BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048M23

Length=696
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007225690.1|  hypothetical protein PRUPE_ppa003137mg             363   8e-119   
ref|XP_008219380.1|  PREDICTED: transport inhibitor response 1-li...    363   1e-118   Prunus mume [ume]
gb|AIT18064.1|  auxin signaling F-box protein 5                         363   1e-118   Prunus salicina [Japanese plum]
gb|AIT18062.1|  auxin signaling F-box protein 5                         363   1e-118   Prunus salicina [Japanese plum]
emb|CBI19230.3|  unnamed protein product                                361   1e-118   Vitis vinifera
ref|XP_002283927.2|  PREDICTED: transport inhibitor response 1-li...    361   5e-118   Vitis vinifera
ref|XP_010098665.1|  hypothetical protein L484_026040                   357   2e-116   Morus notabilis
ref|XP_004299699.1|  PREDICTED: transport inhibitor response 1-li...    357   3e-116   Fragaria vesca subsp. vesca
ref|XP_002302328.1|  hypothetical protein POPTR_0002s10310g             354   5e-115   Populus trichocarpa [western balsam poplar]
ref|XP_011016884.1|  PREDICTED: transport inhibitor response 1-li...    354   8e-115   Populus euphratica
emb|CDP11468.1|  unnamed protein product                                353   2e-114   Coffea canephora [robusta coffee]
ref|XP_009373673.1|  PREDICTED: transport inhibitor response 1-li...    351   1e-113   Pyrus x bretschneideri [bai li]
ref|XP_008338910.1|  PREDICTED: transport inhibitor response 1-li...    350   1e-113   Malus domestica [apple tree]
ref|XP_002306554.1|  F-box family protein                               350   2e-113   Populus trichocarpa [western balsam poplar]
gb|KDP41450.1|  hypothetical protein JCGZ_15857                         349   2e-113   Jatropha curcas
ref|XP_002514006.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    350   2e-113   Ricinus communis
gb|AAK16647.1|AF139835_1  F-box containing protein TIR1                 350   2e-113   Populus tremula x Populus tremuloides
ref|XP_008466181.1|  PREDICTED: transport inhibitor response 1-li...    349   5e-113   Cucumis melo [Oriental melon]
ref|NP_001234722.1|  LeTIR                                              348   1e-112   Solanum lycopersicum
ref|XP_006472518.1|  PREDICTED: transport inhibitor response 1-li...    348   2e-112   Citrus sinensis [apfelsine]
ref|XP_011016326.1|  PREDICTED: transport inhibitor response 1-li...    347   3e-112   Populus euphratica
ref|XP_006338135.1|  PREDICTED: transport inhibitor response 1-li...    346   5e-112   Solanum tuberosum [potatoes]
ref|XP_008466180.1|  PREDICTED: transport inhibitor response 1-li...    346   7e-112   Cucumis melo [Oriental melon]
ref|XP_009763830.1|  PREDICTED: transport inhibitor response 1-li...    345   2e-111   Nicotiana sylvestris
ref|XP_006433877.1|  hypothetical protein CICLE_v10000564mg             345   3e-111   Citrus clementina [clementine]
gb|KHG29069.1|  hypothetical protein F383_04554                         343   4e-111   Gossypium arboreum [tree cotton]
ref|XP_011010387.1|  PREDICTED: transport inhibitor response 1-li...    343   6e-111   Populus euphratica
ref|XP_004160301.1|  PREDICTED: transport inhibitor response 1-li...    343   9e-111   
ref|XP_004136263.1|  PREDICTED: transport inhibitor response 1-li...    342   3e-110   
gb|KHG12530.1|  hypothetical protein F383_18959                         340   6e-110   Gossypium arboreum [tree cotton]
ref|XP_004160292.1|  PREDICTED: transport inhibitor response 1-li...    340   1e-109   
gb|KGN60245.1|  hypothetical protein Csa_3G890010                       340   1e-109   Cucumis sativus [cucumbers]
gb|KJB58951.1|  hypothetical protein B456_009G232000                    339   2e-109   Gossypium raimondii
gb|KJB64196.1|  hypothetical protein B456_010G036400                    339   3e-109   Gossypium raimondii
ref|XP_009597676.1|  PREDICTED: transport inhibitor response 1-li...    338   5e-109   Nicotiana tomentosiformis
gb|KGN60246.1|  hypothetical protein Csa_3G890020                       341   7e-109   Cucumis sativus [cucumbers]
ref|XP_004136426.1|  PREDICTED: transport inhibitor response 1-li...    337   1e-108   
ref|XP_007018160.1|  Auxin F-box protein 5 isoform 1                    337   3e-108   
ref|XP_003615232.1|  F-box family protein                               332   9e-107   Medicago truncatula
ref|XP_007141239.1|  hypothetical protein PHAVU_008G179000g             328   4e-105   Phaseolus vulgaris [French bean]
ref|XP_010266476.1|  PREDICTED: transport inhibitor response 1-li...    325   5e-105   Nelumbo nucifera [Indian lotus]
ref|XP_004490408.1|  PREDICTED: transport inhibitor response 1-li...    328   6e-105   Cicer arietinum [garbanzo]
ref|XP_010441379.1|  PREDICTED: transport inhibitor response 1-li...    328   6e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010530111.1|  PREDICTED: transport inhibitor response 1-li...    328   7e-105   Tarenaya hassleriana [spider flower]
ref|XP_006280173.1|  hypothetical protein CARUB_v10026074mg             328   8e-105   Capsella rubella
ref|XP_010445996.1|  PREDICTED: transport inhibitor response 1-li...    327   1e-104   Camelina sativa [gold-of-pleasure]
ref|NP_568718.1|  auxin F-box protein 5                                 327   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865768.1|  auxin F-box protein 5                              326   3e-104   
gb|KHN09006.1|  Transport inhibitor response 1-like protein             322   4e-104   Glycine soja [wild soybean]
ref|XP_010266465.1|  PREDICTED: transport inhibitor response 1-li...    325   1e-103   Nelumbo nucifera [Indian lotus]
ref|XP_010482301.1|  PREDICTED: transport inhibitor response 1-li...    325   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010525658.1|  PREDICTED: transport inhibitor response 1-li...    323   3e-103   Tarenaya hassleriana [spider flower]
