNASSIETGLSTELDAVSSFSEIVPDTVI  78

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFEKFPPTAAT SSSLLLGICSLPDT F+SAV+TALAD ECYG +D   RMSCF NKA
Sbjct  79   FDDFEKFPPTAATASSSLLLGICSLPDTIFRSAVETALADSECYGQKDPGVRMSCFLNKA  138

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVGGDL+KLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLYN + + PERLLFKIP+TW
Sbjct  139  LVNVGGDLSKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYNELGVSPERLLFKIPSTW  198

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASR+LE+ GIQTHLTFVY
Sbjct  199  QGIEASRVLESEGIQTHLTFVY  220



>ref|XP_009343901.1| PREDICTED: probable transaldolase [Pyrus x bretschneideri]
 ref|XP_009343904.1| PREDICTED: probable transaldolase [Pyrus x bretschneideri]
Length=390

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 5/202 (2%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q  +L+F+  S   +L F  +  FP+IRASA     LDTG  TEL+ V++YSEIVPDTV+
Sbjct  18   QGTRLRFSNGSPPSNLHFTLQRSFPLIRASA-----LDTGSITELEGVSSYSEIVPDTVI  72

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGICSLPDT F++AVD ALAD EC   E+ + R+SCFFNKA
Sbjct  73   FDDFERFPPTAATVSSSLLLGICSLPDTIFRNAVDMALADSECNLHENSNVRLSCFFNKA  132

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVGGDLAKLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLYN + +PPERLLFKIP+TW
Sbjct  133  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYNQVNVPPERLLFKIPSTW  192

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  193  QGIEASRLLESEGIQTHLTFVY  214



>ref|XP_006440370.1| hypothetical protein CICLE_v10020501mg [Citrus clementina]
 gb|ESR53610.1| hypothetical protein CICLE_v10020501mg [Citrus clementina]
Length=394

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  126  STKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPT  305
            ST   + FN +  FP IRAS+  SSSLD GL+TELDAV+++SEIVPDTVVFDDFE+FPPT
Sbjct  27   STASDVHFNFRSSFPHIRASSSSSSSLDAGLSTELDAVSSFSEIVPDTVVFDDFERFPPT  86

Query  306  AATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAK  485
            AATVSSSLLLGICSLPDT F++AVD ALAD  C  LE+ + R+SCFFNKALVNVGGDLAK
Sbjct  87   AATVSSSLLLGICSLPDTIFRNAVDMALADSSCCELENSELRLSCFFNKALVNVGGDLAK  146

Query  486  LVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE  665
            +VPGRVSTEVDARLAYDTHGI+ KVHDLLKLY+ I++PPERLLFKIP+TWQGIEASRLLE
Sbjct  147  MVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYSEIDVPPERLLFKIPSTWQGIEASRLLE  206

Query  666  AXGIQTHLTFVY  701
            + GIQTHLTFVY
Sbjct  207  SEGIQTHLTFVY  218



>gb|KDO48369.1| hypothetical protein CISIN_1g016178mg [Citrus sinensis]
Length=394

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  126  STKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPT  305
            ST   + FN +  FP IRAS+  SSSLD GL+TELDAV+++SEIVPDTVVFDDFE+FPPT
Sbjct  27   STASDVHFNFRSSFPHIRASSSSSSSLDAGLSTELDAVSSFSEIVPDTVVFDDFERFPPT  86

Query  306  AATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAK  485
            AATVSSSLLLGICSLPDT F++AVD ALAD  C  LE+ + R+SCFFNKALVNVGGDLAK
Sbjct  87   AATVSSSLLLGICSLPDTIFRNAVDMALADSSCCELENSELRLSCFFNKALVNVGGDLAK  146

Query  486  LVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE  665
            +VPGRVSTEVDARLAYDTHGI+ KVHDLLKLY+ I++PPERLLFKIP+TWQGIEASRLLE
Sbjct  147  MVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYSEIDVPPERLLFKIPSTWQGIEASRLLE  206

Query  666  AXGIQTHLTFVY  701
            + GIQTHLTFVY
Sbjct  207  SEGIQTHLTFVY  218



>ref|XP_007209231.1| hypothetical protein PRUPE_ppa006960mg [Prunus persica]
 gb|EMJ10430.1| hypothetical protein PRUPE_ppa006960mg [Prunus persica]
Length=389

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 170/202 (84%), Gaps = 5/202 (2%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q  +L+F+  S   +L FN +  FPVIRASA     LDTG TTELD V+++SEIVPDTV+
Sbjct  17   QGTRLRFSNGSPASNLLFNFQRSFPVIRASA-----LDTGSTTELDLVSSFSEIVPDTVI  71

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGICSLPDT F++AVD ALAD EC   E+ + R+SCF NKA
Sbjct  72   FDDFERFPPTAATVSSSLLLGICSLPDTIFRNAVDMALADSECNKHENSELRLSCFSNKA  131

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVGG LAKLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLYN + +PPERLLFKIP+TW
Sbjct  132  LVNVGGYLAKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYNEVNVPPERLLFKIPSTW  191

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  192  QGIEASRLLESEGIQTHLTFVY  213



>gb|KDO48370.1| hypothetical protein CISIN_1g016178mg [Citrus sinensis]
Length=374

 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  126  STKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPT  305
            ST   + FN +  FP IRAS+  SSSLD GL+TELDAV+++SEIVPDTVVFDDFE+FPPT
Sbjct  27   STASDVHFNFRSSFPHIRASSSSSSSLDAGLSTELDAVSSFSEIVPDTVVFDDFERFPPT  86

Query  306  AATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAK  485
            AATVSSSLLLGICSLPDT F++AVD ALAD  C  LE+ + R+SCFFNKALVNVGGDLAK
Sbjct  87   AATVSSSLLLGICSLPDTIFRNAVDMALADSSCCELENSELRLSCFFNKALVNVGGDLAK  146

Query  486  LVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE  665
            +VPGRVSTEVDARLAYDTHGI+ KVHDLLKLY+ I++PPERLLFKIP+TWQGIEASRLLE
Sbjct  147  MVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYSEIDVPPERLLFKIPSTWQGIEASRLLE  206

Query  666  AXGIQTHLTFVY  701
            + GIQTHLTFVY
Sbjct  207  SEGIQTHLTFVY  218



>ref|XP_008437125.1| PREDICTED: probable transaldolase [Cucumis melo]
Length=405

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 176/202 (87%), Gaps = 1/202 (0%)
 Frame = +3

Query  99   ERKLKFAAQSTKPSLSFNSKP-CFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            +RKL F+A    PS+  +  P   P+  AS+GFSSSLDTGLT+ELDAV+++S+IVPDTVV
Sbjct  28   QRKLGFSAGLFTPSILISHSPTSLPLTSASSGFSSSLDTGLTSELDAVSSFSQIVPDTVV  87

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGIC LPDT F++AVD ALAD +C+GL++ + + SC FNKA
Sbjct  88   FDDFERFPPTAATVSSSLLLGICGLPDTIFRNAVDMALADSQCFGLDNPELKYSCIFNKA  147

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVGGDLAKLVPGRVSTEVDAR+AYDTHGI+ KVHDLLKLYN I +PPERLLFKIPATW
Sbjct  148  LVNVGGDLAKLVPGRVSTEVDARVAYDTHGIIRKVHDLLKLYNEINVPPERLLFKIPATW  207

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  208  QGIEASRLLESEGIQTHLTFVY  229



>ref|XP_006477245.1| PREDICTED: probable transaldolase-like [Citrus sinensis]
Length=398

 Score =   300 bits (768),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 170/196 (87%), Gaps = 4/196 (2%)
 Frame = +3

Query  126  STKPSLSFNSKPCFPVIRASAGFSSS----LDTGLTTELDAVTNYSEIVPDTVVFDDFEK  293
            ST   + FN +  FP IRAS+  SSS    LD GL+TELDAV+++SEIVPDTVVFDDFE+
Sbjct  27   STASDVHFNFRSSFPHIRASSSSSSSSSSSLDAGLSTELDAVSSFSEIVPDTVVFDDFER  86

Query  294  FPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGG  473
            FPPTAATVSSSLLLGICSLPDT F++AVD ALAD  C  LE+ + R+SCFFNKALVNVGG
Sbjct  87   FPPTAATVSSSLLLGICSLPDTIFRNAVDMALADSSCCKLENSELRLSCFFNKALVNVGG  146

Query  474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS  653
            DLAK+VPGRVSTEVDARLAYDTHGI+ KVHDLLKLY+ I++PPERLLFKIP+TWQGIEAS
Sbjct  147  DLAKMVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYSEIDVPPERLLFKIPSTWQGIEAS  206

Query  654  RLLEAXGIQTHLTFVY  701
            RLLE+ GIQTHLTFVY
Sbjct  207  RLLESEGIQTHLTFVY  222



>ref|XP_004298660.1| PREDICTED: probable transaldolase [Fragaria vesca subsp. vesca]
Length=389

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 170/202 (84%), Gaps = 8/202 (4%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q RKL     S   +L F S+P  P++RASA     LDTG  TELDAV+++SEIVPDTV+
Sbjct  20   QGRKLSLFNGS---NLLFTSRPSLPLLRASA-----LDTGSATELDAVSSFSEIVPDTVI  71

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSS+LLLGICSLPDT F++AVD ALAD EC   E+ + ++SCFFNKA
Sbjct  72   FDDFERFPPTAATVSSALLLGICSLPDTIFRNAVDMALADSECNKHENSELKLSCFFNKA  131

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVG DLAKLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLY+ +++PPERLLFKIP+TW
Sbjct  132  LVNVGADLAKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYDRVDVPPERLLFKIPSTW  191

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  192  QGIEASRLLESEGIQTHLTFVY  213



>ref|XP_004147589.1| PREDICTED: transaldolase-like [Cucumis sativus]
 ref|XP_004167919.1| PREDICTED: transaldolase-like [Cucumis sativus]
Length=405

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 175/202 (87%), Gaps = 1/202 (0%)
 Frame = +3

Query  99   ERKLKFAAQSTKPSLSFNSKP-CFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            ++KL F+A    PS+  +  P   P+  AS+GFSSSLDTGLT+ELDAV+++S+IVPDTVV
Sbjct  28   QKKLGFSAGLFTPSILISHSPTSLPLTSASSGFSSSLDTGLTSELDAVSSFSQIVPDTVV  87

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGIC LPDT F++AVD ALAD EC+GL++   + SC FNKA
Sbjct  88   FDDFERFPPTAATVSSSLLLGICGLPDTIFRNAVDMALADSECFGLDNPQLKYSCIFNKA  147

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVGGDLAKLVPGRVSTEVDAR+AYDTHGI+ KVHDLLKLYN I +PPERLLFKIPATW
Sbjct  148  LVNVGGDLAKLVPGRVSTEVDARVAYDTHGIIKKVHDLLKLYNEINVPPERLLFKIPATW  207

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  208  QGIEASRLLESEGIQTHLTFVY  229



>gb|KGN50221.1| hypothetical protein Csa_5G160240 [Cucumis sativus]
Length=405

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = +3

Query  99   ERKLKFAAQSTKPSLSFNSKP-CFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            ++KL F+A    P +  +  P   P+  AS+GFSSSLDTGLT+ELDAV+++S+IVPDTVV
Sbjct  28   QKKLGFSAGLFTPYILISHSPTSLPLTSASSGFSSSLDTGLTSELDAVSSFSQIVPDTVV  87

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGIC LPDT F++AVD ALAD EC+GL++   + SC FNKA
Sbjct  88   FDDFERFPPTAATVSSSLLLGICGLPDTIFRNAVDMALADSECFGLDNPQLKYSCIFNKA  147

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            LVNVGGDLAKLVPGRVSTEVDAR+AYDTHGI+ KVHDLLKLYN I +PPERLLFKIPATW
Sbjct  148  LVNVGGDLAKLVPGRVSTEVDARVAYDTHGIIKKVHDLLKLYNEINVPPERLLFKIPATW  207

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEASRLLE+ GIQTHLTFVY
Sbjct  208  QGIEASRLLESEGIQTHLTFVY  229



>gb|KJB37607.1| hypothetical protein B456_006G212700 [Gossypium raimondii]
Length=395

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  105  KLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDD  284
            +L FA   +  SL F     FP IRAS+GFSSSLDTGL TELDAV+ +SEIVPDTV+FDD
Sbjct  21   RLGFANGCSSSSLLFKFNASFPAIRASSGFSSSLDTGLRTELDAVSTFSEIVPDTVIFDD  80

Query  285  FEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVN  464
            FEKFPPTAATVSSSLLLGI SLPDT F++AVD ALAD  C  L++ + R+SCFFNKALVN
Sbjct  81   FEKFPPTAATVSSSLLLGILSLPDTVFRNAVDMALADSTCSRLDNPELRLSCFFNKALVN  140

Query  465  VGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGI  644
            VGGDLAKLVPGRVSTEVDAR AYDTHGI+ +VHDLLKLYN I++PPERLLFKIP+TWQGI
Sbjct  141  VGGDLAKLVPGRVSTEVDARRAYDTHGIIRRVHDLLKLYNEIDVPPERLLFKIPSTWQGI  200

Query  645  EASRLLEAXGIQTHLTFVY  701
            EASRLLE+ GIQTHLTFVY
Sbjct  201  EASRLLESEGIQTHLTFVY  219



>gb|AFK49390.1| unknown [Lotus japonicus]
Length=394

 Score =   295 bits (755),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAAT  314
            P+L F S+  FP+IRAS   SSS++T   TELDAV+ +SEIVP+TV+FDDF+KFPPTAAT
Sbjct  33   PTLPFKSQRSFPLIRAS---SSSINTASITELDAVSAFSEIVPNTVIFDDFQKFPPTAAT  89

Query  315  VSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVP  494
            VSSSLLLGIC LPDT F++AVD ALAD EC GL++ +AR+SCF NKALVNVG DLAKLVP
Sbjct  90   VSSSLLLGICGLPDTVFRNAVDMALADSECNGLQNPEARLSCFVNKALVNVGTDLAKLVP  149

Query  495  GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXG  674
            GRVSTEVDARLAYDTH I+ KVHDLLKLYN   +PP+RLLFKIP+TWQGIEA+RLLE+ G
Sbjct  150  GRVSTEVDARLAYDTHDIIRKVHDLLKLYNDNNVPPQRLLFKIPSTWQGIEAARLLESEG  209

Query  675  IQTHLTFVY  701
            IQTHLTFVY
Sbjct  210  IQTHLTFVY  218



>ref|XP_011018260.1| PREDICTED: probable transaldolase [Populus euphratica]
Length=401

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 158/182 (87%), Gaps = 5/182 (3%)
 Frame = +3

Query  156  KPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLL  335
             P FP IRAS     SLD G +TELDAV++ SEIVPDTVVFDDF+KFPPTAATVSSSLLL
Sbjct  49   NPSFPQIRAS-----SLDAGASTELDAVSSLSEIVPDTVVFDDFQKFPPTAATVSSSLLL  103

Query  336  GICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEV  515
            GICSLPDT F+SAVDTALAD  C  LE+   R+SCF NKALVNVGGDL+KLVPGRVSTEV
Sbjct  104  GICSLPDTIFRSAVDTALADSGCSSLENDVLRLSCFANKALVNVGGDLSKLVPGRVSTEV  163

Query  516  DARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTF  695
            DARLAYDTHGI+ KVHDLLK Y+ I++PPERLLFKIPATWQGIEASRLLE+ GIQTHLTF
Sbjct  164  DARLAYDTHGIIRKVHDLLKSYSEIDVPPERLLFKIPATWQGIEASRLLESEGIQTHLTF  223

Query  696  VY  701
            VY
Sbjct  224  VY  225



>gb|AAQ17460.1| transaldolase [Gossypium hirsutum]
Length=396

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  105  KLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDD  284
            +L FA      SL F     FP IRAS+GFSSSLDTGL TELDAV+ +SEIVPDTV+FDD
Sbjct  21   RLGFANGCPSSSLLFKFNASFPAIRASSGFSSSLDTGLRTELDAVSTFSEIVPDTVIFDD  80

Query  285  FEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVN  464
            FEKFPPTAATVSSSLLLGI SLPDT F++AVD ALAD  C  L++ + R++CFFNKALVN
Sbjct  81   FEKFPPTAATVSSSLLLGILSLPDTIFRNAVDLALADSTCSRLDNPELRLACFFNKALVN  140

Query  465  VGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGI  644
            VGGDLAKLVPGRVSTEVDARLAYDTHGI+ +VHDLLKLYN I++PPERLLFKIP TWQGI
Sbjct  141  VGGDLAKLVPGRVSTEVDARLAYDTHGIIRRVHDLLKLYNEIDVPPERLLFKIPXTWQGI  200

Query  645  EASRLLEAXGIQTHLTFVY  701
            EASRLLE+ GIQTHLTFVY
Sbjct  201  EASRLLESEGIQTHLTFVY  219



>ref|XP_006368174.1| hypothetical protein POPTR_0001s00260g [Populus trichocarpa]
 gb|ERP64743.1| hypothetical protein POPTR_0001s00260g [Populus trichocarpa]
Length=399

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 157/182 (86%), Gaps = 5/182 (3%)
 Frame = +3

Query  156  KPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLL  335
             P FP IRAS     SLD G +TELDAV++ SEIVPDTVVFDDF+KFPPTAATVSSSLLL
Sbjct  47   NPSFPQIRAS-----SLDAGASTELDAVSSLSEIVPDTVVFDDFQKFPPTAATVSSSLLL  101

Query  336  GICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEV  515
            GICSLPDT F+SAVDTALAD  C  LE+   R+SCF NKALVNVGGDL+KLVPGRVSTEV
Sbjct  102  GICSLPDTIFRSAVDTALADSGCSSLENDVLRLSCFANKALVNVGGDLSKLVPGRVSTEV  161

Query  516  DARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTF  695
            DARLAYDTHGI+ KVHDLLK Y  I++PPERLLFKIPATWQGIEASRLLE+ GIQTHLTF
Sbjct  162  DARLAYDTHGIIRKVHDLLKSYGEIDVPPERLLFKIPATWQGIEASRLLESEGIQTHLTF  221

Query  696  VY  701
            VY
Sbjct  222  VY  223



>ref|XP_003525805.1| PREDICTED: transaldolase-like [Glycine max]
 gb|KHN04339.1| Transaldolase [Glycine soja]
Length=398

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 160/188 (85%), Gaps = 3/188 (2%)
 Frame = +3

Query  138  SLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATV  317
            +L FN     P+IRAS   +SS++   TTELDAV+ +SEIVPDTVVFDDFEKFPPTAATV
Sbjct  38   TLHFNPHRSLPLIRAS---NSSINAASTTELDAVSAFSEIVPDTVVFDDFEKFPPTAATV  94

Query  318  SSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPG  497
            SSSLLLGIC LPDT F++AV+ ALAD ECYGLE+ +AR+SCF NKA  N+G D+AKLVPG
Sbjct  95   SSSLLLGICGLPDTIFRNAVEMALADSECYGLENPNARLSCFVNKAFANIGSDMAKLVPG  154

Query  498  RVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGI  677
            RVSTEVDARLAYDTH I+ KVHDLLKLYN   +PP+RLLFKIP+TWQGIEA+RLLE+ GI
Sbjct  155  RVSTEVDARLAYDTHAIIRKVHDLLKLYNDSNVPPQRLLFKIPSTWQGIEAARLLESEGI  214