ref|XP_003526541.1|  PREDICTED: transport inhibitor response 1-li...    322   4e-103   Glycine max [soybeans]
gb|KFK26632.1|  hypothetical protein AALP_AA8G273700                    317   6e-101   Arabis alpina [alpine rockcress]
gb|KDO81096.1|  hypothetical protein CISIN_1g044749mg                   311   6e-101   Citrus sinensis [apfelsine]
ref|XP_003523780.1|  PREDICTED: transport inhibitor response 1-li...    316   7e-101   Glycine max [soybeans]
emb|CDY21439.1|  BnaC03g27580D                                          315   3e-100   Brassica napus [oilseed rape]
ref|XP_009138011.1|  PREDICTED: F-box protein FBX14                     312   5e-99    Brassica rapa
emb|CDY34286.1|  BnaA01g13890D                                          311   2e-98    Brassica napus [oilseed rape]
emb|CDY03450.1|  BnaC01g16320D                                          308   2e-97    
ref|XP_010448570.1|  PREDICTED: F-box protein FBX14-like                308   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006285271.1|  hypothetical protein CARUB_v10006645mg             307   8e-97    Capsella rubella
ref|XP_010272955.1|  PREDICTED: transport inhibitor response 1-li...    306   1e-96    Nelumbo nucifera [Indian lotus]
emb|CDX83172.1|  BnaA03g23340D                                          304   5e-96    
ref|XP_010439045.1|  PREDICTED: F-box protein FBX14                     304   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009134037.1|  PREDICTED: transport inhibitor response 1-li...    302   3e-95    Brassica rapa
ref|XP_010433773.1|  PREDICTED: F-box protein FBX14-like                302   7e-95    Camelina sativa [gold-of-pleasure]
ref|XP_003519193.1|  PREDICTED: transport inhibitor response 1-li...    302   7e-95    Glycine max [soybeans]
emb|CAB45074.1|  transport inhibitor response-like protein              301   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567702.2|  auxin signaling F-BOX 4                               301   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544234.1|  PREDICTED: transport inhibitor response 1-li...    301   3e-94    Glycine max [soybeans]
ref|XP_006413438.1|  hypothetical protein EUTSA_v10024672mg             300   5e-94    Eutrema salsugineum [saltwater cress]
ref|XP_006413440.1|  hypothetical protein EUTSA_v10024671mg             300   6e-94    Eutrema salsugineum [saltwater cress]
ref|XP_002867664.1|  hypothetical protein ARALYDRAFT_492408             298   1e-93    
emb|CDP01403.1|  unnamed protein product                                281   3e-92    Coffea canephora [robusta coffee]
ref|XP_003602960.1|  F-box family protein                               293   6e-92    Medicago truncatula
gb|KHN26118.1|  Transport inhibitor response 1-like protein             288   3e-91    Glycine soja [wild soybean]
ref|XP_010942647.1|  PREDICTED: transport inhibitor response 1-li...    292   3e-91    Elaeis guineensis
ref|XP_010675461.1|  PREDICTED: transport inhibitor response 1-li...    292   4e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010916693.1|  PREDICTED: transport inhibitor response 1-li...    288   7e-90    Elaeis guineensis
ref|XP_008812967.1|  PREDICTED: transport inhibitor response 1-li...    286   5e-89    
ref|XP_006841245.1|  hypothetical protein AMTR_s00135p00080850          285   1e-88    Amborella trichopoda
ref|XP_008806378.1|  PREDICTED: F-box protein FBX14-like                285   1e-88    Phoenix dactylifera
ref|XP_008795194.1|  PREDICTED: F-box protein FBX14-like                283   4e-88    
gb|ACV87280.1|  TIR1/AFB auxin receptor protein PintaAFB4A              282   7e-88    Pinus taeda
gb|ACV87281.1|  TIR1/AFB auxin receptor protein PintaAFB4A              282   1e-87    Pinus taeda
emb|CDP12732.1|  unnamed protein product                                270   8e-87    Coffea canephora [robusta coffee]
ref|XP_010939729.1|  PREDICTED: transport inhibitor response 1-li...    278   6e-86    Elaeis guineensis
ref|XP_009391335.1|  PREDICTED: transport inhibitor response 1-li...    278   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399685.1|  PREDICTED: transport inhibitor response 1-li...    276   6e-85    
gb|AHW83201.1|  auxin F-box protein 2                                   275   1e-84    Larix kaempferi [karamatsu]
ref|XP_003570592.1|  PREDICTED: transport inhibitor response 1-li...    271   5e-83    Brachypodium distachyon [annual false brome]
gb|EMS64215.1|  hypothetical protein TRIUR3_23956                       265   2e-82    Triticum urartu
ref|XP_010926346.1|  PREDICTED: transport inhibitor response 1-li...    267   1e-81    Elaeis guineensis
ref|XP_006656778.1|  PREDICTED: transport inhibitor response 1-li...    263   1e-80    Oryza brachyantha
ref|XP_008782182.1|  PREDICTED: transport inhibitor response 1-li...    263   3e-80    Phoenix dactylifera
gb|EMT11181.1|  hypothetical protein F775_20551                         265   4e-80    
gb|EEC74038.1|  hypothetical protein OsI_09014                          261   8e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_009409171.1|  PREDICTED: F-box protein FBX14-like                261   3e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003570593.1|  PREDICTED: transport inhibitor response 1-li...    261   3e-79    Brachypodium distachyon [annual false brome]
ref|NP_001048183.1|  Os02g0759700                                       261   3e-79    
ref|XP_006647937.1|  PREDICTED: transport inhibitor response 1-li...    258   5e-78    
ref|XP_004953988.1|  PREDICTED: F-box protein FBX14-like                258   1e-77    
ref|XP_008677495.1|  PREDICTED: uncharacterized protein LOC100381...    258   1e-77    
ref|XP_002452866.1|  hypothetical protein SORBIDRAFT_04g033850          257   2e-77    Sorghum bicolor [broomcorn]
gb|AFW73532.1|  hypothetical protein ZEAMMB73_849714                    254   5e-76    
ref|NP_001145982.1|  uncharacterized protein LOC100279510               248   1e-75    Zea mays [maize]