Query  678  QTHLTFVY  701
            QTHLTFVY
Sbjct  215  QTHLTFVY  222



>gb|ACU24347.1| unknown [Glycine max]
Length=398

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 159/188 (85%), Gaps = 3/188 (2%)
 Frame = +3

Query  138  SLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATV  317
            +L FN     P+IRAS   +SS++   TTELDAV+ +SEIVPDTVVFDDFEKFPPTAATV
Sbjct  38   TLHFNPHRSLPLIRAS---NSSINAASTTELDAVSAFSEIVPDTVVFDDFEKFPPTAATV  94

Query  318  SSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPG  497
            SSSLLLGIC LPDT F++AV+ ALAD ECYGLE+ +AR+SCF NKA  N+G D+AKLVPG
Sbjct  95   SSSLLLGICGLPDTIFRNAVEMALADSECYGLENPNARLSCFVNKAFANIGSDMAKLVPG  154

Query  498  RVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGI  677
            RVSTEVDARLAYDTH I+ KVH LLKLYN   +PP+RLLFKIP+TWQGIEA+RLLE+ GI
Sbjct  155  RVSTEVDARLAYDTHAIIRKVHGLLKLYNDSNVPPQRLLFKIPSTWQGIEAARLLESEGI  214

Query  678  QTHLTFVY  701
            QTHLTFVY
Sbjct  215  QTHLTFVY  222



>gb|KEH31659.1| transaldolase total2 protein [Medicago truncatula]
Length=353

 Score =   288 bits (738),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 160/189 (85%), Gaps = 6/189 (3%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAAT  314
            P+L FNSK  F +IRAS     S DT + TELDAV+ +SEIVPDTV+FDDF+KFPPTAAT
Sbjct  42   PTLLFNSKNSFSLIRAS-----STDT-VITELDAVSAFSEIVPDTVIFDDFQKFPPTAAT  95

Query  315  VSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVP  494
            VSSSL+LGIC LPDT F+ AV+ ALAD ECYGL+D +AR+SCF  KALVNVG D+ KLVP
Sbjct  96   VSSSLILGICGLPDTIFRKAVEMALADSECYGLQDPNARLSCFATKALVNVGSDMTKLVP  155

Query  495  GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXG  674
            GRVSTEVDARLAYDTHGI+ KVHDLLKLYN   +P ERLLFKIP+TWQGIEA+RLLE+ G
Sbjct  156  GRVSTEVDARLAYDTHGIIRKVHDLLKLYNDSNVPHERLLFKIPSTWQGIEAARLLESEG  215

Query  675  IQTHLTFVY  701
            IQTHLTFVY
Sbjct  216  IQTHLTFVY  224



>gb|KHN09791.1| Transaldolase [Glycine soja]
Length=397

 Score =   290 bits (741),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAAT  314
            P+L FNS     + RASA   SS+ T  TTELDAV+++SEIVPDTVVFDDFEKFPPTAAT
Sbjct  36   PTLRFNSHSSLSLTRASA---SSITTASTTELDAVSSFSEIVPDTVVFDDFEKFPPTAAT  92

Query  315  VSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVP  494
            VSSSLLLGIC LPDT F++AV+ ALAD ECYGLE+ +AR+SCF NKA  NVG D+AKLVP
Sbjct  93   VSSSLLLGICGLPDTIFRNAVEMALADSECYGLENPNARLSCFVNKAFANVGSDMAKLVP  152

Query  495  GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXG  674
            GRVSTEVDAR AYDT  I+ KVHDLLKLYN   +PP+RLLFKIP+TWQGIEA+RLLE+ G
Sbjct  153  GRVSTEVDARFAYDTPAIIRKVHDLLKLYNDSNVPPKRLLFKIPSTWQGIEAARLLESEG  212

Query  675  IQTHLTFVY  701
            IQTHLTFVY
Sbjct  213  IQTHLTFVY  221



>ref|XP_004516847.1| PREDICTED: transaldolase-like [Cicer arietinum]
Length=389

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +3

Query  105  KLKFAAQSTKP-SLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFD  281
            +  F+ +ST P +L  N +  FP I AS    S++DT +T ELDAV+ +SEIVPDTV+FD
Sbjct  19   RTSFSLRSTPPPTLLINYRNSFPRIHAS----SNIDTAIT-ELDAVSAFSEIVPDTVIFD  73

Query  282  DFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALV  461
            DF+KFPPTAATVSSSLLLGIC LPDT F++AV+ ALAD ECYGLED + R+SCF  KALV
Sbjct  74   DFQKFPPTAATVSSSLLLGICGLPDTIFRNAVEMALADAECYGLEDPNTRLSCFATKALV  133

Query  462  NVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQG  641
            NVG D+AKLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLY+   +PP+RLLFKIP+TWQG
Sbjct  134  NVGSDMAKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYHDSNVPPQRLLFKIPSTWQG  193

Query  642  IEASRLLEAXGIQTHLTFVY  701
            IEA+RLLE+ GIQTHLTFVY
Sbjct  194  IEAARLLESEGIQTHLTFVY  213



>ref|XP_003608757.1| Transaldolase [Medicago truncatula]
 gb|AES90954.1| transaldolase total2 protein [Medicago truncatula]
Length=400

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 162/196 (83%), Gaps = 6/196 (3%)
 Frame = +3

Query  114  FAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEK  293
            F   +  P+L FNSK  F +IRAS     S DT + TELDAV+ +SEIVPDTV+FDDF+K
Sbjct  35   FFRSTPPPTLLFNSKNSFSLIRAS-----STDT-VITELDAVSAFSEIVPDTVIFDDFQK  88

Query  294  FPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGG  473
            FPPTAATVSSSL+LGIC LPDT F+ AV+ ALAD ECYGL+D +AR+SCF  KALVNVG 
Sbjct  89   FPPTAATVSSSLILGICGLPDTIFRKAVEMALADSECYGLQDPNARLSCFATKALVNVGS  148

Query  474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS  653
            D+ KLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLYN   +P ERLLFKIP+TWQGIEA+
Sbjct  149  DMTKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYNDSNVPHERLLFKIPSTWQGIEAA  208

Query  654  RLLEAXGIQTHLTFVY  701
            RLLE+ GIQTHLTFVY
Sbjct  209  RLLESEGIQTHLTFVY  224



>ref|XP_008794812.1| PREDICTED: probable transaldolase [Phoenix dactylifera]
Length=396

 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 161/188 (86%), Gaps = 1/188 (1%)
 Frame = +3

Query  141  LSFNSKPCFPVIRASAG-FSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATV  317
            L F+ +   P++ A+ G  SSSL++ L+TELDAV+++SEIVPDTVVFDDFE+FPPTAATV
Sbjct  33   LVFHLRKSIPIVNAAGGNASSSLESDLSTELDAVSSFSEIVPDTVVFDDFERFPPTAATV  92

Query  318  SSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPG  497
            SSS LLG+CSLPDTKFKS ++TALAD ECY  E    RMSCFFNKALV+VG DL KLVPG
Sbjct  93   SSSFLLGLCSLPDTKFKSGIETALADSECYEKESPSERMSCFFNKALVHVGADLGKLVPG  152

Query  498  RVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGI  677
            RVSTEVDARLAYDT GI+ +VH+LLKLYN +E+  +RLLFKIP+TWQGIEASRLLE+ GI
Sbjct  153  RVSTEVDARLAYDTQGIIRRVHELLKLYNEVEVSSQRLLFKIPSTWQGIEASRLLESEGI  212

Query  678  QTHLTFVY  701
            QTHLTFVY
Sbjct  213  QTHLTFVY  220



>ref|XP_007155630.1| hypothetical protein PHAVU_003G218000g [Phaseolus vulgaris]
 gb|ESW27624.1| hypothetical protein PHAVU_003G218000g [Phaseolus vulgaris]
Length=400

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +3

Query  138  SLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATV  317
            +L FN     P  RASA   SS++   TTELDAV+ +SEIVPDTVVFDDFEKFPPTAATV
Sbjct  40   TLHFNYHRSLPRTRASA---SSINIASTTELDAVSAFSEIVPDTVVFDDFEKFPPTAATV  96

Query  318  SSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPG  497
            SSSLLLGIC LPDT F++AV+ ALAD ECYG+++ +AR+SCF +KA  NVG DLAKLVPG
Sbjct  97   SSSLLLGICGLPDTIFRNAVEMALADSECYGIQNPNARLSCFVSKAFANVGSDLAKLVPG  156

Query  498  RVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGI  677
            RVSTEVDARLAYDTH I+ KVHDLLKLYN   +PP+RLLFKIP+TWQGIEA+RLLE+ GI
Sbjct  157  RVSTEVDARLAYDTHAIIRKVHDLLKLYNISNVPPQRLLFKIPSTWQGIEAARLLESEGI  216

Query  678  QTHLTFVY  701
            QTHLTFVY
Sbjct  217  QTHLTFVY  224



>ref|NP_001242359.1| uncharacterized protein LOC100800377 [Glycine max]
 gb|ACU24408.1| unknown [Glycine max]
Length=397

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 158/189 (84%), Gaps = 3/189 (2%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAAT  314
            P+L FNS     + RASA   SS+ T  TT LDAV+++SEIVPDTVVFDDFEKFPPTAAT
Sbjct  36   PTLRFNSHSSLSLTRASA---SSITTASTTGLDAVSSFSEIVPDTVVFDDFEKFPPTAAT  92

Query  315  VSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVP  494
            VSSSLLLGIC LPDT F++AV+ ALAD ECYGLE+ +AR+SCF NKA  NVG D+AKLVP
Sbjct  93   VSSSLLLGICGLPDTIFRNAVEMALADSECYGLENPNARLSCFDNKAFANVGSDMAKLVP  152

Query  495  GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXG  674
            GRVSTEVDAR AYDT  I+ KVHDLLKLYN   +PP+RLLFKIP+TWQGIEA+RLLE+ G
Sbjct  153  GRVSTEVDARFAYDTPAIIRKVHDLLKLYNDSNVPPKRLLFKIPSTWQGIEAARLLESEG  212

Query  675  IQTHLTFVY  701
            IQTHLTFVY
Sbjct  213  IQTHLTFVY  221



>gb|KEH31658.1| transaldolase total2 protein [Medicago truncatula]
Length=399

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 162/196 (83%), Gaps = 7/196 (4%)
 Frame = +3

Query  114  FAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEK  293
            F   +  P+L FNSK  F +IRAS     S DT + TELDAV+ +SEIVPDTV+FDDF+K
Sbjct  35   FFRSTPPPTLLFNSKNSFSLIRAS-----STDT-VITELDAVSAFSEIVPDTVIFDDFQK  88

Query  294  FPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGG  473
            FPPTAATVSSSL+LGIC LPDT F+ AV+ ALAD ECYGL+D +AR+SCF  KALVNVG 
Sbjct  89   FPPTAATVSSSLILGICGLPDTIFR-AVEMALADSECYGLQDPNARLSCFATKALVNVGS  147

Query  474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS  653
            D+ KLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLYN   +P ERLLFKIP+TWQGIEA+
Sbjct  148  DMTKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYNDSNVPHERLLFKIPSTWQGIEAA  207

Query  654  RLLEAXGIQTHLTFVY  701
            RLLE+ GIQTHLTFVY
Sbjct  208  RLLESEGIQTHLTFVY  223



>ref|XP_009407153.1| PREDICTED: probable transaldolase [Musa acuminata subsp. malaccensis]
Length=393

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAAT  314
            PSL    +   P +R  AG +S  DT L+ ELDAV ++SEIVPDTVVFDDFE+FPPTAAT
Sbjct  29   PSLLIRLQRSLPRVRVFAGNASPADTDLSNELDAVLSFSEIVPDTVVFDDFERFPPTAAT  88

Query  315  VSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVP  494
            VSSS LLG+CSLP+TKFKSA++TALAD EC G E+   R+SCF NKALVNVG DLA+ VP
Sbjct  89   VSSSFLLGLCSLPNTKFKSAIETALADSECNGKENSSDRLSCFSNKALVNVGADLARFVP  148

Query  495  GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXG  674
            GRVSTEVDARLAYDT GI+ KVH+LLKLYN +E+  +RLLFKIP+TWQGIEASRLLE+ G
Sbjct  149  GRVSTEVDARLAYDTRGIIRKVHELLKLYNEVEVSSQRLLFKIPSTWQGIEASRLLESEG  208

Query  675  IQTHLTFVY  701
            IQTHLTFVY
Sbjct  209  IQTHLTFVY  217



>ref|XP_010093688.1| hypothetical protein L484_019027 [Morus notabilis]
 gb|EXB54468.1| hypothetical protein L484_019027 [Morus notabilis]
Length=402

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 171/203 (84%), Gaps = 3/203 (1%)
 Frame = +3

Query  99   ERKLKFAAQSTKPS-LSFN-SKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTV  272
             R L F+ +    + + FN  K C P IRAS+G SSSLDTG  TEL+AV+ +SEIVPDTV
Sbjct  25   RRGLSFSGRYRASNFIVFNLPKSCTP-IRASSGSSSSLDTGSGTELEAVSTFSEIVPDTV  83

Query  273  VFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNK  452
            +FDDFEKFPPTAATVSSSLLLGIC LPDT F++AVD ALAD EC  LE+ + +MSCF NK
Sbjct  84   IFDDFEKFPPTAATVSSSLLLGICGLPDTIFRNAVDMALADSECSKLENSELKMSCFSNK  143

Query  453  ALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPAT  632
            ALVNVGGDL+KLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLY+ I +PPERLLFKIP+T
Sbjct  144  ALVNVGGDLSKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYDEINVPPERLLFKIPST  203

Query  633  WQGIEASRLLEAXGIQTHLTFVY  701
            WQGIEASRLLE+ GIQTHLTFVY
Sbjct  204  WQGIEASRLLESEGIQTHLTFVY  226



>gb|KDP25631.1| hypothetical protein JCGZ_20787 [Jatropha curcas]
Length=399

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +3

Query  147  FNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSS  326
            F  +  FP IRAS+GFSSSLDTG +TELDAV+++SEIVPDTV+FDDFEKFPPTAATVSSS
Sbjct  39   FKLQRSFPQIRASSGFSSSLDTGASTELDAVSSFSEIVPDTVIFDDFEKFPPTAATVSSS  98

Query  327  LLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVS  506
            LLLGI SLPDT F++AVD ALAD  C  L++ ++R+SCF NKALVNVGGDL KLVPGRVS
Sbjct  99   LLLGILSLPDTIFRNAVDMALADSGCAALKNPESRLSCFANKALVNVGGDLVKLVPGRVS  158

Query  507  TEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTH  686
            TEVDARLAYDTHGI+ KVH LLKLY+ I +PPERLLFKIP+TWQGIEASRLLE+ GIQTH
Sbjct  159  TEVDARLAYDTHGIIRKVHALLKLYDEINVPPERLLFKIPSTWQGIEASRLLESEGIQTH  218

Query  687  LTFVY  701
            LTFVY
Sbjct  219  LTFVY  223



>ref|XP_007039918.1| Transaldolase isoform 1 [Theobroma cacao]
 gb|EOY24419.1| Transaldolase isoform 1 [Theobroma cacao]
Length=400

 Score =   282 bits (721),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 173/201 (86%), Gaps = 2/201 (1%)
 Frame = +3

Query  105  KLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSS--LDTGLTTELDAVTNYSEIVPDTVVF  278
            +L+FA  S+  +L F     FPVIRAS+  S S  LDTGL+TELDAV+ +SEIVPDTV+F
Sbjct  24   RLRFANVSSSSALLFKFNRSFPVIRASSSSSFSSSLDTGLSTELDAVSTFSEIVPDTVIF  83

Query  279  DDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKAL  458
            DDFE+FPPTAATVSSSLLLGI SLPDT F++AVD ALAD  C GL++ + R+SCF NKAL
Sbjct  84   DDFERFPPTAATVSSSLLLGILSLPDTIFRNAVDMALADSGCSGLDNPELRLSCFCNKAL  143

Query  459  VNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQ  638
            VNVGGDLAKLVPGRVSTEVDARLAYDTHGI+ +VHDLLKLYN I++PPERLLFKIP+TWQ
Sbjct  144  VNVGGDLAKLVPGRVSTEVDARLAYDTHGIIRRVHDLLKLYNEIDVPPERLLFKIPSTWQ  203

Query  639  GIEASRLLEAXGIQTHLTFVY  701
            GIEASRLLE+ GIQTHLTFVY
Sbjct  204  GIEASRLLESEGIQTHLTFVY  224



>ref|XP_010941128.1| PREDICTED: probable transaldolase [Elaeis guineensis]
Length=396

 Score =   282 bits (721),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L++ L+TELDAV+++SEIVPDTVVFDDFE+FPPTAATVSSS LLG+CSLPDTKFKSA++T
Sbjct  55   LESDLSTELDAVSSFSEIVPDTVVFDDFERFPPTAATVSSSFLLGLCSLPDTKFKSAIET  114

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD ECY  E+   RMSCFFNKALV+VG DL KLVPGRVSTEVDARLAYDTHGI+ +VH
Sbjct  115  ALADSECYEKENPSERMSCFFNKALVHVGADLVKLVPGRVSTEVDARLAYDTHGIIRRVH  174

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +LLKLYN +E+  +RLLFKIP+TWQGIEASRLLE+ GIQTHLTF+Y
Sbjct  175  ELLKLYNEVEVSSQRLLFKIPSTWQGIEASRLLESEGIQTHLTFIY  220



>ref|XP_010919480.1| PREDICTED: probable transaldolase [Elaeis guineensis]
Length=394

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = +3

Query  168  PVIRAS-AGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGIC  344
            P + AS +  SS+LD  L+TELDAV+ +SEIVPDTV+FDDFE+FPPTAATVSSSLLLGI 
Sbjct  40   PRVYASISNASSTLDADLSTELDAVSGFSEIVPDTVIFDDFERFPPTAATVSSSLLLGIS  99

Query  345  SLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDAR  524
             LPDTKF+SA++TALAD ECY  ++ + R+SCF++KA+VNVG DL KLVPGRVSTEVDAR
Sbjct  100  GLPDTKFRSAIETALADGECYEEQNPNDRLSCFYDKAMVNVGADLVKLVPGRVSTEVDAR  159

Query  525  LAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LA+DTHGIV KVHDLLKLY  IE+P ERLLFKIP+TWQGIEASR+LE+ GIQTHLTFVY
Sbjct  160  LAHDTHGIVRKVHDLLKLYYEIEVPSERLLFKIPSTWQGIEASRVLESEGIQTHLTFVY  218



>ref|XP_006840956.1| hypothetical protein AMTR_s00085p00019560 [Amborella trichopoda]
 gb|ERN02631.1| hypothetical protein AMTR_s00085p00019560 [Amborella trichopoda]
Length=395

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+T   TELDAV+ +SEIVPDTVVFDDFE+FPPTAATVSSSLLLGICSLPDTKFKSA++T
Sbjct  54   LETAPGTELDAVSTFSEIVPDTVVFDDFERFPPTAATVSSSLLLGICSLPDTKFKSAIET  113

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD EC   E+ D R++CF+NKALVNVG DLAK VPGRVSTEVDARLAYDTHGI+ KVH
Sbjct  114  ALADGECCTKENPDDRLACFYNKALVNVGADLAKAVPGRVSTEVDARLAYDTHGIIRKVH  173