gb|EMS50853.1|  hypothetical protein TRIUR3_18749                       246   4e-75    Triticum urartu
dbj|BAK00859.1|  predicted protein                                      250   8e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT26241.1|  hypothetical protein F775_11202                         243   4e-74    
gb|KHN08256.1|  Transport inhibitor response 1-like protein             241   3e-72    Glycine soja [wild soybean]
ref|XP_006844497.1|  hypothetical protein AMTR_s00016p00126140          230   9e-68    Amborella trichopoda
gb|ACV87279.1|  TIR1/AFB auxin receptor protein PintaTIR1               228   4e-67    Pinus taeda
gb|AHW83200.1|  auxin F-box protein 1                                   226   2e-66    Larix kaempferi [karamatsu]
gb|AHA44842.1|  TIR1                                                    226   3e-66    Larix kaempferi [karamatsu]
ref|XP_006651114.1|  PREDICTED: transport inhibitor response 1-li...    224   3e-66    Oryza brachyantha
gb|ADE76203.1|  unknown                                                 225   5e-66    Picea sitchensis
ref|XP_010660695.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         225   7e-66    
ref|XP_007031984.1|  Auxin signaling F-box 2                            224   2e-65    Theobroma cacao [chocolate]
ref|XP_010682986.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    223   3e-65    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003553972.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    221   1e-64    
emb|CDP03546.1|  unnamed protein product                                219   1e-64    Coffea canephora [robusta coffee]
ref|XP_002269127.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    221   2e-64    Vitis vinifera
ref|XP_006663433.1|  PREDICTED: uncharacterized protein LOC102708848    229   2e-64    
gb|KCW64321.1|  hypothetical protein EUGRSUZ_G01952                     218   2e-64    Eucalyptus grandis [rose gum]
ref|XP_006841829.1|  hypothetical protein AMTR_s00003p00270130          221   2e-64    Amborella trichopoda
ref|XP_009403780.1|  PREDICTED: transport inhibitor response 1-li...    221   2e-64    
emb|CBI21294.3|  unnamed protein product                                220   3e-64    Vitis vinifera
dbj|BAK07267.1|  predicted protein                                      221   3e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003624463.1|  Protein AUXIN SIGNALING F-BOX                      220   3e-64    Medicago truncatula
ref|XP_003558633.1|  PREDICTED: transport inhibitor response 1-li...    221   3e-64    Brachypodium distachyon [annual false brome]
ref|XP_010249158.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    220   4e-64    Nelumbo nucifera [Indian lotus]
ref|XP_002512866.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    220   5e-64    Ricinus communis
ref|XP_010038170.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    220   5e-64    Eucalyptus grandis [rose gum]
ref|XP_006479877.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    220   6e-64    Citrus sinensis [apfelsine]
gb|AIT18061.1|  auxin signaling F-box protein 2                         219   7e-64    Prunus salicina [Japanese plum]
emb|CDY28523.1|  BnaC02g36370D                                          219   8e-64    Brassica napus [oilseed rape]
gb|EYU31866.1|  hypothetical protein MIMGU_mgv1a003473mg                219   2e-63    Erythranthe guttata [common monkey flower]
ref|XP_008805287.1|  PREDICTED: transport inhibitor response 1-li...    218   2e-63    Phoenix dactylifera
gb|EYU34827.1|  hypothetical protein MIMGU_mgv1a003674mg                218   2e-63    Erythranthe guttata [common monkey flower]
ref|XP_010502624.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         218   2e-63    Camelina sativa [gold-of-pleasure]
ref|XP_006395519.1|  hypothetical protein EUTSA_v10003903mg             218   2e-63    Eutrema salsugineum [saltwater cress]
ref|XP_007217221.1|  hypothetical protein PRUPE_ppa003465mg             218   3e-63    Prunus persica
ref|XP_010112739.1|  Protein TRANSPORT INHIBITOR RESPONSE 1             218   3e-63    
ref|XP_009386581.1|  PREDICTED: transport inhibitor response 1-li...    218   3e-63    
ref|XP_010523990.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    218   3e-63    Tarenaya hassleriana [spider flower]
ref|XP_010066425.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    218   3e-63    Eucalyptus grandis [rose gum]
emb|CBI32265.3|  unnamed protein product                                215   3e-63    Vitis vinifera
ref|XP_006290819.1|  hypothetical protein CARUB_v10016928mg             218   3e-63    Capsella rubella
gb|AIT18060.1|  auxin signaling F-box protein 2                         218   4e-63    Prunus salicina [Japanese plum]
gb|AIG99441.1|  transport inhibitor response 1                          218   4e-63    Morus alba var. multicaulis
ref|XP_009129474.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         218   4e-63    Brassica rapa
gb|KFK30917.1|  hypothetical protein AALP_AA6G042500                    218   4e-63    Arabis alpina [alpine rockcress]
ref|XP_008800392.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    218   4e-63    
ref|XP_010052384.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    218   5e-63    Eucalyptus grandis [rose gum]
ref|XP_009405455.1|  PREDICTED: transport inhibitor response 1-li...    217   5e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006444233.1|  hypothetical protein CICLE_v10019437mg             217   6e-63    Citrus clementina [clementine]
ref|XP_008231044.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    217   6e-63    Prunus mume [ume]
ref|XP_010245369.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    217   6e-63    Nelumbo nucifera [Indian lotus]
gb|KJB11711.1|  hypothetical protein B456_001G273700                    213   7e-63    Gossypium raimondii