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +LLKLYN +E+P ERLLFKIP+TWQGIEASRLLE+ GI THLTFVY
Sbjct  174  ELLKLYNEVEVPQERLLFKIPSTWQGIEASRLLESEGILTHLTFVY  219



>gb|ADG27842.1| transaldolase [Gossypium hirsutum]
Length=395

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  105  KLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDD  284
            +L FA  S+  +L F     FPV+RAS+G SSS+DTGL+TELDAV+ +SEIVPDTV+FDD
Sbjct  21   RLGFANGSSSSTLLFKFNRSFPVLRASSGSSSSVDTGLSTELDAVSTFSEIVPDTVIFDD  80

Query  285  FEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVN  464
            FEKFPPTAATVSSSLLLGI SLPDT F++AVD ALAD  C  L++ + R+SCF NKALVN
Sbjct  81   FEKFPPTAATVSSSLLLGILSLPDTIFRNAVDMALADSTCSPLDNPELRLSCFVNKALVN  140

Query  465  VGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGI  644
            VGGDLAKLVPGRVSTEVDARLAYDTHGI+ +VHDLL+LY+ I +PPERLLFKIP+TWQGI
Sbjct  141  VGGDLAKLVPGRVSTEVDARLAYDTHGIIRRVHDLLRLYDEIAVPPERLLFKIPSTWQGI  200

Query  645  EASRLLEAXGIQTHLTFVY  701
            EASRLLE+ GIQTHLTFVY
Sbjct  201  EASRLLESEGIQTHLTFVY  219



>ref|XP_006307691.1| hypothetical protein CARUB_v10009318mg [Capsella rubella]
 gb|EOA40589.1| hypothetical protein CARUB_v10009318mg [Capsella rubella]
Length=405

 Score =   278 bits (710),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 162/194 (84%), Gaps = 5/194 (3%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP  299
            P++SF+ +   P IRASA  S S     L+ G   ELDAV+ +SEIVPDTVVFDDFE+FP
Sbjct  35   PAVSFSLRRSIPRIRASASSSPSQSSSSLEAGENNELDAVSAFSEIVPDTVVFDDFERFP  94

Query  300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL  479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SC FNKA+VNVGGDL
Sbjct  95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCIFNKAMVNVGGDL  154

Query  480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL  659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct  155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL  214

Query  660  LEAXGIQTHLTFVY  701
            LE+ GIQTH+TFVY
Sbjct  215  LESEGIQTHITFVY  228



>gb|EPS67513.1| hypothetical protein M569_07263, partial [Genlisea aurea]
Length=338

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            TELD VT +S+IVPDTVVFDDFE+FPPTAATVSSSLLLGICSLPDTKF+S++DTALAD E
Sbjct  3    TELDVVTGFSQIVPDTVVFDDFERFPPTAATVSSSLLLGICSLPDTKFRSSIDTALADSE  62

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
            C+ L   + +MSCF N+ALVNVGG+LAKLVPGRVSTEVDARLAYDTHGI+ KVHDLL LY
Sbjct  63   CFTLAKTEDQMSCFVNQALVNVGGELAKLVPGRVSTEVDARLAYDTHGILRKVHDLLNLY  122

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            + I++PPERLLFKIP+TWQGIEAS+LLE+ GIQTH+TFVY
Sbjct  123  HKIKVPPERLLFKIPSTWQGIEASQLLESEGIQTHMTFVY  162



>gb|AAL65634.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65636.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P ERLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHERLLFKIPATWQGIEAARLLESEGIQTHITFVY  228



>gb|KHG09888.1| Transaldolase [Gossypium arboreum]
Length=395

 Score =   277 bits (708),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  105  KLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDD  284
            +L+FA  S+  +L F     FPV+ AS+G SSS+DTGL+TELDAV+ +SEIVPDTV+FDD
Sbjct  21   RLRFANGSSSSTLLFKFNRSFPVLGASSGSSSSVDTGLSTELDAVSTFSEIVPDTVIFDD  80

Query  285  FEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVN  464
            FEKFPPTAATVSSSLLLGI SLPDT F++AVD ALAD  C  L++ + R+SCF NKALVN
Sbjct  81   FEKFPPTAATVSSSLLLGILSLPDTIFRNAVDMALADSTCSPLDNPELRLSCFVNKALVN  140

Query  465  VGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGI  644
            VGGDLAKLVPGRVSTEVDARLAYDTHGI+ +VHDLL+LY+ I +PPERLLFKIP+TWQGI
Sbjct  141  VGGDLAKLVPGRVSTEVDARLAYDTHGIIRRVHDLLRLYDEIAVPPERLLFKIPSTWQGI  200

Query  645  EASRLLEAXGIQTHLTFVY  701
            EASRLLE+ GIQTHLTFVY
Sbjct  201  EASRLLESEGIQTHLTFVY  219



>gb|AAL65624.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65625.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P ERLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHERLLFKIPATWQGIEAARLLESEGIQTHITFVY  228



>gb|AAL65627.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65629.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65630.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65631.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P ERLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHERLLFKIPATWQGIEAARLLESEGIQTHITFVY  228



>gb|AAL65638.1| transaldolase-like protein [Arabidopsis lyrata]
Length=375

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSSSLLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSSLLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>ref|XP_008787008.1| PREDICTED: probable transaldolase [Phoenix dactylifera]
Length=394

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = +3

Query  168  PVIRAS-AGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGIC  344
            P + AS +  SS++DT LTTELDAV+++SEIVPDTVVFDDFE+FPPTAATVSSSLLLGI 
Sbjct  40   PRVYASISNASSTIDTDLTTELDAVSSFSEIVPDTVVFDDFERFPPTAATVSSSLLLGIS  99

Query  345  SLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDAR  524
             LPDTKF+SA++TAL D ECY  ++ + R+SCF++KA+VNVG DL KLVPGRVSTEVDAR
Sbjct  100  GLPDTKFRSAIETALVDSECYEQQNPNDRLSCFYDKAMVNVGADLVKLVPGRVSTEVDAR  159

Query  525  LAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LAYD HGIV KV DL+KLY  I++P ERLLFKIP+TWQGIEASR+LE+ GIQTHLTFVY
Sbjct  160  LAYDIHGIVRKVRDLMKLYYEIDVPSERLLFKIPSTWQGIEASRVLESEGIQTHLTFVY  218



>ref|XP_006417257.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
 gb|ESQ35610.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
Length=312

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 159/195 (82%), Gaps = 6/195 (3%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSS------LDTGLTTELDAVTNYSEIVPDTVVFDDFEKF  296
            P+++F+ +   P I  SA  SSS      +  G   ELDAV+  SEIVPDTVVFDDFE+F
Sbjct  35   PAVNFSVRRSLPRIHVSASSSSSSPSSPSVGAGENNELDAVSALSEIVPDTVVFDDFERF  94

Query  297  PPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGD  476
            PPTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  D+R+SCFFNKA+VNVGGD
Sbjct  95   PPTAATVSSALLLGICGLPDTIFRNAVDMALADASCAGLETTDSRLSCFFNKAIVNVGGD  154

Query  477  LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR  656
            L KLVPGRVSTEVDARLAYDT+ IV KVHDLL+LYN I++P +RLLFKIPATWQGIEA+R
Sbjct  155  LVKLVPGRVSTEVDARLAYDTNAIVRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAAR  214

Query  657  LLEAXGIQTHLTFVY  701
            LLE+ GIQTHLTFVY
Sbjct  215  LLESEGIQTHLTFVY  229



>ref|XP_008778383.1| PREDICTED: probable transaldolase, partial [Phoenix dactylifera]
Length=377

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  207  DTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTA  386
            D+ L+TELDAV+++SE+VPDTVVFDDFE+FPPTAATVSSS LLG+CSLPDTKFKSA++TA
Sbjct  37   DSDLSTELDAVSSFSELVPDTVVFDDFERFPPTAATVSSSFLLGLCSLPDTKFKSAIETA  96

Query  387  LADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
            LAD ECY  ++ + RMSCFFNKALV+VG DL KLVPGRVSTEVDARLAYDT  I+ KVH+
Sbjct  97   LADSECYEKKNPNERMSCFFNKALVHVGADLEKLVPGRVSTEVDARLAYDTKSIIQKVHE  156

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LLKLYN +E+  +RLLFKIP+TWQGIEASRLLE+ GIQTHLTFVY
Sbjct  157  LLKLYNEVEVSSQRLLFKIPSTWQGIEASRLLESEGIQTHLTFVY  201



>gb|AAL65623.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65632.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>gb|KFK43488.1| hypothetical protein AALP_AA1G131500 [Arabis alpina]
Length=406

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 160/194 (82%), Gaps = 5/194 (3%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP  299
            P+++F  +   P I AS+   SS     L+ G   ELDAV+ +SEIVPDTVVFDDFE+FP
Sbjct  36   PAVNFTLRRSIPRIYASSSSFSSPSSSSLEAGENNELDAVSAFSEIVPDTVVFDDFERFP  95

Query  300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL  479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct  96   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAMVNVGGDL  155

Query  480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL  659
             KLVPGRVSTEVDARLAYDT+ I+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct  156  VKLVPGRVSTEVDARLAYDTNAILRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL  215

Query  660  LEAXGIQTHLTFVY  701
            LE+ GIQTHLTFVY
Sbjct  216  LESEGIQTHLTFVY  229



>gb|AAL65605.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65607.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65609.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65611.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65615.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65617.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65619.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>gb|AAL65612.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65613.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>gb|AAL65620.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>gb|AAL65622.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>ref|XP_009382350.1| PREDICTED: probable transaldolase [Musa acuminata subsp. malaccensis]
Length=400

 Score =   275 bits (702),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = +3

Query  183  SAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTK  362
            +A  SS++ + L+TELDAV+ +SEIVPDTVVFDDFE+FPPTAATVSSSLLLGICSLPDTK
Sbjct  52   AADSSSAVGSELSTELDAVSRFSEIVPDTVVFDDFERFPPTAATVSSSLLLGICSLPDTK  111

Query  363  FKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTH  542
            F+SA++TALAD ECY  +D + R+SCF +KALVNVG DLA+LVPGRVSTEVDARLA+D H
Sbjct  112  FRSAIETALADSECYEQDDPNDRLSCFCDKALVNVGADLARLVPGRVSTEVDARLAFDAH  171

Query  543  GIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            GIV KVH LL+LY  +E+P ERLLFKIP+TWQGIEA++LLE+ GIQTHLTFVY
Sbjct  172  GIVRKVHRLLRLYYELEVPSERLLFKIPSTWQGIEAAKLLESEGIQTHLTFVY  224



>ref|NP_563900.1| transaldolase-like protein [Arabidopsis thaliana]
 gb|AAG12571.1|AC022522_4 Similar to transaldolase [Arabidopsis thaliana]
 gb|AAN72047.1| expressed protein [Arabidopsis thaliana]
 gb|AAP37846.1| At1g12230 [Arabidopsis thaliana]
 gb|AEE28853.1| transaldolase-like protein [Arabidopsis thaliana]
Length=405

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>gb|AAM66063.1| transaldolase ToTAL2 [Arabidopsis thaliana]
Length=405

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G   EL+AV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  228



>ref|XP_006417256.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
 gb|ESQ35609.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
Length=406

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 159/195 (82%), Gaps = 6/195 (3%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSS------LDTGLTTELDAVTNYSEIVPDTVVFDDFEKF  296
            P+++F+ +   P I  SA  SSS      +  G   ELDAV+  SEIVPDTVVFDDFE+F
Sbjct  35   PAVNFSVRRSLPRIHVSASSSSSSPSSPSVGAGENNELDAVSALSEIVPDTVVFDDFERF  94

Query  297  PPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGD  476
            PPTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  D+R+SCFFNKA+VNVGGD
Sbjct  95   PPTAATVSSALLLGICGLPDTIFRNAVDMALADASCAGLETTDSRLSCFFNKAIVNVGGD  154

Query  477  LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR  656
            L KLVPGRVSTEVDARLAYDT+ IV KVHDLL+LYN I++P +RLLFKIPATWQGIEA+R
Sbjct  155  LVKLVPGRVSTEVDARLAYDTNAIVRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAAR  214

Query  657  LLEAXGIQTHLTFVY  701
            LLE+ GIQTHLTFVY
Sbjct  215  LLESEGIQTHLTFVY  229



>ref|XP_010458643.1| PREDICTED: probable transaldolase [Camelina sativa]
Length=405

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L  G   ELDAV+ +SEIVPDTVVFDDFE+FPPTAATVSSSLLLGIC LPDT F++AVD 
Sbjct  63   LGAGENNELDAVSAFSEIVPDTVVFDDFERFPPTAATVSSSLLLGICGLPDTVFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SC  NKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  123  ALADSSCAGLETTESRLSCISNKAMVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  183  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHITFVY  228



>ref|XP_010533770.1| PREDICTED: probable transaldolase [Tarenaya hassleriana]
Length=404

 Score =   270 bits (691),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L+ G ++ELDAV+ +SEIVPDTV+FDDFEKFPPTAATVSS LLLGIC LPDT F++AVD 
Sbjct  63   LEAGQSSELDAVSAFSEIVPDTVIFDDFEKFPPTAATVSSGLLLGICGLPDTIFRNAVDM  122

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C G E  ++R SCFFNKA+VNVGG+L KLVPGRVSTEVD RLAYDT+GI+ KVH
Sbjct  123  ALADFTCTGQESPESRFSCFFNKAIVNVGGELVKLVPGRVSTEVDGRLAYDTNGIIRKVH  182

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLLKLYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTHLTFVY
Sbjct  183  DLLKLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHLTFVY  228



>emb|CDX98081.1| BnaA06g08320D [Brassica napus]
Length=406

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 162/200 (81%), Gaps = 4/200 (2%)
 Frame = +3

Query  114  FAAQSTKPSLSFNSKPCFPVIRASAGFSSS----LDTGLTTELDAVTNYSEIVPDTVVFD  281
            F+     P+++F  +   P I ASA  SS     L  G  +ELDAV+ +SEIVPDTVVFD
Sbjct  30   FSVAPPPPAVNFTLRRSIPRIHASASSSSPSSPSLGAGENSELDAVSAFSEIVPDTVVFD  89

Query  282  DFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALV  461
            DFE+FPPTAATVSS+LLLGIC LPDT F++AVD ALAD  C GL+  D+++SCFF+KA+V
Sbjct  90   DFERFPPTAATVSSALLLGICGLPDTIFRNAVDMALADSTCAGLDTTDSKLSCFFDKAIV  149

Query  462  NVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQG  641
            NVGGDL KLVPGRVSTEVDARLAYDT+ I+ KVHDLL+LYN I++P +RLLFKIPATWQG
Sbjct  150  NVGGDLVKLVPGRVSTEVDARLAYDTNAIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQG  209

Query  642  IEASRLLEAXGIQTHLTFVY  701
            IEA++LLE+ GIQTHLTFVY
Sbjct  210  IEAAKLLESEGIQTHLTFVY  229



>ref|XP_010676173.1| PREDICTED: probable transaldolase [Beta vulgaris subsp. vulgaris]
Length=394

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 162/192 (84%), Gaps = 2/192 (1%)
 Frame = +3

Query  132  KPSLSFN-SKPCFPVIRASA-GFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPT  305
            + +L+FN  +  FP +R SA    SSL  G++TELD V+ +SEIVPDTVVFDDFE+FPPT
Sbjct  27   RSNLTFNFRQSSFPQLRTSASNLPSSLHAGVSTELDDVSTFSEIVPDTVVFDDFERFPPT  86

Query  306  AATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAK  485
            AATVSSSLLLGI SLPDT FKSAVDTALAD +C  L   D R+SCF++KALVNVG DLAK
Sbjct  87   AATVSSSLLLGILSLPDTIFKSAVDTALADSDCASLGKSDGRLSCFYDKALVNVGADLAK  146

Query  486  LVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE  665
            LVPGRVSTEVD RLAYDTHGI+ KVHDLLKLYN IE+P ERLLFKIP+TWQGIEA+R+LE
Sbjct  147  LVPGRVSTEVDPRLAYDTHGIIHKVHDLLKLYNDIEVPAERLLFKIPSTWQGIEAARVLE  206

Query  666  AXGIQTHLTFVY  701
            + GIQTHLTFVY
Sbjct  207  SEGIQTHLTFVY  218



>dbj|BAG95062.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = +3

Query  117  AAQSTKPSLSFNSKPCFPVIRASAGF---SSSLDTGLTTELDAVTNYSEIVPDTVVFDDF  287
            AA S +P ++F+ +      R +AG    SSS+D  + TELDAV ++SEIVPDTVVFDDF
Sbjct  28   AAMSARP-VAFSLRRPVLAARVAAGGNAPSSSVDE-VVTELDAVASFSEIVPDTVVFDDF  85

Query  288  EKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNV  467
            EKF PTAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  +E  + RMSCF  KAL NV
Sbjct  86   EKFAPTAATVSSSLLLGIAGLPDTKFKSAIDTALADGECNTMEKPEDRMSCFLTKALANV  145

Query  468  GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE  647
            G ++A LVPGRVSTE+DARLAYDT GI+ +VH+LLKLY+  ++  ERLLFKIPATWQGIE
Sbjct  146  GAEMAHLVPGRVSTEIDARLAYDTQGIIQRVHELLKLYSDHDVLSERLLFKIPATWQGIE  205

Query  648  ASRLLEAXGIQTHLTFVY  701
            ASRLLE+ GIQTHLTFVY
Sbjct  206  ASRLLESEGIQTHLTFVY  223



>ref|XP_009148608.1| PREDICTED: probable transaldolase [Brassica rapa]
Length=409

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L  G   ELDAV+ +SEIVPDTVVFDDFE+FPPTAATVSS+LLLGIC LPDT F++AVD 
Sbjct  67   LGAGENNELDAVSAFSEIVPDTVVFDDFERFPPTAATVSSALLLGICGLPDTIFRNAVDM  126

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GL+  D+++SCFF+KA+VNVGGDL KLVPGRVSTEVDARLAYDT+ I+ KVH
Sbjct  127  ALADSTCAGLDTTDSKLSCFFDKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNAIIRKVH  186

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA++LLE+ GIQTHLTFVY
Sbjct  187  DLLRLYNEIDVPHDRLLFKIPATWQGIEAAKLLESEGIQTHLTFVY  232



>ref|XP_010906619.1| PREDICTED: probable transaldolase [Elaeis guineensis]
Length=396

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  129  TKPSLSFNSKPCFP-VIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPT  305
            + P+L  + K   P V  A+   SS+LD+  + ELDAV+++SE+VPDTVVFDDFE+FPPT
Sbjct  29   SPPALVLHLKRSIPRVNAAAGNASSALDSDFSNELDAVSSFSELVPDTVVFDDFERFPPT  88

Query  306  AATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAK  485
            AATVSSS LLG+CSLPDTKFK+A++TALAD ECY  ++   R SCFFNKALV+VG DLAK
Sbjct  89   AATVSSSFLLGLCSLPDTKFKNAIETALADSECYEKKNPSERESCFFNKALVHVGADLAK  148

Query  486  LVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE  665
            LVPGRVSTEVDARLAYDT GI+ +VH+LLKLYN +E+  + LLFKIP+TWQGIEASRLLE
Sbjct  149  LVPGRVSTEVDARLAYDTTGIIQRVHELLKLYNEVEVSSQCLLFKIPSTWQGIEASRLLE  208

Query  666  AXGIQTHLTFVY  701
            + GIQTHLTFVY
Sbjct  209  SEGIQTHLTFVY  220



>ref|XP_010476185.1| PREDICTED: probable transaldolase isoform X1 [Camelina sativa]
 ref|XP_010476186.1| PREDICTED: probable transaldolase isoform X2 [Camelina sativa]
Length=420

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDT  383
            L  G   ELDAV+ +SEIVPDTVVFDDFE+FPPTAATVSSSLLLGIC LPDT F++AVD 
Sbjct  78   LGAGENNELDAVSAFSEIVPDTVVFDDFERFPPTAATVSSSLLLGICGLPDTVFRNAVDM  137

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SC  NKA+VNV GDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  138  ALADSSCAGLETTESRLSCISNKAMVNVSGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  197

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  198  DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHITFVY  243



>emb|CDY30055.1| BnaC05g09650D [Brassica napus]
Length=471

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 160/194 (82%), Gaps = 5/194 (3%)
 Frame = +3

Query  135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP  299
            PS++F  +   P I ASA  SSS     L  G   ELDAV+ +SEIVPDTVVFDDFE+FP
Sbjct  101  PSVNFTLRRSIPRIHASASSSSSPSSPSLGAGENNELDAVSAFSEIVPDTVVFDDFERFP  160

Query  300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL  479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GL+  ++++SCFF+KA+VNVGGDL
Sbjct  161  PTAATVSSALLLGICGLPDTIFRNAVDMALADSTCAGLDTTESKLSCFFDKAIVNVGGDL  220

Query  480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL  659
             KLVPGRVSTEVDARLAYDT+ I+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA++L
Sbjct  221  VKLVPGRVSTEVDARLAYDTNAIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAAKL  280

Query  660  LEAXGIQTHLTFVY  701
            LE+ GIQTHLTFVY
Sbjct  281  LESEGIQTHLTFVY  294



>gb|EAZ05627.1| hypothetical protein OsI_27846 [Oryza sativa Indica Group]
Length=399

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = +3

Query  117  AAQSTKPSLSFNSKPCFPVIRASAGF---SSSLDTGLTTELDAVTNYSEIVPDTVVFDDF  287
            AA S +P ++F+ +      R +AG    SSS+D  + TELDAV ++SEIVPDTVVFDDF
Sbjct  28   AAMSARP-VAFSLRRPVLAARVAAGGNAPSSSVDE-VVTELDAVASFSEIVPDTVVFDDF  85

Query  288  EKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNV  467
            EKF PTAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  +E  + RMSCF  KAL NV
Sbjct  86   EKFAPTAATVSSSLLLGIAGLPDTKFKSAIDTALADGECNTMEKPEDRMSCFLTKALANV  145

Query  468  GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE  647
            G ++A LVPGRVSTE+DARLAYDT GI+ +VH+LLKLY+  ++  ERLLFKIPATWQGIE
Sbjct  146  GAEMAHLVPGRVSTEIDARLAYDTQGIIQRVHELLKLYSDHDVLSERLLFKIPATWQGIE  205

Query  648  ASRLLEAXGIQTHLTFVY  701
            ASRLLE+ GIQTHLTFVY
Sbjct  206  ASRLLESEGIQTHLTFVY  223



>ref|NP_001061014.1| Os08g0154300 [Oryza sativa Japonica Group]
 dbj|BAC55687.1| putative transaldolase ToTAL2 [Oryza sativa Japonica Group]
 dbj|BAF22928.1| Os08g0154300 [Oryza sativa Japonica Group]
 gb|EAZ41547.1| hypothetical protein OsJ_26073 [Oryza sativa Japonica Group]
Length=399

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = +3

Query  117  AAQSTKPSLSFNSKPCFPVIRASAGF---SSSLDTGLTTELDAVTNYSEIVPDTVVFDDF  287
            AA S +P ++F+ +      R +AG    SSS+D  + TELDAV ++SEIVPDTVVFDDF
Sbjct  28   AAMSARP-VAFSLRRPVLAARVAAGGNAPSSSVDE-VVTELDAVASFSEIVPDTVVFDDF  85

Query  288  EKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNV  467
            EKF PTAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  +E  + RMSCF  KAL NV
Sbjct  86   EKFAPTAATVSSSLLLGIAGLPDTKFKSAIDTALADGECNTMEKPEDRMSCFLTKALANV  145

Query  468  GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE  647
            G ++A LVPGRVSTE+DARLAYDT GI+ +VH+LLKLY+  ++  ERLLFKIPATWQGIE
Sbjct  146  GAEMAHLVPGRVSTEIDARLAYDTQGIIQRVHELLKLYSDHDVLSERLLFKIPATWQGIE  205

Query  648  ASRLLEAXGIQTHLTFVY  701
            ASRLLE+ GIQTHLTFVY
Sbjct  206  ASRLLESEGIQTHLTFVY  223



>ref|NP_001184971.1| transaldolase-like protein [Arabidopsis thaliana]
 gb|AEE28854.1| transaldolase-like protein [Arabidopsis thaliana]
Length=427

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 148/188 (79%), Gaps = 22/188 (12%)
 Frame = +3

Query  204  LDTGLTTELDAVTNYSEIVPDTVVFDDFE----------------------KFPPTAATV  317
            L+ G   EL+AV+ +SEIVPDTVVFDDFE                      KFPPTAATV
Sbjct  63   LEAGENNELNAVSAFSEIVPDTVVFDDFESFSLDRGYKKEISLRCKNSLPHKFPPTAATV  122

Query  318  SSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPG  497
            SS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPG
Sbjct  123  SSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPG  182

Query  498  RVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGI  677
            RVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GI
Sbjct  183  RVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGI  242

Query  678  QTHLTFVY  701
            QTH+TFVY
Sbjct  243  QTHMTFVY  250



>ref|XP_006659843.1| PREDICTED: probable transaldolase-like [Oryza brachyantha]
Length=370

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 147/177 (83%), Gaps = 2/177 (1%)
 Frame = +3

Query  171  VIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSL  350
            +I   +G S+ ++  + TELDAV ++SEIVPDTVVFDDFEKF PTAATVSSSLLLGI  L
Sbjct  20   IIWPFSGLSALME--VVTELDAVASFSEIVPDTVVFDDFEKFAPTAATVSSSLLLGIAGL  77

Query  351  PDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLA  530
            PDTKFKSA+DTALAD EC  LE  + RMSCF  KAL NVG +LA LVPGRVSTE+DARLA
Sbjct  78   PDTKFKSAIDTALADGECNTLEKPNDRMSCFLTKALANVGAELAHLVPGRVSTEIDARLA  137

Query  531  YDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            YDT GI+ +VH+LLKLYN  ++  ERLLFKIPATWQGIEASRLLE+ GIQTHLTFVY
Sbjct  138  YDTQGIIQRVHELLKLYNDHDVSSERLLFKIPATWQGIEASRLLESEGIQTHLTFVY  194



>dbj|BAJ97939.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 152/193 (79%), Gaps = 2/193 (1%)
 Frame = +3

Query  126  STKPSLSFNSKPCFPVIRASAGFSSSLDTG-LTTELDAVTNYSEIVPDTVVFDDFEKFPP  302
            S KP++    +P   V RA+AG + S   G + TELD V+++SEIVPDTVVFDDFEKF P
Sbjct  29   SAKPAVFSLRRPVL-VARAAAGNAPSSPAGAVVTELDVVSSFSEIVPDTVVFDDFEKFAP  87

Query  303  TAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLA  482
            TAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  +E    RMSC+  KAL NVG +LA
Sbjct  88   TAATVSSSLLLGIAGLPDTKFKSAIDTALADGECNTMEKPGDRMSCYLTKALGNVGAELA  147

Query  483  KLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLL  662
              VPGRVSTE+DARLAYD  GI+ +VH+LL++YN  +IP ERLLFKIPATWQGIEASRLL
Sbjct  148  HQVPGRVSTEIDARLAYDAQGIIQRVHELLQIYNEHDIPSERLLFKIPATWQGIEASRLL  207

Query  663  EAXGIQTHLTFVY  701
            E+ G QTHLTFVY
Sbjct  208  ESEGTQTHLTFVY  220



>ref|XP_003573490.1| PREDICTED: probable transaldolase [Brachypodium distachyon]
Length=397

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 149/194 (77%), Gaps = 0/194 (0%)
 Frame = +3

Query  120  AQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP  299
            A S +P  S   +P      A+    SS    + TELD V+++SEIVPDTVVFDDFEKF 
Sbjct  28   ASSARPVASSLRRPVLAARAAAGNVPSSPVDQVVTELDVVSSFSEIVPDTVVFDDFEKFA  87

Query  300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL  479
            PTAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  +E+   RMSCF  KAL NVG +L
Sbjct  88   PTAATVSSSLLLGIAGLPDTKFKSAIDTALADGECNTMENSGDRMSCFLTKALGNVGAEL  147

Query  480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL  659
            A  VPGRVSTE+D+RLAYDT GI+ +VH+LL++YN  ++P ERLLFKIPATWQGIEASRL
Sbjct  148  AHQVPGRVSTEIDSRLAYDTQGIIQRVHELLQIYNEHDVPSERLLFKIPATWQGIEASRL  207

Query  660  LEAXGIQTHLTFVY  701
            LE+ G QTHLTFVY
Sbjct  208  LESEGTQTHLTFVY  221



>gb|ABK26234.1| unknown [Picea sitchensis]
Length=387

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  219  TTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ  398
             TE++A+   SEIVPDT++FDDFE+FPPTAATVSSSLLLGICSLP+T+F S ++TA+ D 
Sbjct  51   NTEMEAIKELSEIVPDTMIFDDFERFPPTAATVSSSLLLGICSLPETRFGSVIETAMVDS  110

Query  399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL  578
            E Y  ED   R+SC FNKA+VNVG +L K+VPGRVSTEVDARLAYDTHG + KVH+LLKL
Sbjct  111  EGYASEDGSDRLSCIFNKAMVNVGAELVKIVPGRVSTEVDARLAYDTHGTIKKVHELLKL  170

Query  579  YNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            Y  +E+P ERLLFKIPATWQGIEASRLLEA GIQTH+TFVY
Sbjct  171  YEEVEVPQERLLFKIPATWQGIEASRLLEAEGIQTHVTFVY  211



>gb|ACN40140.1| unknown [Picea sitchensis]
Length=387

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  219  TTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ  398
             TE++A+   SEIVPDT++FDDFE+FPPTAATVSSSLLLGICSLP+T+F S ++TA+ D 
Sbjct  51   NTEMEAIKELSEIVPDTMIFDDFERFPPTAATVSSSLLLGICSLPETRFGSVIETAMVDS  110

Query  399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL  578
            E Y  ED   R+SC FNKA+VNVG +L K+VPGRVSTEVDARLAYDTHG + KVH+LLKL
Sbjct  111  EGYASEDGSDRLSCIFNKAMVNVGAELVKIVPGRVSTEVDARLAYDTHGTIKKVHELLKL  170

Query  579  YNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            Y  +E+P ERLLFKIPATWQGIEASRLLEA GIQTH+TFVY
Sbjct  171  YEEVEVPQERLLFKIPATWQGIEASRLLEAEGIQTHVTFVY  211



>gb|AIN39832.1| hypothetical protein [Zoysia matrella]
Length=280

 Score =   253 bits (646),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
              TELDAV  +SEIVPDTVVFDDFEKF P AATVSSSLLLGI  LPDTKFKSA+DTALAD
Sbjct  59   FVTELDAVAGFSEIVPDTVVFDDFEKFAPKAATVSSSLLLGIAGLPDTKFKSAIDTALAD  118

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             EC  LE  +ARMSC+  KAL NVG +LA  VPGRVSTE+DARLAYDT GI+ +VH+LL 
Sbjct  119  GECNALEKPEARMSCYLTKALANVGAELAHQVPGRVSTEIDARLAYDTQGIIQRVHELLN  178

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN  +I  E LLFKIPATWQGIEASRLLE+ GI+THLTFVY
Sbjct  179  LYNQHDISSEHLLFKIPATWQGIEASRLLESEGIRTHLTFVY  220



>ref|XP_002532577.1| transaldolase total2, putative [Ricinus communis]
 gb|EEF29811.1| transaldolase total2, putative [Ricinus communis]
Length=367

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  147  FNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSS  326
            F  +  FP IRAS+GFSSSLDTG +TELDAV+++SEIVPDTV+FDDFEKFPPTAATVSSS
Sbjct  38   FKFQSSFPQIRASSGFSSSLDTGASTELDAVSSFSEIVPDTVIFDDFEKFPPTAATVSSS  97

Query  327  LLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVS  506
            LLLGI SLPDT F++AVD ALAD  C  L++ + R+SCF NKALVNVGGDL+KLVPGRVS
Sbjct  98   LLLGILSLPDTIFRNAVDMALADSGCAALDNPELRLSCFANKALVNVGGDLSKLVPGRVS  157

Query  507  TEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR  656
            TEVDARLAYDTHGI+ KVH LLKLY+ I +PPERLLFKIP+TWQGIEASR
Sbjct  158  TEVDARLAYDTHGIIRKVHSLLKLYDEINVPPERLLFKIPSTWQGIEASR  207



>ref|XP_002445069.1| hypothetical protein SORBIDRAFT_07g003600 [Sorghum bicolor]
 gb|EES14564.1| hypothetical protein SORBIDRAFT_07g003600 [Sorghum bicolor]
Length=394

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = +3

Query  108  LKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDF  287
            ++  ++S KP+     +P      A+    +S  + + TELDAV  +SEIVPDTVVFDDF
Sbjct  21   VRLTSRSAKPATFSLRRPPLAAAAAAGNAPTSPVSEVVTELDAVAGFSEIVPDTVVFDDF  80

Query  288  EKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNV  467
            E+F PTAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  LE  + RMSC+  KAL NV
Sbjct  81   ERFAPTAATVSSSLLLGIAGLPDTKFKSAIDTALADGECNALEKPEDRMSCYLTKALANV  140

Query  468  GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE  647
            G +LA  VPGRVSTE+DARLAYDT GI+ +VH+LL LYN  ++  +RLLFKIPATWQGIE
Sbjct  141  GAELAHQVPGRVSTEIDARLAYDTQGIIHRVHELLNLYNQHDVSTDRLLFKIPATWQGIE  200

Query  648  ASRLLEAXGIQTHLTFVY  701
            ASRLLE+ G+QTHLTFVY
Sbjct  201  ASRLLESEGVQTHLTFVY  218



>gb|EMS49842.1| Transaldolase [Triticum urartu]
Length=286

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +3

Query  213  GLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA  392
             + TELD V+++SEIVPDTVVFDDFEKF PTAATVSSSLLLGI  LPDTKFKSA+DTAL 
Sbjct  44   AVVTELDVVSSFSEIVPDTVVFDDFEKFAPTAATVSSSLLLGIAGLPDTKFKSAIDTALV  103

Query  393  DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL  572
            D EC  +E+   RMSC+  KAL NVG +LA  VPGRVSTE+DARLAYDT GIV +VH+LL
Sbjct  104  DGECNTMENPGDRMSCYLTKALGNVGAELAHQVPGRVSTEIDARLAYDTQGIVQRVHELL  163

Query  573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            ++YN  +IP ERLLFKIPATWQGIEASRLLE+ G QTHLTFVY
Sbjct  164  QIYNEHDIPSERLLFKIPATWQGIEASRLLESEGTQTHLTFVY  206



>ref|NP_001131550.1| hypothetical protein [Zea mays]
 gb|ACF79996.1| unknown [Zea mays]
 gb|AFW61220.1| hypothetical protein ZEAMMB73_046549 [Zea mays]
Length=394

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 151/200 (76%), Gaps = 0/200 (0%)
 Frame = +3

Query  102  RKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFD  281
            ++++  ++  KP+     +P      A+    +S    + TELDAV  +SEIVPDTVVFD
Sbjct  19   QEVRLTSRPPKPATFSLRRPHLAARAAAGNAPTSPVREVVTELDAVAGFSEIVPDTVVFD  78

Query  282  DFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALV  461
            DFE+F PTAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  LE  + RMSC+  KAL 
Sbjct  79   DFERFAPTAATVSSSLLLGITGLPDTKFKSAIDTALADGECNALEKAEDRMSCYLTKALA  138

Query  462  NVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQG  641
            NVG +LA  VPGRVSTE+DARLAYDT GI+ +VH+LL LYN  ++  +RLLFKIPATWQG
Sbjct  139  NVGAELAHQVPGRVSTEIDARLAYDTQGIIHRVHELLNLYNQHDVSTDRLLFKIPATWQG  198

Query  642  IEASRLLEAXGIQTHLTFVY  701
            IEASRLLE+ GIQTHLTFVY
Sbjct  199  IEASRLLESEGIQTHLTFVY  218



>ref|XP_004972823.1| PREDICTED: transaldolase-like [Setaria italica]
Length=396

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 147/195 (75%), Gaps = 2/195 (1%)
 Frame = +3

Query  120  AQSTKP-SLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKF  296
            A+S KP   S  S P      A    +S +D  + TELDAV  +SEIVPDTVVFDDFE+F
Sbjct  27   ARSAKPVPFSLRSSPLAARAAAGNAPTSPVDE-IVTELDAVAGFSEIVPDTVVFDDFERF  85

Query  297  PPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGD  476
             PTAAT SSSLLLGI  LP+TKFKSA+DTALAD EC  L+  + RMSC+  KAL NVG  
Sbjct  86   APTAATASSSLLLGIAGLPNTKFKSAIDTALADGECNALDKLEDRMSCYLTKALANVGAQ  145

Query  477  LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR  656
            LA  VPGRVSTE+DARLAYDT GI+ +VH+LL LYN  ++  +RLLFKIPATWQGIEASR
Sbjct  146  LAHQVPGRVSTEIDARLAYDTQGIIQRVHELLNLYNQHDVLTDRLLFKIPATWQGIEASR  205

Query  657  LLEAXGIQTHLTFVY  701
            LLE+ GIQTHLTFVY
Sbjct  206  LLESDGIQTHLTFVY  220



>ref|XP_001780973.1| predicted protein [Physcomitrella patens]
 gb|EDQ54233.1| predicted protein [Physcomitrella patens]
Length=408

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +3

Query  198  SSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAV  377
            +S+ T   TELDA+  YSE+VPDTV+FDDFE+FPPTAATVSSSLLLGI S+P   +  A+
Sbjct  66   ASVSTAEGTELDAIRKYSEVVPDTVIFDDFERFPPTAATVSSSLLLGITSVPKGSYNGAI  125

Query  378  DTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLK  557
            D+ALA  +CY +E+   R+SCF NKALVNVG +L K VPGRVSTEVDARLAYDT GIV +
Sbjct  126  DSALAYNKCY-VENSGERLSCFLNKALVNVGAELVKSVPGRVSTEVDARLAYDTPGIVNE  184

Query  558  VHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            VH+LL++Y+ +E+P +RLLFKIPATWQGIEA+R LE  GIQTH++ VY
Sbjct  185  VHELLRMYDEVEVPRDRLLFKIPATWQGIEATRQLETEGIQTHVSLVY  232



>ref|XP_008364532.1| PREDICTED: probable transaldolase [Malus domestica]
Length=186

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 128/155 (83%), Gaps = 5/155 (3%)
 Frame = +3