ref|XP_010528142.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         217   7e-63    Tarenaya hassleriana [spider flower]
gb|EAZ18296.1|  hypothetical protein OsJ_33834                          223   8e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010514346.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    217   8e-63    Camelina sativa [gold-of-pleasure]
ref|XP_007161649.1|  hypothetical protein PHAVU_001G087000g             216   1e-62    Phaseolus vulgaris [French bean]
gb|EYU46730.1|  hypothetical protein MIMGU_mgv1a003374mg                217   1e-62    Erythranthe guttata [common monkey flower]
gb|ACX31301.2|  transport inhibitor response 1                          217   1e-62    Dimocarpus longan [longan]
ref|XP_002875343.1|  auxin signaling F-box 2                            216   1e-62    
ref|XP_007159244.1|  hypothetical protein PHAVU_002G221400g             216   1e-62    Phaseolus vulgaris [French bean]
ref|NP_001067865.1|  Os11g0462900                                       223   1e-62    
gb|ACL51018.1|  transport inhibitor response protein                    216   1e-62    Citrus trifoliata [hardy orange]
emb|CDY34211.1|  BnaA02g28290D                                          216   2e-62    Brassica napus [oilseed rape]
ref|XP_006446967.1|  hypothetical protein CICLE_v10014749mg             216   2e-62    Citrus clementina [clementine]
gb|KDO47371.1|  hypothetical protein CISIN_1g008325mg                   216   2e-62    Citrus sinensis [apfelsine]
gb|AEQ94093.1|  putative transport inhibitor response 1                 212   2e-62    Elaeis guineensis
ref|XP_011098945.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         215   3e-62    Sesamum indicum [beniseed]
ref|NP_566800.1|  auxin signaling F-box 2                               215   4e-62    Arabidopsis thaliana [mouse-ear cress]
gb|EPS70592.1|  transport inhibitor response protein                    215   4e-62    Genlisea aurea
ref|XP_010052385.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    215   4e-62    Eucalyptus grandis [rose gum]
ref|XP_009344196.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    215   4e-62    Pyrus x bretschneideri [bai li]
ref|XP_011082496.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    214   5e-62    Sesamum indicum [beniseed]
ref|XP_004493010.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    214   6e-62    Cicer arietinum [garbanzo]
ref|XP_011079740.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    214   6e-62    Sesamum indicum [beniseed]
ref|XP_010458719.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    214   7e-62    Camelina sativa [gold-of-pleasure]
ref|XP_008651820.1|  PREDICTED: F-box protein FBX14-like                215   7e-62    Zea mays [maize]
ref|XP_009415862.1|  PREDICTED: transport inhibitor response 1-li...    214   7e-62    
ref|XP_009378024.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         214   8e-62    Pyrus x bretschneideri [bai li]
ref|XP_010476261.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3         214   8e-62    Camelina sativa [gold-of-pleasure]
gb|KJB40643.1|  hypothetical protein B456_007G072400                    214   9e-62    Gossypium raimondii
ref|XP_010425404.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    214   1e-61    Camelina sativa [gold-of-pleasure]
ref|XP_002892715.1|  auxin signaling F-box 3                            214   1e-61    Arabidopsis lyrata subsp. lyrata
ref|XP_009587773.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    214   1e-61    Nicotiana tomentosiformis
gb|KJB23185.1|  hypothetical protein B456_004G085900                    210   1e-61    Gossypium raimondii
gb|KDP28084.1|  hypothetical protein JCGZ_13855                         214   1e-61    Jatropha curcas
ref|XP_002520681.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    214   1e-61    Ricinus communis
emb|CDX71968.1|  BnaC08g29060D                                          213   2e-61    
ref|XP_010241246.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    213   2e-61    Nelumbo nucifera [Indian lotus]
ref|XP_003518127.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    213   2e-61    Glycine max [soybeans]
gb|KJB11712.1|  hypothetical protein B456_001G273700                    213   2e-61    Gossypium raimondii
gb|KDP20879.1|  hypothetical protein JCGZ_21350                         213   2e-61    Jatropha curcas
gb|KHG11169.1|  auxin signaling f-box 2 -like protein                   213   2e-61    Gossypium arboreum [tree cotton]
gb|KJB69424.1|  hypothetical protein B456_011G023100                    213   2e-61    Gossypium raimondii
ref|XP_010430752.1|  PREDICTED: GRR1-like protein 1                     213   2e-61    Camelina sativa [gold-of-pleasure]
ref|XP_009118055.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    213   2e-61    Brassica rapa
ref|XP_010929637.1|  PREDICTED: transport inhibitor response 1-li...    213   3e-61    Elaeis guineensis
gb|KDP41834.1|  hypothetical protein JCGZ_26852                         213   3e-61    Jatropha curcas
emb|CDY26594.1|  BnaA09g46830D                                          213   3e-61    Brassica napus [oilseed rape]
emb|CDY16034.1|  BnaC08g40890D                                          213   3e-61    Brassica napus [oilseed rape]
ref|XP_010455977.1|  PREDICTED: GRR1-like protein 1                     213   4e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010096050.1|  Protein AUXIN SIGNALING F-BOX 2                    212   5e-61    Morus notabilis
ref|XP_008791063.1|  PREDICTED: transport inhibitor response 1-li...    212   5e-61    Phoenix dactylifera
ref|XP_008341250.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    212   5e-61    
ref|XP_004985419.1|  PREDICTED: transport inhibitor response 1-li...    212   6e-61    Setaria italica
ref|XP_002321035.1|  TRANSPORT INHIBITOR RESPONSE 1 family protein      212   6e-61    Populus trichocarpa [western balsam poplar]
ref|XP_009784635.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    212   6e-61    Nicotiana sylvestris
gb|ACJ85606.1|  unknown                                                 204   7e-61    Medicago truncatula
ref|XP_010909072.1|  PREDICTED: transport inhibitor response 1-li...    212   7e-61    Elaeis guineensis
ref|XP_009604230.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    211   8e-61    Nicotiana tomentosiformis
ref|NP_001267557.1|  protein AUXIN SIGNALING F-BOX 2-like               211   9e-61    Cucumis sativus [cucumbers]
gb|KHG11704.1|  auxin signaling f-box 2 -like protein                   211   9e-61    Gossypium arboreum [tree cotton]
gb|AES90448.2|  transport inhibitor response 1 protein                  211   1e-60    Medicago truncatula
ref|XP_009771789.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    211   1e-60    Nicotiana sylvestris
emb|CDY11468.1|  BnaA09g40340D                                          211   1e-60    Brassica napus [oilseed rape]
ref|NP_567135.1|  protein TRANSPORT INHIBITOR RESPONSE 1                211   1e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449206.1|  hypothetical protein CICLE_v10014739mg             211   1e-60    Citrus clementina [clementine]
ref|XP_003608251.1|  Protein AUXIN SIGNALING F-BOX                      211   1e-60    
ref|XP_008450007.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    211   1e-60    Cucumis melo [Oriental melon]
ref|XP_003548933.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    211   2e-60    
ref|XP_003536281.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    211   2e-60    Glycine max [soybeans]
gb|KHM99229.1|  Protein AUXIN SIGNALING F-BOX 3                         211   2e-60    Glycine soja [wild soybean]
ref|XP_006467904.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    211   2e-60    
ref|XP_006417190.1|  hypothetical protein EUTSA_v10007195mg             210   2e-60    Eutrema salsugineum [saltwater cress]
ref|XP_010545044.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    211   2e-60    Tarenaya hassleriana [spider flower]
ref|XP_009116967.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    211   2e-60    Brassica rapa
emb|CDX76680.1|  BnaC08g32660D                                          211   2e-60    
gb|ACV87282.1|  TIR1/AFB auxin receptor protein PintaAFB6               210   2e-60    Pinus taeda
gb|KHN00102.1|  Protein TRANSPORT INHIBITOR RESPONSE 1                  209   3e-60    Glycine soja [wild soybean]
ref|XP_006306355.1|  hypothetical protein CARUB_v10012250mg             210   3e-60    Capsella rubella
ref|XP_002465737.1|  hypothetical protein SORBIDRAFT_01g044720          211   3e-60    Sorghum bicolor [broomcorn]
ref|XP_002981422.1|  hypothetical protein SELMODRAFT_178850             210   3e-60    
ref|XP_002969952.1|  hypothetical protein SELMODRAFT_170974             210   3e-60    
ref|XP_010905566.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    210   3e-60    
ref|XP_004134961.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    210   3e-60    Cucumis sativus [cucumbers]
ref|NP_001267546.1|  protein TRANSPORT INHIBITOR RESPONSE 1-like        210   3e-60    Cucumis sativus [cucumbers]
ref|XP_008451438.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    210   4e-60    Cucumis melo [Oriental melon]
ref|XP_011009720.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    209   4e-60    Populus euphratica
gb|KJB23183.1|  hypothetical protein B456_004G085900                    209   5e-60    Gossypium raimondii
ref|XP_010522662.1|  PREDICTED: GRR1-like protein 1                     209   5e-60    Tarenaya hassleriana [spider flower]
ref|NP_563915.1|  auxin signaling F-box 3 protein                       209   6e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941793.1|  PREDICTED: transport inhibitor response 1-li...    209   7e-60    Elaeis guineensis
gb|KEH43259.1|  transport inhibitor response-like protein               209   7e-60    Medicago truncatula
ref|XP_007144561.1|  hypothetical protein PHAVU_007G166200g             209   7e-60    Phaseolus vulgaris [French bean]
ref|XP_003528427.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    209   7e-60    Glycine max [soybeans]
ref|XP_003518950.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    209   7e-60    
ref|XP_010554129.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    209   8e-60    Tarenaya hassleriana [spider flower]
ref|XP_003532560.2|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    209   8e-60    
ref|XP_006290792.1|  hypothetical protein CARUB_v10016894mg             209   9e-60    Capsella rubella
ref|XP_008379063.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         208   1e-59    
ref|XP_008658847.1|  PREDICTED: uncharacterized protein LOC100383...    209   1e-59    
ref|XP_008224957.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    209   1e-59    Prunus mume [ume]
ref|NP_001169310.1|  uncharacterized protein LOC100383174               209   1e-59    
ref|XP_002872791.1|  hypothetical protein ARALYDRAFT_490244             209   1e-59    Arabidopsis lyrata subsp. lyrata
gb|KHG02050.1|  transport inhibitor response 1 -like protein            209   1e-59    Gossypium arboreum [tree cotton]
emb|CDY68868.1|  BnaCnng60850D                                          207   1e-59    Brassica napus [oilseed rape]
ref|XP_007201723.1|  hypothetical protein PRUPE_ppa003344mg             208   1e-59    Prunus persica
ref|XP_002316664.1|  hypothetical protein POPTR_0011s04200g             208   2e-59    
emb|CDP16729.1|  unnamed protein product                                205   2e-59    Coffea canephora [robusta coffee]
gb|ABG56238.1|  auxin-responsive factor TIR1-like protein               207   2e-59    Populus tomentosa [Chinese white poplar]
ref|XP_002305651.1|  hypothetical protein POPTR_0004s03400g             207   2e-59    