Query  96   QERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVV  275
            Q  +L+F+  S   +L F  +  FP+IRAS     +LDTG TTELD+V++YSEIVPDTV+
Sbjct  18   QGTRLRFSNGSPPSNLHFTLQRSFPLIRAS-----TLDTGSTTELDSVSSYSEIVPDTVI  72

Query  276  FDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKA  455
            FDDFE+FPPTAATVSSSLLLGICSLPDT F++AVD ALAD EC   E+ D R+SCFFNKA
Sbjct  73   FDDFERFPPTAATVSSSLLLGICSLPDTIFRNAVDMALADSECNLHENSDVRLSCFFNKA  132

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV  560
            LVNVGGDLAKLVPGRVSTEVDARLAYDTHGI+ KV
Sbjct  133  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIIRKV  167



>gb|AFK41264.1| unknown [Medicago truncatula]
Length=187

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 127/159 (80%), Gaps = 6/159 (4%)
 Frame = +3

Query  114  FAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEK  293
            F   +  P+L FNSK  F +IRAS     S DT + TELDAV+ +SEIVPDTV+FDDF+K
Sbjct  35   FFRSTPPPTLLFNSKNSFSLIRAS-----STDT-VITELDAVSAFSEIVPDTVIFDDFQK  88

Query  294  FPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGG  473
            F PTAATVSSSL+LGIC LPDT F+ AV+ ALAD ECYGL+D +AR+SCF  KALVNVG 
Sbjct  89   FSPTAATVSSSLILGICGLPDTIFRKAVEMALADSECYGLQDPNARLSCFATKALVNVGS  148

Query  474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGI  590
            D+ KLVPGRVSTEVDARLAYDTHGI+ KVHDLLKLY  I
Sbjct  149  DMTKLVPGRVSTEVDARLAYDTHGIIRKVHDLLKLYKHI  187



>gb|EMT17151.1| Transaldolase [Aegilops tauschii]
Length=351

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = +3

Query  126  STKPSLSFNSKPCFPVIRASAGFSSSLDTG-LTTELDAVTNYSEIVPDTVVFDDFEKFPP  302
            S KP+  F+ +    V RA+AG + S   G + TELD V+++SEIVPDTVVFDDFE+F P
Sbjct  29   SLKPA-GFSLRRPVVVARAAAGNAPSSPAGAVVTELDVVSSFSEIVPDTVVFDDFERFAP  87

Query  303  TAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLA  482
            TAATVSSSLLLGI  LPDTKFKSA+DTAL D EC  +E    RMSC+  KAL NVG +LA
Sbjct  88   TAATVSSSLLLGIAGLPDTKFKSAIDTALVDGECNTMEKPGDRMSCYLTKALGNVGAELA  147

Query  483  KLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQ  638
              VPGRVSTE+DARLAYDT GIV +VH+LL++YN  +IP ERLLFKIPATWQ
Sbjct  148  LQVPGRVSTEIDARLAYDTQGIVQRVHELLQIYNEHDIPSERLLFKIPATWQ  199



>ref|XP_002889922.1| hypothetical protein ARALYDRAFT_888542 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66181.1| hypothetical protein ARALYDRAFT_888542 [Arabidopsis lyrata subsp. 
lyrata]
Length=1851

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 141/194 (73%), Gaps = 33/194 (17%)
 Frame = +3

Query  135   PSLSFNSKPCFPVI-----RASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP  299
             P+++F+ +   P I      +S+  SSSL+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct  1509  PAVNFSIRRSIPRILASASSSSSPSSSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP  1568

Query  300   PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL  479
             PTAATVSSSLLLGIC LPDT F+                            A+VNVGGDL
Sbjct  1569  PTAATVSSSLLLGICGLPDTIFR----------------------------AIVNVGGDL  1600

Query  480   AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL  659
              KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct  1601  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL  1660

Query  660   LEAXGIQTHLTFVY  701
             LE+ GIQTH+TFVY
Sbjct  1661  LESEGIQTHMTFVY  1674



>ref|XP_007039919.1| Transaldolase isoform 2, partial [Theobroma cacao]
 gb|EOY24420.1| Transaldolase isoform 2, partial [Theobroma cacao]
Length=295

 Score =   194 bits (492),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +3

Query  369  SAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGI  548
            +AVD ALAD  C GL++ + R+SCF NKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGI
Sbjct  20   NAVDMALADSGCSGLDNPELRLSCFCNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGI  79

Query  549  VLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            + +VHDLLKLYN I++PPERLLFKIP+TWQGIEASRLLE+ GIQTHLTFVY
Sbjct  80   IRRVHDLLKLYNEIDVPPERLLFKIPSTWQGIEASRLLESEGIQTHLTFVY  130



>gb|KJB37609.1| hypothetical protein B456_006G212700 [Gossypium raimondii]
 gb|KJB37610.1| hypothetical protein B456_006G212700 [Gossypium raimondii]
Length=283

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C  L++ + R+SCFFNKALVNVGGDLAKLVPGRVSTEVDAR AYDTHGI+ +VH
Sbjct  2    ALADSTCSRLDNPELRLSCFFNKALVNVGGDLAKLVPGRVSTEVDARRAYDTHGIIRRVH  61

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLLKLYN I++PPERLLFKIP+TWQGIEASRLLE+ GIQTHLTFVY
Sbjct  62   DLLKLYNEIDVPPERLLFKIPSTWQGIEASRLLESEGIQTHLTFVY  107



>dbj|BAD94458.1| hypothetical protein [Arabidopsis thaliana]
Length=284

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SCFFNKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  2    ALADSSCAGLETTESRLSCFFNKAIVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  61

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  62   DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHMTFVY  107



>ref|XP_010493866.1| PREDICTED: probable transaldolase isoform X1 [Camelina sativa]
 ref|XP_010493906.1| PREDICTED: probable transaldolase isoform X6 [Camelina sativa]
Length=284

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  384  ALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
            ALAD  C GLE  ++R+SC  NKA+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVH
Sbjct  2    ALADSSCAGLETTESRLSCISNKAMVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVH  61

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            DLL+LYN I++P +RLLFKIPATWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  62   DLLRLYNEIDVPHDRLLFKIPATWQGIEAARLLESEGIQTHITFVY  107



>ref|XP_010493869.1| PREDICTED: probable transaldolase isoform X2 [Camelina sativa]
Length=265

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  450  KALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPA  629
            +A+VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPA
Sbjct  5    QAMVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPA  64

Query  630  TWQGIEASRLLEAXGIQTHLTFVY  701
            TWQGIEA+RLLE+ GIQTH+TFVY
Sbjct  65   TWQGIEAARLLESEGIQTHITFVY  88



>ref|XP_010493876.1| PREDICTED: probable transaldolase isoform X3 [Camelina sativa]
 ref|XP_010493883.1| PREDICTED: probable transaldolase isoform X4 [Camelina sativa]
 ref|XP_010493889.1| PREDICTED: probable transaldolase isoform X5 [Camelina sativa]
 ref|XP_010493894.1| PREDICTED: probable transaldolase isoform X4 [Camelina sativa]
 ref|XP_010493899.1| PREDICTED: probable transaldolase isoform X5 [Camelina sativa]
Length=259

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  456  LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW  635
            +VNVGGDL KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATW
Sbjct  1    MVNVGGDLVKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATW  60

Query  636  QGIEASRLLEAXGIQTHLTFVY  701
            QGIEA+RLLE+ GIQTH+TFVY
Sbjct  61   QGIEAARLLESEGIQTHITFVY  82



>ref|XP_006574169.1| PREDICTED: uncharacterized protein LOC102659644 [Glycine max]
Length=231

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 11/152 (7%)
 Frame = +3

Query  240  TNYSEIVPDTVVFDDFEK------FPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            T++SEIVPDTVVF+DFEK      FPPTAATV+S LLLGI   PDT F++ V+  LAD E
Sbjct  71   TSFSEIVPDTVVFNDFEKHLRCCKFPPTAATVNSLLLLGIYGPPDTIFRNVVEMDLADLE  130

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLK--VHDLLK  575
            CYG+E+ +AR+SCF NKA  +VG D+AKLV G VS EVD RLAYDTH I+ K  + D + 
Sbjct  131  CYGVENPNARLSCFVNKAFADVGSDMAKLVLGCVSIEVDVRLAYDTHAIIRKKDLTDSIV  190

Query  576  LYN-GIEIPPERLLFKIPATWQGIEASRLLEA  668
            L N G+ I    L +K  +T QGI   ++  A
Sbjct  191  LRNIGVGIGHSLLAYK--STLQGIGKLQVFSA  220



>gb|AFW61221.1| hypothetical protein ZEAMMB73_046549 [Zea mays]
Length=266

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  432  MSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERL  611
            MSC+  KAL NVG +LA  VPGRVSTE+DARLAYDT GI+ +VH+LL LYN  ++  +RL
Sbjct  1    MSCYLTKALANVGAELAHQVPGRVSTEIDARLAYDTQGIIHRVHELLNLYNQHDVSTDRL  60

Query  612  LFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LFKIPATWQGIEASRLLE+ GIQTHLTFVY
Sbjct  61   LFKIPATWQGIEASRLLESEGIQTHLTFVY  90



>ref|XP_005651138.1| aldolase [Coccomyxa subellipsoidea C-169]
 gb|EIE26594.1| aldolase [Coccomyxa subellipsoidea C-169]
Length=402

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKF-PPTAATVSSSLLLGICSLPD--TKFKSAVDTALA  392
            TELD + N+S +VPDT++  D EK   P AATVSS++L GI   P    ++K A+  A+ 
Sbjct  50   TELDYLENWSTVVPDTLLLQDIEKIEAPKAATVSSAVLGGILRNPAGLQEYKIAIANAIN  109

Query  393  DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL  572
               C   +   A+++C  +KA VN+G   ++ V GRVSTEVD RLAYDT  I+ +   LL
Sbjct  110  YDVCQA-KTGAAKLACEIDKATVNIGALFSRQVEGRVSTEVDPRLAYDTEAIMTRAQGLL  168

Query  573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            K Y  + I  +R+L ++P T++GI+A++ LEA GIQTH+  VY
Sbjct  169  KNYEEMGISRDRILLRVPGTFEGIQAAKELEAQGIQTHIILVY  211



>gb|KJB20856.1| hypothetical protein B456_003G169200 [Gossypium raimondii]
Length=153

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +3

Query  99   ERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVF  278
            + +L FA  S+  +L F     FPV+RAS+G SSS+DTGL+TELDAV+ +SEIVPDTV+F
Sbjct  19   KSRLGFANGSSSSTLLFKFNRSFPVLRASSGSSSSVDTGLSTELDAVSTFSEIVPDTVIF  78

Query  279  DDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKAL  458
            DDFEKFPPTAATVSSSLLLGI SLPDT F++AVD ALAD  C  L++ + R+SCF NK  
Sbjct  79   DDFEKFPPTAATVSSSLLLGILSLPDTIFRNAVDMALADSTCSPLDNPELRLSCFVNKVR  138

Query  459  VNVGG  473
            + + G
Sbjct  139  IRILG  143



>ref|WP_005647616.1| transaldolase [Haemophilus influenzae]
 gb|EDJ89342.1| transaldolase [Haemophilus influenzae 22.1-21]
Length=210

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_032093096.1| transaldolase [Necropsobacter rosorum]
Length=317

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 102/162 (63%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+   + +V DT   D  +++ P  AT + SL+L   +LP  ++ + +D A+A 
Sbjct  1    MTTQLDALRGMTVVVADTGDIDAIKQYQPQDATTNPSLILSASALP--QYAALIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +    +D+  ++    +K  VN+G ++ K+VPGRVSTEVDARL+YDT   V K   L+K
Sbjct  59   AKTQS-QDRAQQLIDAEDKLAVNIGLEILKIVPGRVSTEVDARLSYDTDATVAKARKLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  ER+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNNAGIANERILIKIASTWQGIRAAEILEQEGINCNLTLLF  159



>ref|WP_032093091.1| transaldolase [Necropsobacter rosorum]
Length=317

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 102/162 (63%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+   + +V DT   D  +++ P  AT + SL+L   +LP  ++ + +D A+A 
Sbjct  1    MTTQLDALRGMTVVVADTGDIDAIKQYQPQDATTNPSLILSASALP--QYAALIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +    +D+  ++    +K  VN+G ++ K+VPGRVSTEVDARL+YDT   V K   L+K
Sbjct  59   AKTQS-QDRAQQLIDAEDKLAVNIGLEILKIVPGRVSTEVDARLSYDTDATVAKARKLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  ER+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNDAGIANERILIKIASTWQGIRAAEILEQEGINCNLTLLF  159



>ref|WP_011608357.1| transaldolase [Histophilus somni]
 sp|Q0I1U0.1|TAL_HISS1 RecName: Full=Transaldolase [Haemophilus somnus 129PT]
 gb|ABI24482.1| transaldolase [Haemophilus somnus 129PT]
Length=317

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+ N + +V DT   D  +K+ P  AT + SL+L   SLP  ++   +D A+A 
Sbjct  1    MTTQLDALRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASSLP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAKSA-DKTQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_012341545.1| transaldolase [Histophilus somni]
 sp|B0UV30.1|TAL_HISS2 RecName: Full=Transaldolase [Haemophilus somnus 2336]
 gb|ACA32385.1| transaldolase [Haemophilus somnus 2336]
Length=317

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+ N + +V DT   D  +K+ P  AT + SL+L   SLP  ++   +D A+A 
Sbjct  1    MTTQLDALRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASSLP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAKS-ADKTQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_042611678.1| transaldolase [Haemophilus influenzae]
 gb|KIP47831.1| transaldolase [Haemophilus influenzae]
Length=317

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D ALA 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEALAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-ADKVQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_012054488.1| transaldolase [Haemophilus influenzae]
 sp|A5UCY0.1|TAL_HAEIE RecName: Full=Transaldolase [Haemophilus influenzae PittEE]
 gb|ABQ98631.1| transaldolase [Haemophilus influenzae PittEE]
Length=317

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005689370.1| transaldolase [Haemophilus influenzae]
 gb|EEP47991.1| transaldolase B [Haemophilus influenzae 6P18H1]
 emb|CBY81278.1| transaldolase [Haemophilus influenzae F3031]
Length=317

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_040976877.1| transaldolase [Pasteurella sp. FF6]
Length=317

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 102/162 (63%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+ + + +V DT   D  +++ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDALRSMTVVVADTGDIDAIKQYRPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +    +DK  ++    +K  VN+G ++ K+VPGRVSTEVDARL+Y+T   V K   L++
Sbjct  59   AKTQS-QDKAQQLIDAEDKLAVNIGLEILKIVPGRVSTEVDARLSYNTEATVAKARKLIR  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  ER+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEASISNERILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005667515.1| transaldolase [Haemophilus influenzae]
 gb|EDK11568.1| transaldolase [Haemophilus influenzae PittII]
 gb|ADO81212.1| Transaldolase B [Haemophilus influenzae R2866]
Length=317

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005693444.1| transaldolase [Haemophilus influenzae]
 ref|NP_439282.1| transaldolase B [Haemophilus influenzae Rd KW20]
 sp|P45055.2|TAL_HAEIN RecName: Full=Transaldolase [Haemophilus influenzae Rd KW20]
 gb|AAC22779.1| transaldolase B (talB) [Haemophilus influenzae Rd KW20]
 gb|EEW77427.1| transaldolase [Haemophilus influenzae RdAW]
Length=317

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005651803.1| transaldolase [Haemophilus influenzae]
 gb|EDJ91928.1| transaldolase [Haemophilus influenzae R3021]
Length=317

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_038440031.1| transaldolase [Haemophilus influenzae]
 gb|AIB46146.1| Transaldolase [Haemophilus influenzae CGSHiCZ412602]
 gb|KIP33810.1| transaldolase [Haemophilus influenzae]
 gb|AJO90294.1| Transaldolase B [Haemophilus influenzae]
Length=317

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIV  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_042602002.1| transaldolase [Haemophilus influenzae]
 gb|KIP32837.1| transaldolase [Haemophilus influenzae]
Length=317

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   SLP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASSLP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     +K  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-NKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005686423.1| transaldolase [Haemophilus influenzae]
 gb|EEP46878.1| transaldolase B [Haemophilus influenzae 7P49H1]
Length=317

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L +  LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSVSELP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQSA-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_021034924.1| transaldolase B [Haemophilus influenzae]
 gb|AGV11613.1| transaldolase B [Haemophilus influenzae KR494]
Length=317

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_011272395.1| transaldolase [Haemophilus influenzae]
 sp|Q4QLG9.1|TAL_HAEI8 RecName: Full=Transaldolase [Haemophilus influenzae 86-028NP]
 gb|AAX88128.1| transaldolase [Haemophilus influenzae 86-028NP]
 gb|ADO96608.1| Transaldolase B [Haemophilus influenzae R2846]
 gb|KIP35563.1| transaldolase [Haemophilus influenzae]
 gb|KIP38329.1| transaldolase [Haemophilus influenzae]
 gb|KIP39330.1| transaldolase [Haemophilus influenzae]
 gb|KIP40307.1| transaldolase [Haemophilus influenzae]
 gb|KIP44918.1| transaldolase [Haemophilus influenzae]
 gb|KIP45651.1| transaldolase [Haemophilus influenzae]
 gb|KIP45935.1| transaldolase [Haemophilus influenzae]
 gb|AJO87647.1| Transaldolase B [Haemophilus influenzae]
 gb|AJO90980.1| Transaldolase B [Haemophilus influenzae]
Length=317

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005690695.1| transaldolase [Haemophilus influenzae]
 gb|EEW78910.1| transaldolase [Haemophilus influenzae NT127]
Length=317

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     +K  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-NKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_012055411.1| transaldolase [Haemophilus influenzae]
 sp|A5UIP9.1|TAL_HAEIG RecName: Full=Transaldolase [Haemophilus influenzae PittGG]
 gb|ABR00655.1| transaldolase [Haemophilus influenzae PittGG]
Length=317

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     +K  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-NKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005670786.1| transaldolase [Haemophilus influenzae]
 gb|EDK13996.1| transaldolase [Haemophilus influenzae 22.4-21]
Length=317

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     +K  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-NKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005662742.1| transaldolase [Haemophilus influenzae]
 gb|EDK10183.1| transaldolase [Haemophilus influenzae PittHH]
 gb|KIP49504.1| transaldolase [Haemophilus influenzae]
 gb|KIS35032.1| Transaldolase B [Haemophilus influenzae]
Length=317

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     +K  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-NKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_011201500.1| transaldolase [[Mannheimia] succiniciproducens]
 sp|Q65PZ8.1|TAL_MANSM RecName: Full=Transaldolase [Mannheimia succiniciproducens MBEL55E]
 gb|AAU38962.1| MipB protein [Mannheimia succiniciproducens MBEL55E]
Length=317

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+  
Sbjct  1    MTTQLDALRNMTVVVADTGDIEAIKKYQPQDATTNPSLILSASALP--QYASLIDDAINY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+K
Sbjct  59   AKAKST-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTAATVEKARKLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K+ +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGINNDRILIKVASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_015702599.1| transaldolase [Pasteurella multocida]
 gb|AET16728.1| transaldolase A [Pasteurella multocida 36950]
 gb|ESQ72441.1| transaldolase [Pasteurella multocida subsp. multocida P1062]
 gb|AHE65246.1| transaldolase [Pasteurella multocida subsp. multocida str. HB03]
 gb|AIN49523.1| transaldolase [Pasteurella multocida]
Length=317