ref|XP_009587288.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    207   2e-59    Nicotiana tomentosiformis
gb|EAZ25866.1|  hypothetical protein OsJ_09705                          207   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011033611.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    207   2e-59    Populus euphratica
ref|XP_010674940.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    208   3e-59    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006389669.1|  TRANSPORT INHIBITOR RESPONSE 1 family protein      207   3e-59    Populus trichocarpa [western balsam poplar]
ref|XP_011001141.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    207   3e-59    Populus euphratica
ref|XP_006373115.1|  transport inhibitor response family protein        207   3e-59    Populus trichocarpa [western balsam poplar]
ref|XP_009138698.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    207   3e-59    
ref|XP_007211398.1|  hypothetical protein PRUPE_ppa003317mg             207   3e-59    Prunus persica
ref|XP_006402320.1|  hypothetical protein EUTSA_v10005852mg             207   3e-59    Eutrema salsugineum [saltwater cress]
ref|XP_006287352.1|  hypothetical protein CARUB_v10000550mg             207   4e-59    Capsella rubella
gb|EYU40528.1|  hypothetical protein MIMGU_mgv1a003462mg                207   4e-59    
emb|CDX89163.1|  BnaA04g00230D                                          208   4e-59    
gb|AAN64135.1|  Putative F-box containing protein TIR1                  207   4e-59    
gb|AHA44833.1|  AFB6                                                    207   4e-59    
ref|XP_004979343.1|  PREDICTED: transport inhibitor response 1-li...    207   4e-59    
ref|XP_010277925.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    207   5e-59    
ref|XP_010512696.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    207   6e-59    
ref|XP_009393237.1|  PREDICTED: transport inhibitor response 1-li...    206   6e-59    
gb|ACT53268.1|  transport inhibitor response 1                          206   7e-59    
ref|NP_001052659.1|  Os04g0395600                                       206   7e-59    
gb|AAK76473.1|  putative F-box protein GRR1 protein 1, AtFBL18          206   7e-59    
gb|EAY93933.1|  hypothetical protein OsI_15707                          206   7e-59    
ref|XP_008439908.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    206   7e-59    
ref|XP_010413212.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    206   8e-59    
ref|XP_002300140.1|  transport inhibitor response family protein        206   8e-59    
gb|AFP19451.1|  transport inhibitor response 1                          206   8e-59    
ref|XP_004975445.1|  PREDICTED: transport inhibitor response 1-li...    206   9e-59    
gb|ABG46343.1|  transport inhibitor response 1                          206   9e-59    
ref|XP_002524686.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    206   9e-59    
ref|XP_009788922.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    206   9e-59    
ref|XP_009404746.1|  PREDICTED: transport inhibitor response 1-li...    206   1e-58    
ref|XP_006652225.1|  PREDICTED: transport inhibitor response 1-li...    206   1e-58    
ref|XP_003579653.1|  PREDICTED: transport inhibitor response 1-li...    206   1e-58    
ref|XP_007050790.1|  F-box/RNI-like superfamily protein isoform 1       206   1e-58    
ref|XP_011043308.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    206   1e-58    
ref|XP_004309692.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    206   1e-58    
ref|XP_010494680.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    205   2e-58    
ref|XP_002878489.1|  hypothetical protein ARALYDRAFT_907876             206   2e-58    
ref|XP_009104405.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    206   2e-58    
ref|XP_011045792.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    205   2e-58    
ref|NP_567255.1|  GRR1-like protein 1                                   205   3e-58    
ref|XP_006359432.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    205   3e-58    
gb|AIT18058.1|  transport inhibitor response 1-like protein             204   3e-58    
ref|XP_004304555.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         204   3e-58    
ref|XP_011006220.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    204   3e-58    
ref|XP_007213588.1|  hypothetical protein PRUPE_ppa003070mg             205   3e-58    
emb|CDY53998.1|  BnaC06g43000D                                          204   3e-58    
gb|AFS44506.1|  auxin receptor 1                                        204   4e-58    
emb|CDX67912.1|  BnaA07g19520D                                          206   4e-58    
gb|KHN43550.1|  Protein TRANSPORT INHIBITOR RESPONSE 1                  204   4e-58    
ref|XP_002447719.1|  hypothetical protein SORBIDRAFT_06g014420          204   5e-58    
ref|XP_009110620.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3         204   5e-58    
gb|KDO75707.1|  hypothetical protein CISIN_1g007916mg                   204   5e-58    
ref|XP_008234995.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    204   6e-58    
ref|XP_006449208.1|  hypothetical protein CICLE_v10014716mg             204   6e-58    
ref|XP_008804585.1|  PREDICTED: transport inhibitor response 1-li...    204   7e-58    
ref|XP_007025803.1|  F-box/RNI-like superfamily protein isoform 1       204   7e-58    
gb|AAK01147.1|AF291816_1  GRR1-like protein 1                           204   7e-58    
ref|XP_006467903.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    204   7e-58    
ref|XP_008386617.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    204   8e-58    
gb|ABQ50554.1|  hypothetical protein                                    204   8e-58    
ref|XP_007025804.1|  F-box/RNI-like superfamily protein isoform 2       204   1e-57    
gb|KHG02422.1|  transport inhibitor response 1 -like protein            203   1e-57    
ref|XP_008368919.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    203   1e-57    
gb|ABQ50561.1|  hypothetical protein                                    204   2e-57    
gb|KJB41985.1|  hypothetical protein B456_007G131300                    202   2e-57    
ref|XP_010087910.1|  hypothetical protein L484_002775                   202   2e-57    
ref|XP_006396547.1|  hypothetical protein EUTSA_v10028532mg             202   3e-57    
ref|XP_007025805.1|  F-box/RNI-like superfamily protein                 202   3e-57    
ref|XP_009375118.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    202   3e-57    
ref|XP_008224955.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    202   3e-57    
emb|CDY31282.1|  BnaC08g15770D                                          201   5e-57    
ref|XP_007163058.1|  hypothetical protein PHAVU_001G202600g             201   6e-57    
ref|XP_004495993.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    201   6e-57    
ref|NP_001234673.1|  TIR1-like protein                                  201   7e-57    
ref|XP_010904761.1|  PREDICTED: transport inhibitor response 1-li...    201   9e-57    
ref|XP_009421041.1|  PREDICTED: transport inhibitor response 1-li...    201   1e-56    
gb|KJB23186.1|  hypothetical protein B456_004G085900                    195   1e-56    
ref|NP_001136608.1|  hypothetical protein                               200   1e-56    
gb|KJB22544.1|  hypothetical protein B456_004G053500                    200   2e-56    
gb|EPS65956.1|  hypothetical protein M569_08818                         199   2e-56    
ref|XP_008364135.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    199   3e-56    
emb|CDY53774.1|  BnaC03g73110D                                          199   3e-56    
ref|XP_009122075.1|  PREDICTED: GRR1-like protein 1                     199   3e-56    
emb|CDY22108.1|  BnaA09g01370D                                          200   4e-56    
ref|XP_006362983.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    199   5e-56    
tpg|DAA38082.1|  TPA: hypothetical protein ZEAMMB73_041546              196   1e-55    
ref|XP_009402531.1|  PREDICTED: transport inhibitor response 1-li...    197   2e-55    
emb|CDY21947.1|  BnaC09g00530D                                          197   3e-55    
ref|XP_009134369.1|  PREDICTED: GRR1-like protein 1                     197   3e-55    
ref|XP_004504964.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    197   3e-55    
gb|EMS47226.1|  hypothetical protein TRIUR3_32567                       196   3e-55    
ref|XP_008669494.1|  PREDICTED: transport inhibitor response 1-li...    196   3e-55    
emb|CDX90899.1|  BnaA03g25790D                                          196   4e-55    
ref|XP_003548026.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    196   6e-55    
gb|KJB23184.1|  hypothetical protein B456_004G085900                    190   6e-55    
ref|XP_006352806.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    195   1e-54    
ref|XP_009603009.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    195   1e-54    
ref|XP_002271412.2|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    195   1e-54    
gb|KHN13379.1|  Protein AUXIN SIGNALING F-BOX 2                         195   1e-54    
ref|XP_008799278.1|  PREDICTED: transport inhibitor response 1-li...    195   2e-54    
ref|XP_004960270.1|  PREDICTED: transport inhibitor response 1-li...    194   2e-54    
dbj|BAK05356.1|  predicted protein                                      194   3e-54    
gb|KEH21100.1|  transport inhibitor response 1 protein                  194   3e-54    
sp|Q0DKP3.2|TIR1A_ORYSJ  RecName: Full=Transport inhibitor respon...    194   3e-54    
ref|XP_009763253.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    194   3e-54    
gb|KHG14995.1|  transport inhibitor response 1 -like protein            194   3e-54    
emb|CAN73714.1|  hypothetical protein VITISV_038840                     194   3e-54    
ref|XP_002272850.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    193   5e-54    
ref|XP_002440601.1|  hypothetical protein SORBIDRAFT_09g003870          193   6e-54    
dbj|BAK06180.1|  predicted protein                                      194   9e-54    
ref|XP_006654054.1|  PREDICTED: transport inhibitor response 1-li...    190   1e-53    
ref|XP_006362984.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    191   2e-53    
gb|AAV32196.1|  putative transport inhibitor response TIR1              189   2e-53    
ref|XP_006347140.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    192   2e-53    
ref|XP_008383826.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    191   3e-53    
ref|XP_006662955.1|  PREDICTED: transport inhibitor response 1-li...    191   4e-53    
ref|XP_010268854.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    191   4e-53    
ref|NP_001148131.1|  transport inhibitor response 1 protein             191   4e-53    
gb|ACG48935.1|  transport inhibitor response 1 protein                  191   5e-53    
emb|CBI34249.3|  unnamed protein product                                188   7e-53    
dbj|BAJ87145.1|  predicted protein                                      190   8e-53    
ref|NP_001067971.2|  Os11g0515500                                       190   9e-53    
ref|XP_004232795.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    190   1e-52    
gb|KJB24339.1|  hypothetical protein B456_004G140500                    189   1e-52    
emb|CDO99639.1|  unnamed protein product                                189   2e-52    
ref|XP_003568922.1|  PREDICTED: transport inhibitor response 1-li...    189   2e-52    
ref|XP_011096196.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    189   3e-52    
ref|XP_010686279.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    189   3e-52    