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYNG  I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNGAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_015702071.1| transaldolase [Haemophilus influenzae]
 emb|CBW29471.1| transaldolase B [Haemophilus influenzae 10810]
Length=317

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+  
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVGY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQSA-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_006996542.1| MULTISPECIES: transaldolase [Haemophilus]
 emb|CBY87456.1| transaldolase [Haemophilus influenzae F3047]
 gb|EGF13070.1| transaldolase A [Haemophilus aegyptius ATCC 11116]
Length=317

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQG  A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGTRAAEILEKEGINCNLTLLF  159



>ref|WP_040034674.1| transaldolase [Haemophilus influenzae]
 gb|KIG22936.1| transaldolase [Haemophilus influenzae 60294N1]
Length=317

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-ADKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_012440450.1| transaldolase [Erwinia tasmaniensis]
 emb|CAO95748.1| Transaldolase B [Erwinia tasmaniensis Et1/99]
Length=317

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   + +V DT      E++ P  AT + SL+L    +P+  ++  +D ++A 
Sbjct  1    MTDKLSSLRQVTTVVADTGDIAAMERYKPQDATTNPSLILSAAQIPE--YRKLIDASIAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      DKD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K   
Sbjct  59   ARDQSS----DKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKARS  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_005697398.1| transaldolase [Haemophilus parainfluenzae]
 gb|EIF41033.1| transaldolase [Haemophilus parainfluenzae HK262]
Length=317

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ + + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRSMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-ADKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_014064668.1| transaldolase [Haemophilus parainfluenzae]
 emb|CBW14927.1| transaldolase B [Haemophilus parainfluenzae T3T1]
Length=317

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ + + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRSMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-ADKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005661288.1| transaldolase [Haemophilus influenzae]
 gb|EDK07144.1| transaldolase [Haemophilus influenzae PittAA]
Length=317

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L    LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASELP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQSA-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_032107818.1| transaldolase, partial [Haemophilus sp. FF7]
Length=267

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+ + + +V DT   D  +++ P  AT + SL+L   +LP  ++   +D A+  
Sbjct  1    MTTQLDALRSMTVVVADTGDIDAIKQYRPQDATTNPSLILSASALP--QYAPLIDEAIKY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +    +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L++
Sbjct  59   AKTQS-QDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATVAKARKLIR  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_007242430.1| transaldolase [Haemophilus pittmaniae]
 gb|EGV06123.1| transaldolase [Haemophilus pittmaniae HK 85]
Length=317

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+ + + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDALRSMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-ADKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGIANDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005700118.1| transaldolase [Haemophilus parainfluenzae]
 gb|EIJ28600.1| transaldolase [Haemophilus parainfluenzae HK2019]
Length=317

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ + + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRSMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-ADKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_038441373.1| transaldolase [Haemophilus influenzae]
 gb|AIT68221.1| transaldolase [Haemophilus influenzae]
Length=317

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVD RL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDVRLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_032824638.1| transaldolase [Haemophilus influenzae]
 gb|KAI97206.1| transaldolase [Haemophilus influenzae]
 gb|KAI99157.1| transaldolase [Haemophilus influenzae]
 gb|KAJ00880.1| transaldolase [Haemophilus influenzae]
Length=317

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     +K  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQSA-NKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005704791.1| transaldolase [Aggregatibacter aphrophilus]
 gb|EGY30225.1| transaldolase B [Aggregatibacter aphrophilus ATCC 33389]
Length=317

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L+++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTNQLNSLRQLTVVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYASLIDEAIA-  57

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT+  V+K   
Sbjct  58   ---YGKQQSQDKAQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTNATVVKARK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI ATWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIAATWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005702343.1| transaldolase [Aggregatibacter aphrophilus]
 gb|ACS98255.1| transaldolase [Aggregatibacter aphrophilus NJ8700]
 gb|EHB89239.1| transaldolase [Aggregatibacter aphrophilus F0387]
Length=317

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L+++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTNQLNSLRQLTVVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYASLIDEAIA-  57

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT+  V+K   
Sbjct  58   ---YGKQQSQDKAQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTNATVVKARK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI ATWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIAATWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005636292.1| transaldolase [Haemophilus haemolyticus]
 gb|EGT81986.1| Transaldolase [Haemophilus haemolyticus M21621]
Length=317

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++   + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRQMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005626807.1| transaldolase [Haemophilus haemolyticus]
 gb|EGT74157.1| Transaldolase [Haemophilus haemolyticus M19501]
 gb|EGT80270.1| Transaldolase [Haemophilus haemolyticus M19107]
 gb|EIJ74695.1| transaldolase [Haemophilus haemolyticus HK386]
Length=317

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++   + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRQMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005643167.1| transaldolase [Haemophilus haemolyticus]
 gb|EGT79716.1| Transaldolase [Haemophilus haemolyticus M21639]
Length=317

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++   + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRQMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005694697.1| transaldolase [Haemophilus parainfluenzae]
 gb|EGC73325.1| transaldolase [Haemophilus parainfluenzae ATCC 33392]
 gb|KFM00175.1| transaldolase [Haemophilus parainfluenzae ATCC 33392]
Length=317

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ + + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+  
Sbjct  1    MTTQLDSLRSMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAITY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKAQS-ADKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005657273.1| transaldolase [Haemophilus influenzae]
 gb|EDJ92949.1| transaldolase [Haemophilus influenzae 3655]
Length=317

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++   + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRQMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQSTVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>gb|EJS86902.1| transaldolase B [Pasteurella multocida subsp. multocida str. 
Anand1_buffalo]
Length=317

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTSDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_005718405.1| transaldolase [Pasteurella multocida]
 gb|EGP04541.1| transaldolase B [Pasteurella multocida subsp. gallicida str. 
Anand1_poultry]
Length=317

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_005752148.1| transaldolase [Pasteurella multocida]
 gb|EJS83985.1| transaldolase B [Pasteurella multocida subsp. multocida str. 
P52VAC]
 gb|ERL41045.1| transaldolase B [Pasteurella multocida subsp. multocida str. 
PMTB]
 gb|KEP93520.1| transaldolase [Pasteurella multocida subsp. multocida VTCCBAA264]
 gb|KEZ08998.1| transaldolase [Pasteurella multocida]
 gb|KEZ09064.1| transaldolase [Pasteurella multocida]
Length=317

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_005757802.1| transaldolase [Pasteurella multocida]
 gb|EJZ77973.1| Transaldolase [Pasteurella multocida subsp. gallicida P1059]
Length=317

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_010907246.1| transaldolase [Pasteurella multocida]
 sp|Q9CKL0.1|TALA_PASMU RecName: Full=Transaldolase A [Pasteurella multocida subsp. multocida 
str. Pm70]
 gb|AAK03686.1| Tal [Pasteurella multocida subsp. multocida str. Pm70]
 gb|AFF25095.1| transaldolase B [Pasteurella multocida subsp. multocida str. 
HN06]
 gb|AFI47040.1| transaldolase [Pasteurella multocida subsp. multocida str. 3480]
 gb|EPE71171.1| transaldolase B [Pasteurella multocida 671/90]
Length=317

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_005724444.1| transaldolase [Pasteurella multocida]
 gb|EGP03847.1| transaldolase B [Pasteurella multocida subsp. multocida str. 
Anand1_goat]
Length=317

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_005755204.1| transaldolase [Pasteurella multocida]
 gb|EJZ77744.1| Transaldolase [Pasteurella multocida subsp. gallicida X73]
Length=317

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>ref|WP_014167508.1| transaldolase [Aggregatibacter actinomycetemcomitans]
 gb|AEW76602.1| transaldolase B [Aggregatibacter actinomycetemcomitans ANH9381]
Length=317

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTTVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAI--  56

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKQKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTQATVAKARK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005635758.1| transaldolase [Haemophilus haemolyticus]
 gb|EGT75059.1| Transaldolase [Haemophilus haemolyticus M21127]
Length=317

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++   + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+  
Sbjct  1    MTTQLDSLRQMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAIVY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>gb|KIY99632.1| transaldolase [Monoraphidium neglectum]
Length=374

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = +3

Query  219  TTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICS---LPDTKFKSAVDTAL  389
              EL A++  S +VPDT++ +   +    AATVS+ +L G+ +   L    F +A++ +L
Sbjct  22   ANELQALSRLSSVVPDTLLLETPVQL--KAATVSAQVLKGVLASGQLGLKPFMNAIENSL  79

Query  390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
               +C  L+  + R SC  +KAL NVG  LA+ V GRV+TE+D RLA+D   +V +   +
Sbjct  80   TYDKCLQLQGAE-RASCQLDKALANVGSMLAQQVEGRVATELDPRLAHDKDALVARARGI  138

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L LY  + +PP +L+F++PATW GI+A+  LEA G  T +  +Y
Sbjct  139  LALYQEMGVPPSKLIFRVPATWAGIQAAAALEAEGTATQVFHIY  182



>ref|WP_032998029.1| transaldolase [Aggregatibacter segnis]
Length=317

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+A 
Sbjct  1    MTNQLDSLRELTVVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAIA-  57

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  58   ---YGKQQSQDKAQQLVDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTEATVAKARK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>gb|EFU66896.1| transaldolase A [Aggregatibacter segnis ATCC 33393]
Length=339

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+A 
Sbjct  23   MTNQLDSLRELTVVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAIA-  79

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  80   ---YGKQQSQDKAQQLVDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTEATVAKARK  136

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  137  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  181



>ref|WP_009500796.1| transaldolase [Haemophilus sp. oral taxon 851]
 gb|EHO46295.1| transaldolase [Haemophilus sp. oral taxon 851 str. F0397]
Length=317

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++   + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDSLRQMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAETLEKEGINCNLTLLF  159



>ref|WP_005571405.1| transaldolase [Aggregatibacter actinomycetemcomitans]
 gb|EGY49710.1| transaldolase [Aggregatibacter actinomycetemcomitans serotype 
b str. I23C]
 gb|AHN71893.1| transaldolase, putative [Aggregatibacter actinomycetemcomitans 
HK1651]
Length=317

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTTVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAI--  56

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKQKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTQATVAKARK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005555763.1| transaldolase [Aggregatibacter actinomycetemcomitans]
 gb|EGY35095.1| transaldolase [Aggregatibacter actinomycetemcomitans serotype 
e str. SC1083]
Length=317

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTSVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYATLIDEAI--  56

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKQKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTEATVAKARK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_042890069.1| transaldolase [Aggregatibacter actinomycetemcomitans]
Length=317

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTTVVADTGDIDAMRQYKPEDATTNPSLILSAAALP--QYAALIDEAI--  56

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKQKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTQATVAKAKK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_021616992.1| transaldolase [Aggregatibacter sp. oral taxon 458]
 gb|ERH26072.1| transaldolase [Aggregatibacter sp. oral taxon 458 str. W10330]
Length=317

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD +   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+A 
Sbjct  1    MTNQLDTLRELTVVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAIA-  57

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  58   ---YGKQQSQDKAQQLVDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTEATVAKARK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_004580540.1| transaldolase B [Marinobacter nanhaiticus]
 gb|ENO16254.1| transaldolase B [Marinobacter nanhaiticus D15-8W]
Length=316

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 99/160 (62%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            T+LDA+ ++S +V DT   +   ++ P  AT + SL+L    LP    +S +D  LA+ +
Sbjct  2    TQLDALKSHSLVVADTGDVNAIRRYQPHDATTNPSLILKAFDLP--SHQSLIDETLAEVK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
               ++D DAR+    ++  V +G ++A L+PGRVSTEV ARL++DT   + K HDL+ LY
Sbjct  60   -REVDDSDARVEQAVDRLSVAIGSEIAGLIPGRVSTEVAARLSFDTEASIRKAHDLISLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
                I  ER+L K+ +TW+GI A+  LE  GIQ +LT ++
Sbjct  119  EQRGIGAERVLIKLASTWEGIRAAEQLEKEGIQCNLTLLF  158



>ref|WP_005544407.1| transaldolase [Aggregatibacter actinomycetemcomitans]
 ref|YP_003254897.1| transaldolase B [Aggregatibacter actinomycetemcomitans D11S-1]
 gb|ACX81678.1| transaldolase [Aggregatibacter actinomycetemcomitans D11S-1]
 gb|EGY46219.1| transaldolase [Aggregatibacter actinomycetemcomitans serotype 
c str. SCC2302]
 gb|EGY69351.1| hypothetical protein D17P3_2473 [Aggregatibacter actinomycetemcomitans 
D17P-3]
 gb|ELT51389.1| transaldolase [Aggregatibacter actinomycetemcomitans serotype 
c str. AAS4A]
Length=317

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTTVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAI--  56

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKQKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTQATVAKAKK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_041160763.1| transaldolase [Aggregatibacter actinomycetemcomitans]
Length=317

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTTVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAI--  56

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKQKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTQATVTKAKK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_039708898.1| transaldolase [Actinobacillus pleuropneumoniae]
 gb|KIE87921.1| putative Transaldolase [Actinobacillus pleuropneumoniae]
 gb|KIE88118.1| putative Transaldolase [Actinobacillus pleuropneumoniae]
 gb|KIE93928.1| putative Transaldolase [Actinobacillus pleuropneumoniae]
 gb|KIE94181.1| putative Transaldolase [Actinobacillus pleuropneumoniae]
 gb|KIF00141.1| putative Transaldolase [Actinobacillus pleuropneumoniae]
 gb|KIF00330.1| putative Transaldolase [Actinobacillus pleuropneumoniae]
Length=315

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   AKS-DDKSQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_012262678.1| transaldolase [Actinobacillus pleuropneumoniae]
 sp|B0BRM0.1|TAL_ACTPJ RecName: Full=Transaldolase [Actinobacillus pleuropneumoniae 
serovar 3 str. JL03]
 gb|ABY68668.1| transaldolase [Actinobacillus pleuropneumoniae serovar 3 str. 
JL03]
Length=315

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILNASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   AKS-DDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_028831304.1| transaldolase [Proteobacteria bacterium JGI 0000113-E04]
Length=333

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 100/163 (61%), Gaps = 2/163 (1%)
 Frame = +3

Query  213  GLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA  392
            G +T+ DA+   + IV DT  F   +K+ PT AT + SL+     +P+  + + VD A+A
Sbjct  9    GGSTQYDALEKVTTIVADTGDFKQIKKYAPTDATTNPSLIFKASQIPE--YSALVDEAVA  66

Query  393  DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL  572
              + +G  D+   ++   +K  V  G ++ K++PG VSTEVDARL++DT G V +   ++
Sbjct  67   YGKQHGGGDQGETLALILDKLSVAFGTEITKIIPGYVSTEVDARLSFDTEGSVSRARRII  126

Query  573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            K+Y    +P ER+L K+  TW+GI+A+++L+  G+  ++T ++
Sbjct  127  KMYEANGVPKERVLIKLATTWEGIQAAKILKKEGVSCNMTLLF  169



>ref|WP_005594644.1| transaldolase [Aggregatibacter actinomycetemcomitans]
 gb|EKX94642.1| transaldolase [Aggregatibacter actinomycetemcomitans Y4]
Length=317

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTTVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAI--  56

Query  396  QECYGL---EDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG    +DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKPKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYDTQATVTKAKK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005600018.1| transaldolase [Actinobacillus pleuropneumoniae]
 gb|EFL79499.1| transaldolase B [Actinobacillus pleuropneumoniae serovar 2 str. 
4226]
 gb|EFM88639.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 2 str. 
S1536]
Length=315

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   AKS-DDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_005616549.1| transaldolase [Actinobacillus pleuropneumoniae]
 sp|B3GZQ2.1|TAL_ACTP7 RecName: Full=Transaldolase [Actinobacillus pleuropneumoniae 
serovar 7 str. AP76]
 gb|ACE60714.1| transaldolase [Actinobacillus pleuropneumoniae serovar 7 str. 
AP76]
 gb|EFN03781.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 13 str. 
N273]
Length=315

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   ARS-DDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTKATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_005611143.1| transaldolase [Actinobacillus pleuropneumoniae]
 gb|EFM97399.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 10 str. 
D13039]
Length=315

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   ARS-DDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTKATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_005595691.1| transaldolase [Actinobacillus pleuropneumoniae]
 gb|EFL80687.1| transaldolase B [Actinobacillus pleuropneumoniae serovar 6 str. 
Femo]
 gb|EFM86514.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 1 str. 
4074]
 gb|EFM93053.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 6 str. 
Femo]
 gb|EFM95241.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 9 str. 
CVJ13261]
 gb|EFM99578.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 11 str. 
56153]
 gb|EFN01609.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 12 str. 
1096]
Length=315

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   ARS-DDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTKATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_014992075.1| MULTISPECIES: transaldolase [Actinobacillus]
 gb|AFU19511.1| transaldolase B [Actinobacillus suis H91-0380]
 gb|AIJ31649.1| transaldolase B [Actinobacillus suis ATCC 33415]
 gb|AIZ79551.1| transaldolase [Actinobacillus equuli subsp. equuli]
Length=315

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   AKS-DDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_034787030.1| transaldolase [Ewingella americana]
 gb|KFC85739.1| transaldolase [Ewingella americana ATCC 33852]
Length=317

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   +++V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRQLTKVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      D+D +++   +K  VN+G ++ KLVPGR+STEVDARL+YDT   V K H 
Sbjct  59   AKDQSS----DRDQQVADAADKLAVNIGLEILKLVPGRISTEVDARLSYDTEASVAKAHR  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAERLEKEGINCNLTLLF  159



>ref|WP_044024249.1| transaldolase [Actinobacillus ureae]
Length=315

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   AKS-DDKAQQLIDVEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   +  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGVSNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_006986706.1| transaldolase [Cardiobacterium valvarum]
 gb|EHM50923.1| transaldolase [Cardiobacterium valvarum F0432]
Length=316

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
             +LD +   + IV DT   +   K+ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    NQLDTLKGMTTIVADTGDIEAIRKYQPQDATTNPSLILSAAALP--QYASLIDEAVAYGK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
             +G  D+ +++S   +K  VN+G ++ K+VPGRVSTEVDARL+YD    + K   ++  Y
Sbjct  60   AHG-HDRASQISEAEDKLAVNIGLEILKIVPGRVSTEVDARLSYDRDATIAKARKIIAHY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NAAGIKNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  158



>ref|WP_005603232.1| transaldolase [Actinobacillus pleuropneumoniae]
 gb|EFM90766.1| Transaldolase [Actinobacillus pleuropneumoniae serovar 4 str. 
M62]
Length=315

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   AKS-DDKALQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_018357226.1| transaldolase [Pasteurella pneumotropica]
Length=317

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LD++ + + +V DT   +  +K+ P  AT + SL+L   +LP  ++   +D A++ 
Sbjct  1    MTTQLDSLRSMTVVVADTGDIEAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVSY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+Y+T   V K   L+ 
Sbjct  59   AKAQS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYNTQATVEKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>gb|EFA77817.1| transaldolase [Polysphondylium pallidum PN500]
Length=320

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            ++  L+ +  ++ IV DT  F    KF    +T + SL+    S P  ++K  +D A+A 
Sbjct  1    MSDALEKLREFTVIVADTADFAVLSKFNSQDSTTNPSLVYQAASKP--QYKHLIDDAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK AR++   +K  VN G ++ K+VPGRVSTEVDARL+YDT G + K  +L+K
Sbjct  59   AK-KNASDKKARLTLAMDKLFVNFGLEILKIVPGRVSTEVDARLSYDTEGNIKKARELIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY    +  +R+L K+ +TW+GI+A+R+LE  GI  ++T ++
Sbjct  118  LYEDAGVKRDRVLIKLASTWEGIQAARVLEKEGIHCNMTLLF  159



>ref|WP_017806641.1| transaldolase [Avibacterium paragallinarum]
 emb|CDG00162.1| Putative Transaldolase [Avibacterium paragallinarum JF4211]
Length=317

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+   + +V DT   +  + + P  AT + SL+L   +LP  ++   +D A+A 
Sbjct  1    MTTQLDALREMTVVVADTGDIEAIKTYQPQDATTNPSLILSASALP--QYAPLIDEAIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  59   AKTKS-NDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARQLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   +  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGVSNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_005564349.1| transaldolase [Aggregatibacter actinomycetemcomitans]
 gb|EGY43255.1| transaldolase [Aggregatibacter actinomycetemcomitans serotype 
f str. D18P1]
Length=317

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LD++   + +V DT   D   ++ P  AT + SL+L   +LP  ++ + +D A+  
Sbjct  1    MTNQLDSLRELTIVVADTGDIDAIRQYKPEDATTNPSLILSAAALP--QYAALIDEAI--  56

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               YG +   DK  ++    +K  VN+G ++ KLVPGRVSTEVDARL+YDT   V K   
Sbjct  57   --TYGKQKSQDKSQQLIDAEDKLAVNIGLEVLKLVPGRVSTEVDARLSYDTQATVAKAKK  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+ LY    I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  LIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_017345614.1| transaldolase [Pantoea sp. A4]
Length=317

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 99/163 (61%), Gaps = 5/163 (3%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRQLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAKIPE--YRKLIDEAIAW  58

Query  393  DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL  572
             +E  G   K+  +S   +K  VN+G ++ KL+PGR+STEVDARL+YDT G + K H L+
Sbjct  59   AREQNG--RKEDLLSLISDKLAVNIGLEILKLIPGRISTEVDARLSYDTEGSIAKAHSLI  116

Query  573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  117  KLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_023091623.1| transaldolase [Pseudomonas aeruginosa]
 gb|ERY00318.1| transaldolase [Pseudomonas aeruginosa BL25]
 gb|ETD56245.1| transaldolase [Pseudomonas aeruginosa VRFPA07]
 gb|EZP20364.1| transaldolase [Pseudomonas aeruginosa BWH050]
Length=307

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 99/162 (61%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A AD
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAD  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>gb|EFX92188.1| transaldolase [Actinobacillus ureae ATCC 25976]
Length=330

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  17   SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  74

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  75   AKS-DDKAQQLIDVEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATIEKARQIMKLY  133

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   +  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  134  NEAGVSNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  173



>ref|WP_025901184.1| MULTISPECIES: transaldolase [Tatumella]
 gb|KFD20595.1| transaldolase [Tatumella ptyseos ATCC 33301]
Length=317

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L ++   + +V DT   +  + + P  AT + SL+L    +P+  ++  +D A+ D
Sbjct  1    MTDKLSSLRKITTVVADTGDIEAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAI-D  57

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                   DK+ +++   +K  VN+G ++ KL+PGR+STEVDARL+YDT   + K H L+K
Sbjct  58   WARKQSNDKEQQIAFASDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASIAKAHSLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_012072337.1| transaldolase [Actinobacillus succinogenes]
 sp|A6VLW0.1|TAL_ACTSZ RecName: Full=Transaldolase [Actinobacillus succinogenes 130Z]
 gb|ABR73957.1| transaldolase [Actinobacillus succinogenes 130Z]
Length=317

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+LDA+   + +V DT   +  + + P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDALKQMTVVVADTGDIEAMKLYKPQDATTNPSLILSASALP--QYVSLIDDAVAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +K  VN+G ++ KLVPGR+STEVDARL+YD  G + K   ++ 
Sbjct  59   AKAKS-SDKAQQLIDAEDKLAVNIGLEILKLVPGRISTEVDARLSYDIQGTIEKARKIIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   +  +R+L K+ +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGVANDRILIKVASTWQGIRAAEVLEKEGINCNLTLLF  159



>ref|WP_029684573.1| transaldolase [Tatumella saanichensis]
Length=317

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 97/162 (60%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+ D
Sbjct  1    MTDKLTSLRKITTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAI-D  57

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                   DKD +++   +K  VN+G ++ KL+PGR+STEVDARL+YDT   + K H L+K
Sbjct  58   WARQQSNDKDEQIAHASDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASIAKAHSLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_004173248.1| transaldolase B [Erwinia amylovora]
 emb|CCP08292.1| transaldolase B [Erwinia amylovora MR1]
Length=322

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL  389
            T +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++
Sbjct  4    TFMTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASV  61

Query  390  A---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV  560
            A   DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K 
Sbjct  62   AWARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKA  117

Query  561  HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
              L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  RSLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  164



>ref|XP_004528663.1| PREDICTED: transaldolase B-like [Ceratitis capitata]
Length=317

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++  Y+ +V DT      + + P  AT + SL+LG   +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRQYTTVVADTGDIAAMKLYKPQDATTNPSLILGAAQIPE--YRKLIDEAIAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      D++ ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT   V K   
Sbjct  59   AKDQSS----DREQQVVDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASVAKAKR  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_018650945.1| transaldolase [Actinobacillus capsulatus]
Length=315

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 99/160 (62%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT     K   ++KLY
Sbjct  60   AKS-DDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATTEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_043086091.1| transaldolase [Pluralibacter gergoviae]
 gb|AIR02949.1| transaldolase [Pluralibacter gergoviae]
Length=317

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++  Y+ +V DT      + + P  AT + SL+LG   +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRQYTTVVADTGDIAAMKLYKPQDATTNPSLILGAAQIPE--YRKLIDEAIAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      D++ ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT   V K   
Sbjct  59   AKDQSS----DREQQVVDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASVAKAKR  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>emb|CCP04221.1| transaldolase B [Erwinia amylovora Ea644]
Length=322

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL  389
            T +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++
Sbjct  4    TFMTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASV  61

Query  390  A---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV  560
            A   DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K 
Sbjct  62   AWARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKA  117

Query  561  HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
              L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  RSLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  164



>ref|WP_011848304.1| transaldolase [Actinobacillus pleuropneumoniae]
 sp|A3MYD4.1|TAL_ACTP2 RecName: Full=Transaldolase [Actinobacillus pleuropneumoniae 
serovar 5b str. L20]
 gb|ABN73170.1| transaldolase [Actinobacillus pleuropneumoniae serovar 5b str. 
L20]
Length=315

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 99/160 (62%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   +  +++ P  AT + SL+L   +LP  ++ S +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYASLIDDAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                +DK   +    +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K   ++KLY
Sbjct  60   ARS-DDKAQLLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTKATIEKARQIMKLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|WP_005763792.1| transaldolase [Pasteurella dagmatis]
 gb|EEX50577.1| transaldolase [Pasteurella dagmatis ATCC 43325]
Length=317

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 100/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+LD++ + + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct  1    MTTQLDSLRHMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY  58

Query  393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH  563
                 +C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct  59   AKSKSDCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTAATIEKAK  113

Query  564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             L+ LYN   I  +R+L KI +TWQGI A+  LE  GI  +LT ++
Sbjct  114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLF  159



>emb|CBA22729.1| transaldolase B [Erwinia amylovora CFBP1430]
 emb|CBX81834.1| transaldolase B [Erwinia amylovora ATCC BAA-2158]
 gb|EKV52963.1| transaldolase B [Erwinia amylovora ACW56400]
 emb|CCO79817.1| transaldolase B [Erwinia amylovora Ea356]
 emb|CCO83621.1| transaldolase B [Erwinia amylovora Ea266]
 emb|CCO87379.1| transaldolase B [Erwinia amylovora CFBP 2585]
 emb|CCO91177.1| transaldolase B [Erwinia amylovora 01SFR-BO]
 emb|CCO94961.1| transaldolase B [Erwinia amylovora CFBP 1232]
 emb|CCP00289.1| transaldolase B [Erwinia amylovora UPN527]
Length=322

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL  389
            T +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++
Sbjct  4    TFMTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASV  61

Query  390  A---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV  560
            A   DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K 
Sbjct  62   AWARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKA  117

Query  561  HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
              L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  RSLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  164



>gb|ERL83343.1| hypothetical protein D910_00243 [Dendroctonus ponderosae]
Length=322

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   +++V DT      + + P  AT + SL+L   S+P+  ++  +D A+A 
Sbjct  6    MTDKLSSLRELTKVVADTGDIAAIKLYQPQDATTNPSLILNAASIPE--YRKLIDEAIAW  63

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      D+D +++   +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K H 
Sbjct  64   ARDQSG----DRDQQIADAADKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAHR  119

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             +KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  120  FIKLYNDHGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  164



>ref|WP_009634748.1| transaldolase [Serratia sp. M24T3]
 gb|EIC86552.1| transaldolase B [Serratia sp. M24T3]
Length=317

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   +++V DT      + + P  AT + SL+L   S+P+  ++  +D A+A 
Sbjct  1    MTDKLSSLRELTKVVADTGDIAAIKLYQPQDATTNPSLILNAASIPE--YRKLIDEAIAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      D+D +++   +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K H 
Sbjct  59   ARDQSG----DRDQQIADAADKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAHR  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             +KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  FIKLYNDHGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>emb|CAY73102.1| transaldolase B [Erwinia pyrifoliae DSM 12163]
Length=322

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL  389
            T +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++
Sbjct  4    TFMTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASV  61

Query  390  A---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV  560
            A   DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K 
Sbjct  62   AWARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKA  117

Query  561  HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
              L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  RSLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  164



>ref|WP_024496084.1| transaldolase [Candidatus Schmidhempelia bombi]
 ref|XP_003492874.1| PREDICTED: transaldolase 1-like [Bombus impatiens]
Length=316

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 96/160 (60%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LD +  Y+ +V DT   D  ++F P  AT + SL+L    LP  ++K  +D A+   +
Sbjct  2    SQLDELKKYTVVVADTGDIDSIKQFSPEDATTNPSLVLKAAQLP--QYKYLIDEAINTAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
              G  DK+ ++    ++  VN+G ++ K VPGR+STEVDARL++D    V K   L++LY
Sbjct  60   AQG-GDKETQLLNASDQVAVNIGAEILKYVPGRISTEVDARLSFDRGLCVAKARKLIRLY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
                I   R+L KI ATW+GI+A+R LE  GI  +LT ++
Sbjct  119  KEKGIDKSRILIKIAATWEGIQAARELEQEGINCNLTLLF  158



>ref|WP_033477301.1| transaldolase [Erwinia amylovora]
Length=317

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++A 
Sbjct  1    MTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASVAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K   
Sbjct  59   ARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKARS  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_013035857.1| transaldolase [Erwinia amylovora]
 emb|CBJ45321.1| transaldolase B [Erwinia amylovora ATCC 49946]
 emb|CDK16311.1| transaldolase B [Erwinia amylovora LA635]
 emb|CDK19677.1| transaldolase B [Erwinia amylovora LA636]
 emb|CDK23049.1| transaldolase B [Erwinia amylovora LA637]
 dbj|GAJ89043.1| transaldolase B [Erwinia amylovora NBRC 12687]
Length=317

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++A 
Sbjct  1    MTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASVAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K   
Sbjct  59   ARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKARS  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|XP_005097705.1| PREDICTED: transaldolase-like isoform X1 [Aplysia californica]
Length=329

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +3

Query  228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY  407
            LD +   + +V DT  F+  ++F PT AT + SL+    ++P   ++  +D A++  +  
Sbjct  12   LDQLKEITTVVADTGDFEAMKQFKPTDATTNPSLIFAAANMP--AYQKLIDEAVSYAKKL  69

Query  408  GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNG  587
            G ++ +  +S   +K  VN G ++ K++PGRVSTEVDARL++DT  +V K   L+KLY  
Sbjct  70   GGKEPEV-LSNAMDKVCVNFGAEILKIIPGRVSTEVDARLSFDTEAMVQKAQTLIKLYKD  128

Query  588  IEIPPERLLFKIPATWQGIEASRLLEAX-GIQTHLTFVY  701
              I  ER+L K+ +TW+G++A+R+LE+  GI  ++T ++
Sbjct  129  AGIEKERILIKLASTWEGVQAARILESQFGIHCNMTLIF  167



>ref|WP_023656116.1| transaldolase B [Erwinia piriflorinigrans]
 emb|CCG88347.1| transaldolase B [Erwinia piriflorinigrans CFBP 5888]
Length=343

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL  389
            T +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++
Sbjct  25   TTMTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASV  82

Query  390  A---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV  560
            A   DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K 
Sbjct  83   AWARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKA  138

Query  561  HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
              L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  139  RSLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  185



>ref|WP_012667047.1| transaldolase [Erwinia pyrifoliae]
 emb|CAX54469.1| Transaldolase B [Erwinia pyrifoliae Ep1/96]
Length=317

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++A 
Sbjct  1    MTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASVAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K   
Sbjct  59   ARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKARS  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_014542223.1| transaldolase [Erwinia sp. Ejp617]
 gb|ADP10085.1| transaldolase B [Erwinia sp. Ejp617]
Length=317

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D ++A 
Sbjct  1    MTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPE--YRKLIDASVAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      +KD ++S   ++  VN+G ++ KLVPGR+STEVDARL+YDT G + K   
Sbjct  59   ARDQSS----NKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKARS  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_044696429.1| transaldolase, partial [Escherichia coli]
Length=172

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 96/162 (59%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L ++  Y+ +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDAVAW  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     D+  ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   L+K
Sbjct  59   AKQQS-NDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_017493003.1| transaldolase [gamma proteobacterium WG36]
Length=317

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   +++V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRELTKVVADTGDIAAIKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIAW  58

Query  393  --DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
              DQ      D+D ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K H 
Sbjct  59   ARDQSS----DRDQQIIDTADKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAHR  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_013445814.1| transaldolase [Paludibacter propionicigenes]
 gb|ADQ80445.1| transaldolase [Paludibacter propionicigenes WB4]
Length=318

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 96/158 (61%), Gaps = 3/158 (2%)
 Frame = +3

Query  228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY  407
            L+ +  ++++V DT  F   + + P  AT + SL+    +  DT++ S +D A+   +  
Sbjct  4    LEQIKKHTKVVADTGDFTSIQVYKPVDATTNPSLIYA--AAMDTQYSSLIDDAIQYAKSA  61

Query  408  GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNG  587
               DK  +++   +K  VN G  + ++VPGRVSTEVDARL++DT   V K H+L+KLY  
Sbjct  62   ST-DKQKQLNVALDKLAVNFGLKILEIVPGRVSTEVDARLSFDTEATVSKAHELIKLYEA  120

Query  588  IEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             +I  ER+L KI +TW+GI+A+  LE  GI  +LT ++
Sbjct  121  NDISKERVLIKIASTWEGIQAAEQLEKEGIHCNLTLLF  158



>ref|WP_019616015.1| transaldolase [Psychromonas ossibalaenae]
Length=316

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 99/164 (60%), Gaps = 7/164 (4%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTK--FKSAVDTAL  389
            +T++LD +   + +V DT   +  +K+ P  AT + SL+L    + D      S+++ A 
Sbjct  1    MTSKLDELRKLTTVVADTGDIEAIQKYTPEDATTNPSLILKAAQIADYAPLIDSSIEYAK  60

Query  390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
            A  +C   + +D   +C  +   VN+G ++ K+VPGR+STEVDARL+YDT   ++K   L
Sbjct  61   AQSDCAQQQVQD---TC--DMLAVNIGKEILKIVPGRISTEVDARLSYDTEASLVKARQL  115

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +K+YN   I  +R+L K+ +TWQGI A+ +LE  GI  +LT ++
Sbjct  116  MKMYNDAGIANDRILIKLASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|XP_002595826.1| hypothetical protein BRAFLDRAFT_115715 [Branchiostoma floridae]
 gb|EEN51838.1| hypothetical protein BRAFLDRAFT_115715 [Branchiostoma floridae]
Length=339

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 101/173 (58%), Gaps = 10/173 (6%)
 Frame = +3

Query  195  SSSLDTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSA  374
            SS     + T LD + +++ +V DT  FD   ++ P  AT + SLLL    +P  +++S 
Sbjct  4    SSPKKQKMATTLDHLKDFTTVVADTGDFDAIGQYKPQDATTNPSLLLAAADMP--QYQSI  61

Query  375  VDTALADQECYGLEDK---DARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHG  545
            VD A+     YGL++    D +++   +K  VN G ++ K++PGRVSTEVDARL+YD  G
Sbjct  62   VDDAIQ----YGLKNGKTVDDQLTEAMDKLFVNFGVEILKIIPGRVSTEVDARLSYDVEG  117

Query  546  IVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAX-GIQTHLTFVY  701
             + K    + LY    I  ER+L K+ +TW+GI+A   LEA  GI  ++T ++
Sbjct  118  SIAKARKFIDLYEKAGISKERILIKLSSTWEGIKAGEQLEAEHGIHCNMTLLF  170



>ref|WP_027071547.1| transaldolase [Luteimonas sp. J29]
Length=315

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            + ++L+ + + S +V DT   +   +F P  AT + SLLL   SLP   + + +D A+A 
Sbjct  1    MPSQLEQLRSLSTVVADTGDIEAIARFKPMDATTNPSLLLKAASLP--AYAAYLDQAVAA  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                G    +AR++   ++  V +GG++ KL+PGRVSTEVDARL++DT   V K H L++
Sbjct  59   ATGSG----EARVADACDRLAVAIGGEILKLIPGRVSTEVDARLSFDTEATVAKAHRLVE  114

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  +RLL KI +TW+GI A+  LE  GI  +LT ++
Sbjct  115  LYDQAGIGRDRLLIKIASTWEGIRAAERLERDGIHCNLTLLF  156



>ref|WP_011768519.1| transaldolase [Psychromonas ingrahamii]
 gb|ABM01960.1| transaldolase [Psychromonas ingrahamii 37]
Length=316

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            ++ +LD +  ++ +V DT   ++  K+ P  AT + SL+L    L D K+   +D+++A 
Sbjct  1    MSNKLDQLRKFTTVVADTGDVEEIAKYQPEDATTNPSLILKAAQLADYKY--LIDSSIAY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     DK  ++    +   VN+G ++ K+VPGR+STEVDARL+YDT   VLK   L+K
Sbjct  59   AKSKS-ADKAQQIVDTCDMLAVNIGKEILKIVPGRISTEVDARLSYDTEKSVLKARQLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +YN   I  +R+L K+ +TW+GI A  +LE  GI  +LT ++
Sbjct  118  MYNDAGIKNDRILIKLASTWEGIRAGEILEKEGINCNLTLLF  159



>ref|WP_009092233.1| transaldolase [Pantoea sp. Sc1]
 gb|EIC00002.1| transaldolase B [Pantoea sp. Sc1]
Length=317

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+  
Sbjct  1    MTDKLTSLRQLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIG-  57

Query  396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD  566
               +  E   DKD ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT G + K   
Sbjct  58   ---WAREQSSDKDEQLQLVSDKLAVNIGLEILKLIPGRISTEVDARLSYDTEGSINKARS  114

Query  567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            L+KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  115  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_019682663.1| transaldolase, partial [Pseudomonas aeruginosa]
Length=243

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   ------SGGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|XP_005097706.1| PREDICTED: transaldolase-like isoform X2 [Aplysia californica]
 ref|XP_005097707.1| PREDICTED: transaldolase-like isoform X3 [Aplysia californica]
Length=323

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +3

Query  228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY  407
            LD +   + +V DT  F+  ++F PT AT + SL+    ++P   ++  +D A++  +  
Sbjct  6    LDQLKAVTTVVADTGDFEAMKQFKPTDATTNPSLIFAAANMP--AYQKLIDEAVSYAKKL  63

Query  408  GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNG  587
            G ++ +  +S   +K  VN G ++ K++PGRVSTEVDARL++DT  +V K   L+KLY  
Sbjct  64   GGKEPEV-LSNAMDKVCVNFGAEILKIIPGRVSTEVDARLSFDTEAMVQKAQTLIKLYKD  122

Query  588  IEIPPERLLFKIPATWQGIEASRLLEAX-GIQTHLTFVY  701
              I  ER+L K+ +TW+G++A+R+LE+  GI  ++T ++
Sbjct  123  AGIEKERILIKLASTWEGVQAARILESQFGIHCNMTLIF  161



>ref|WP_038023177.1| transaldolase [Tatumella morbirosei]
 gb|KGD70599.1| transaldolase [Tatumella morbirosei]
Length=317

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 100/164 (61%), Gaps = 7/164 (4%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL--  389
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+  
Sbjct  1    MTDKLTSLRKLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIEW  58

Query  390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
            A ++    +DKD +++   +K  VN+G ++ KL+PGR+STEVDARL+YDT   + K H L
Sbjct  59   ARKQS---DDKDKQIAFASDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASIAKAHSL  115

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  116  IKLYNDAGISNDRILIKLASTWQGIRAAERLEKEGINCNLTLLF  159



>ref|WP_027947678.1| transaldolase [Halomonas anticariensis]
Length=319

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +LDA+  +S +V DT   +  +++ P  AT + SLLL    +P   +++ +D  LA 
Sbjct  1    MTHQLDALRQHSVVVADTGDLEAIKRYQPHDATTNPSLLLKAFDMP--GYQALIDAELAA  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                G  D+ A+     ++  V +G ++AKLVPGRVSTEV ARL++DT   V K H+L++
Sbjct  59   IRAEG-GDRQAQAEHAVDRLAVAMGSEIAKLVPGRVSTEVAARLSFDTEASVRKAHELIE  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY    +  +R+L K+ ATW+GI A+ +LE  GI  +LT ++
Sbjct  118  LYERHSVSRDRVLIKLAATWEGIRAAEVLEKEGINCNLTLLF  159



>emb|CBK21823.2| unnamed protein product [Blastocystis hominis]
Length=321

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 96/162 (59%), Gaps = 2/162 (1%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +++ LD ++ ++++V DT  F+    + P  AT + SL+L   + P+  +   VD A+  
Sbjct  1    MSSRLDKISAFTKVVADTGDFESIRAYKPVDATTNPSLILAAATKPE--YSHIVDAAIKY  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
               +  EDK   M    +K  V  G  + ++VPG VSTEVDARL++DT  ++ K   L+K
Sbjct  59   AREHAGEDKKLLMEVLIDKLSVLFGKAILEIVPGLVSTEVDARLSFDTQKMIAKARTLIK  118

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +Y    I  +R+L K+  TW+GIEA+R+LEA GI  +LT ++
Sbjct  119  MYEEEGISKDRILIKLATTWEGIEAARVLEAEGIHCNLTLLF  160



>gb|EEF57116.1| transaldolase [bacterium Ellin514]
Length=332

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            T+LD +  ++ +V DT  F   ++F P  AT + SL+     +P   +K  +D  +A+ +
Sbjct  17   TQLDQLKKFTRVVADTGDFGTIKEFAPQDATTNPSLIFKAAQMP--AYKELLDKVIAESK  74

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
              GL  + A +S   +  LV  G ++ K+VPGRVSTE DA L++DT G+V K H  + LY
Sbjct  75   KSGLSGQQA-LSDIMDNLLVAFGVEILKIVPGRVSTETDANLSFDTEGLVNKAHRFIDLY  133

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +   I  ER+L KI +TW+GI A+ +L+  GI  ++T ++
Sbjct  134  SKKGISKERILIKIASTWEGIRAAEVLQREGINCNMTLLF  173



>ref|WP_044469606.1| transaldolase [Mannheimia sp. MG13]
Length=317

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 102/164 (62%), Gaps = 7/164 (4%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+L+ + + + +V DT   +  +K+ P  AT + SL+L   +LP  ++ + +D A+A 
Sbjct  1    MTTQLETLRSMTVVVADTGDIEAIKKYQPQDATTNPSLILSASALP--QYATLIDEAIAY  58

Query  393  -DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
              Q+ +   DK  ++    +   V +G ++ K+VPGR+STEVDARL+YDT G + K   L
Sbjct  59   AKQQTH---DKAQQIIEAEDILAVKIGLEILKIVPGRISTEVDARLSYDTQGTIEKARKL  115

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            ++LYN   I  +R+L K+ +TWQGI A+ +LE  GI  +LT ++
Sbjct  116  IRLYNEAGISNDRILIKVASTWQGIRAAEVLEKEGINCNLTLLF  159



>ref|WP_005760753.1| MULTISPECIES: transaldolase [Pasteurellaceae]
 gb|EIJ69023.1| transaldolase [Pasteurella bettyae CCUG 2042]
Length=317

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 102/164 (62%), Gaps = 7/164 (4%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +TT+L+ + + + +V DT   +  +K+ P  AT + SL+L   +LP  ++ + +D A+A 
Sbjct  1    MTTQLETLRSMTVVVADTGDIEAIKKYQPQDATTNPSLILSASALP--QYATLIDEAIAY  58

Query  393  -DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
              Q+ +   DK  ++    +   V +G ++ K+VPGR+STEVDARL+YDT G + K   L
Sbjct  59   AKQQTH---DKAQQIIEAEDILAVKIGLEILKIVPGRISTEVDARLSYDTQGTIEKARKL  115

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            ++LYN   I  +R+L K+ +TWQGI A+ +LE  GI  +LT ++
Sbjct  116  IRLYNEAGISNDRILIKVASTWQGIRAAEVLEKEGINCNLTLLF  159



>ref|WP_017517514.1| transaldolase [Pseudomonas nitroreducens]
Length=306

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP    + A   A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP----RYAGHLARAT  56

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
            +   G    DA ++C  ++  V VG D+  ++PGR+STEVDARL++DT   + + H L++
Sbjct  57   EGAQG----DAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDTQATLQRAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  +R+L KI +TW+GI A+  LE  GIQT+LT ++
Sbjct  111  LYDQQGIGRDRVLIKIASTWEGIRAAEQLEREGIQTNLTLLF  152



>gb|EJS86828.1| transaldolase B, partial [Pasteurella multocida subsp. multocida 
str. Anand1_buffalo]
Length=206

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 98/164 (60%), Gaps = 11/164 (7%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA---  392
            T+LD++ + + +V DT   +  +++ P  AT + SL+L   +LP  ++   +D A+A   
Sbjct  2    TQLDSLRSMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYAPLIDDAIAYAK  59

Query  393  -DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
               +C   +  DA      +K  VN+G ++ K++PGR+STEVDARL+YDT   + K   L
Sbjct  60   TKSDCPRQQLVDAE-----DKLAVNIGLEILKIIPGRISTEVDARLSYDTQATIEKARKL  114

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +KLYN   I   R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  115  IKLYNEAGIENHRILIKIASTWQGIRAAEVLEKEGINCNLTLLF  158



>ref|XP_640977.1| hypothetical protein DDB_G0280909 [Dictyostelium discoideum AX4]
 sp|Q54UP4.1|TALDO_DICDI RecName: Full=Probable transaldolase [Dictyostelium discoideum]
 gb|EAL66996.1| hypothetical protein DDB_G0280909 [Dictyostelium discoideum AX4]
Length=321

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 98/163 (60%), Gaps = 4/163 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            ++  L+ +  Y+ +V DT  FD   K+    +T + SL+    S P  K+KS +D A+  
Sbjct  1    MSNALEELKKYTTVVADTADFDVLSKYGSQDSTTNPSLVFQAASDP--KYKSLIDDAIKY  58

Query  396  QECY-GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL  572
                 GL +K+ ++S   +K  VN G ++ K+VPGRVSTEVDARL+YD    V K  +L+
Sbjct  59   VNAKSGLSEKE-KLSLAIDKLFVNFGVEILKIVPGRVSTEVDARLSYDIDANVKKGRELI  117

Query  573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
             LY    I  ER+L K+ +TW+GIEA+++LE  GI  +LT ++
Sbjct  118  ALYKEAGIDKERVLIKLASTWEGIEAAKILEKEGIHCNLTLLF  160



>ref|WP_039159310.1| transaldolase [Gallibacterium anatis]
 gb|KGQ63523.1| transaldolase [Gallibacterium anatis]
Length=317

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 95/162 (59%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +  +LD +   + +V DT   +  +K+ P  AT + SL+L    LP  ++ S +D A+ D
Sbjct  1    MMNQLDTLRKMTVVVADTGDIEAIKKYQPQDATTNPSLVLSASQLP--QYASLIDEAV-D  57

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                   DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct  58   YAKSKSSDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATVAKARKLIA  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  118  LYNEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  159



>ref|WP_021461212.1| transaldolase [Gallibacterium anatis]
 gb|ERF79072.1| transaldolase [Gallibacterium anatis 12656/12]
Length=316

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++L+A+   + +V DT   +  +K+ P  AT + SL+L    LP  ++ + +D A+A  +
Sbjct  2    SQLEALRKMTVVVADTGDIEAIKKYQPQDATTNPSLVLSASQLP--QYAALIDEAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                 DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ LY
Sbjct  60   SKSA-DKGQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATVAKARKLIALY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  158



>gb|AAX47112.1| transaldolase B [Pantoea stewartii subsp. stewartii]
Length=196

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 94/162 (58%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            LT +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct  1    LTDKLTSLRQLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIAW  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                   DK+ ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + +   L+K
Sbjct  59   ARQQS-NDKEQQLQLVSDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIARARSLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K  +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNDAGISNDRILIKPASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_013746700.1| transaldolase [Gallibacterium anatis]
 gb|AEC17933.1| transaldolase B [Gallibacterium anatis UMN179]
Length=316

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++L+A+   + +V DT   +  +K+ P  AT + SL+L    LP  ++ + +D A+A  +
Sbjct  2    SQLEALRKMTVVVADTGDIEAIKKYQPQDATTNPSLVLSASQLP--QYAALIDEAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                 DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ LY
Sbjct  60   SKSA-DKGQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATVAKARKLIALY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  158



>ref|WP_039136836.1| transaldolase [Gallibacterium genomosp. 2]
 gb|KGQ30184.1| transaldolase [Gallibacterium genomosp. 2]
Length=316

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 96/160 (60%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++L+A+   + +V DT   +  +K+ P  AT + SL+L    LP  ++ S +D A+ D  
Sbjct  2    SQLEALRKMTVVVADTGDIEAIKKYQPQDATTNPSLVLSASQLP--QYASLIDEAV-DYA  58

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                 DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ LY
Sbjct  59   KSKSSDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATVAKARKLIALY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  158



>ref|WP_016955785.1| transaldolase [Catenovulum agarivorans]
Length=317

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 98/164 (60%), Gaps = 7/164 (4%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLP--DTKFKSAVDTAL  389
            +TT+L+ +   + +V DT   +  +KF P  AT + SLLL    +P  DT    A++ A 
Sbjct  1    MTTKLENLRKLTTVVADTGDIEAIKKFKPQDATTNPSLLLKAAQIPEYDTLIADAIEWAK  60

Query  390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
            A        D + ++    +K  VN+G ++ K+VPGR+STEVDARL++D  G + K   L
Sbjct  61   AQSN-----DVEQQIIDAGDKLAVNIGLEILKIVPGRISTEVDARLSFDKEGSLAKARKL  115

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +KLYN   I  ER+L K+ +TW+GI+A+ +LE  GI  +LT ++
Sbjct  116  MKLYNDAGIANERVLIKLASTWEGIQAAEVLEQEGINCNLTLLF  159



>ref|WP_039166912.1| transaldolase [Gallibacterium anatis]
 gb|KGQ47416.1| transaldolase [Gallibacterium anatis]
Length=316

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++L+A+   + +V DT   +  +K+ P  AT + SL+L    LP  ++ + +D A+A  +
Sbjct  2    SQLEALRKMTVVVADTGDIEAIKKYQPQDATTNPSLVLSASQLP--QYAALIDEAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                 DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ LY
Sbjct  60   SKSA-DKGQQLIDVEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATVAKARKLIALY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   +  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGVSNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  158



>ref|WP_033892102.1| transaldolase, partial [Pseudomonas aeruginosa]
Length=271

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|WP_039163815.1| transaldolase [Gallibacterium anatis]
 gb|KGQ61187.1| transaldolase [Gallibacterium anatis 4895]
Length=316

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++L+A+   + +V DT   +  +K+ P  AT + SL+L    LP  ++ + +D A+A  +
Sbjct  2    SQLEALRKMTVVVADTGDIEAIKKYQPQDATTNPSLVLSASQLP--QYAALIDEAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                 DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ LY
Sbjct  60   SKS-ADKGQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTEATVAKARKLIALY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI A+ +LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLF  158



>ref|WP_031766810.1| transaldolase, partial [Pseudomonas aeruginosa]
Length=271

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|WP_032805206.1| transaldolase, partial [Cronobacter universalis]
Length=163

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 96/162 (59%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L ++  ++ +V DT      + + P  AT + SL+L    +P+  ++  +D A+  
Sbjct  1    MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDAVTW  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +     D+  ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT G + K   L+K
Sbjct  59   AKSQS-SDRAQQVVDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTEGSIAKAKRLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_040218947.1| transaldolase [Haemophilus parahaemolyticus]
Length=316

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 96/160 (60%), Gaps = 3/160 (2%)
 Frame = +3

Query  222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE  401
            ++LDA+   + +V DT   D  +++ P  AT + SL+L   SLP  ++   +D A+A  +
Sbjct  2    SQLDALREMTVVVADTGDIDAIKQYQPQDATTNPSLILSASSLP--QYAPLIDEAVAYAK  59

Query  402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY  581
                 DK  ++    +K  VN+G ++ K+VPGR+STEVDAR +YDT   + K   L+ LY
Sbjct  60   AKS-NDKAQQLVDAEDKLAVNIGLEILKIVPGRISTEVDARFSYDTEKTIAKARKLIALY  118

Query  582  NGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            N   I  +R+L KI +TWQGI+A+  LE  GI  +LT ++
Sbjct  119  NEAGISNDRILIKIASTWQGIKAAEQLEKEGINCNLTLLF  158



>ref|WP_024916994.1| transaldolase [Pseudomonas aeruginosa]
Length=307

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIERERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|WP_034001939.1| transaldolase, partial [Pseudomonas aeruginosa]
Length=267

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   ------SGGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|WP_033749420.1| MULTISPECIES: transaldolase [Pantoea]
Length=317

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 98/163 (60%), Gaps = 5/163 (3%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA-  392
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A++ 
Sbjct  1    MTDKLTSLRQLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAISW  58

Query  393  DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL  572
             +E  G   KD  +S   +K  VN+G ++ KL+PGR+STEVDARL+YDT G + K   L+
Sbjct  59   AREQNG--SKDELISLVSDKLAVNIGLEILKLIPGRISTEVDARLSYDTEGSIAKARSLI  116

Query  573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            KLYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  117  KLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|XP_002117651.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV19909.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=321

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +++ L+ +  Y+ +V DT  F+   K+ P  +T + SL+L  C +P+  ++  ++ A+ +
Sbjct  1    MSSALEQIKGYTYVVADTGDFESIGKYSPKDSTTNPSLILAACKMPE--YQHLLEKAVEE  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
             +    +D + ++    +   VN G ++ KL+PGRVSTEVDARL++D  G + +   L++
Sbjct  59   AKQRA-DDINGQIEWAMDLLAVNFGAEILKLIPGRVSTEVDARLSFDVQGSLQRARRLIQ  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAX-GIQTHLTFVY  701
            LYN I I  ER+L K+ +TW+GI+A ++LE+  G+  ++T ++
Sbjct  118  LYNDIGIDKERILIKLSSTWEGIQAGKILESEDGVHCNMTLLF  160



>ref|WP_031773824.1| transaldolase, partial [Pseudomonas aeruginosa]
Length=269

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>gb|AAT51194.1| PA2796, partial [synthetic construct]
Length=308

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|WP_006117626.1| transaldolase [Pantoea stewartii]
 gb|EHU02276.1| transaldolase B [Pantoea stewartii subsp. stewartii DC283]
 gb|KHE01785.1| transaldolase [Pantoea stewartii]
 gb|KHN64297.1| transaldolase [Pantoea stewartii]
Length=317

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 95/162 (59%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRQLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIAW  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                   DK+ ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   L+K
Sbjct  59   ARQQS-NDKEQQLQLVSDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKARSLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_034083943.1| transaldolase [Pseudomonas aeruginosa]
Length=307

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|WP_034008330.1| transaldolase [Pseudomonas aeruginosa]
Length=307

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



>ref|WP_027348602.1| transaldolase [Halotalea alkalilenta]
Length=316

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 101/164 (62%), Gaps = 8/164 (5%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +TT+L+++   S++V DT   +  +K+ P  AT + SL+L    LP   ++  +   LA+
Sbjct  1    MTTQLESLKQLSKVVADTGDLEAIKKYQPVDATTNPSLILKAFDLPG--YQELIKKTLAE  58

Query  396  --QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL  569
               E  G    D R+    +K  V +G +++K+VPGRVSTEV A+L+YD    + K H L
Sbjct  59   AASEASG----DERIDHTVDKLSVAMGAEISKIVPGRVSTEVAAKLSYDQEASIAKAHKL  114

Query  570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            +++Y+ I +P +++L K+ +TW+GI A+ +LE  GIQ +LT ++
Sbjct  115  IEMYDRIGVPKDKVLIKLASTWEGIRAAEVLEKEGIQCNLTLLF  158



>ref|WP_033740221.1| transaldolase [Pantoea stewartii]
 gb|KGD83249.1| transaldolase [Pantoea stewartii subsp. indologenes]
Length=317

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 95/162 (59%), Gaps = 3/162 (2%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct  1    MTDKLTSLRQLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIAW  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                   DK+ ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   L+K
Sbjct  59   ARQQS-NDKEQQLQLVSDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKARSLIK  117

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LYN   I  +R+L K+ +TWQGI A+  LE  GI  +LT ++
Sbjct  118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLF  159



>ref|WP_039026892.1| transaldolase [Pseudomonas aeruginosa]
Length=307

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 98/162 (60%), Gaps = 10/162 (6%)
 Frame = +3

Query  216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD  395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct  1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG  58

Query  396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK  575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct  59   ------SGGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE  110

Query  576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAXGIQTHLTFVY  701
            LY+   I  ER+L KI +TW+GI A+ +LE  GIQT+LT ++
Sbjct  111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLF  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335