gb|KHG00218.1|  transport inhibitor response 1 -like protein            188   4e-52    
ref|XP_001755006.1|  TIRA2 TIR1-like auxin receptor protein             187   1e-51    
gb|KJB11713.1|  hypothetical protein B456_001G273700                    177   5e-50    
ref|XP_008656496.1|  PREDICTED: transport inhibitor response 1-li...    182   7e-50    
gb|EMS61945.1|  hypothetical protein TRIUR3_34918                       177   5e-49    
ref|XP_011086127.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    179   9e-49    
gb|EMS56796.1|  hypothetical protein TRIUR3_17029                       181   9e-49    
tpg|DAA38083.1|  TPA: hypothetical protein ZEAMMB73_041546              174   9e-49    
emb|CAN66468.1|  hypothetical protein VITISV_016565                     179   2e-48    
ref|XP_002450803.1|  hypothetical protein SORBIDRAFT_05g018860          178   2e-48    
ref|XP_002262856.2|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    178   3e-48    
gb|EYU27894.1|  hypothetical protein MIMGU_mgv1a003388mg                176   2e-47    
ref|XP_001760786.1|  TIRA1 TIR1-like auxin receptor                     173   9e-47    
ref|XP_010545045.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    171   1e-46    
ref|XP_003577541.1|  PREDICTED: transport inhibitor response 1-li...    173   1e-46    
ref|XP_001775745.1|  TIRB2 TIR1-like auxin receptor protein             173   1e-46    
emb|CBI38185.3|  unnamed protein product                                167   2e-46    
gb|EYU43421.1|  hypothetical protein MIMGU_mgv1a003323mg                173   2e-46    
emb|CDP11332.1|  unnamed protein product                                160   6e-46    
tpg|DAA42007.1|  TPA: hypothetical protein ZEAMMB73_504104              166   6e-46    
ref|XP_002982385.1|  hypothetical protein SELMODRAFT_445149             171   9e-46    
ref|XP_001771423.1|  TIR1-like auxin receptor                           168   1e-44    
ref|XP_009393238.1|  PREDICTED: transport inhibitor response 1-li...    167   2e-44    
ref|XP_002966544.1|  hypothetical protein SELMODRAFT_439561             166   9e-44    
ref|XP_010468900.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    165   1e-43    
emb|CAN82353.1|  hypothetical protein VITISV_036655                     165   1e-43    
gb|EPS73154.1|  f-box family protein                                    164   2e-43    
gb|ABR04117.1|  transport inhibitor response 1                          156   2e-43    
gb|EMT24313.1|  hypothetical protein F775_12364                         163   3e-43    
ref|XP_009378961.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    159   5e-43    
gb|KJB40642.1|  hypothetical protein B456_007G072400                    162   5e-43    
ref|XP_008368441.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    159   5e-42    
gb|EAY88836.1|  hypothetical protein OsI_10308                          154   1e-40    
ref|XP_010650024.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    150   2e-40    
ref|XP_006290791.1|  hypothetical protein CARUB_v10016894mg             154   2e-40    
dbj|BAD19397.1|  F-box containing protein TIR1-like                     151   1e-39    
ref|XP_007018161.1|  Auxin F-box protein 5 isoform 2                    150   1e-38    
emb|CBI23303.3|  unnamed protein product                                150   3e-38    
ref|XP_009104406.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    138   3e-34    
dbj|BAJ97220.1|  predicted protein                                      135   2e-33    
gb|AFW73533.1|  hypothetical protein ZEAMMB73_849714                    126   1e-30    
emb|CBI26585.3|  unnamed protein product                                100   9e-23    
ref|XP_001776814.1|  TLP2B TIR1-like auxin receptor protein             102   3e-21    
emb|CBI29780.3|  unnamed protein product                              95.9    7e-21    
gb|ABR17804.1|  unknown                                                 101   8e-21    
ref|XP_001756729.1|  predicted protein                                93.2    4e-18    
gb|KHN28237.1|  Protein TRANSPORT INHIBITOR RESPONSE 1                90.9    5e-18    
gb|EPS60135.1|  hypothetical protein M569_14670                       89.0    1e-16    
ref|XP_001780371.1|  TLP2A TIR1-like auxin receptor protein           85.9    1e-15    
gb|EAY98249.1|  hypothetical protein OsI_20159                        84.7    3e-15    
ref|XP_002439888.1|  hypothetical protein SORBIDRAFT_09g022040        84.3    4e-15    
ref|NP_001055700.1|  Os05g0449500                                     84.0    5e-15    
gb|ACR35897.1|  unknown                                               84.0    5e-15    
gb|ADL70236.1|  auxin signaling F-box 2                               81.3    7e-15    
gb|ADL70241.1|  auxin signaling F-box 2                               81.3    8e-15    
gb|ADB92055.2|  auxin signaling F-box 2                               81.3    8e-15    
gb|ADB92052.2|  auxin signaling F-box 2                               81.3    8e-15    
gb|ADB92053.1|  auxin signaling F-box 2                               81.3    8e-15    
gb|ADL70239.1|  auxin signaling F-box 2                               81.3    9e-15    
gb|ADL70235.1|  auxin signaling F-box 2                               80.9    9e-15    
gb|ADL70231.1|  auxin signaling F-box 2                               80.9    1e-14    
gb|ADB92054.2|  auxin signaling F-box 2                               81.3    1e-14    
ref|XP_003564629.1|  PREDICTED: coronatine-insensitive protein 1-...  83.2    1e-14    
ref|NP_001147900.1|  LOC100281510                                     82.8    1e-14    
ref|XP_008812756.1|  PREDICTED: coronatine-insensitive protein 1-...  82.4    2e-14    
ref|XP_011076735.1|  PREDICTED: coronatine-insensitive protein 1      82.0    2e-14    
gb|AHY19994.1|  coronatine-insensitive protein 1                      82.0    3e-14    
ref|XP_010909152.1|  PREDICTED: coronatine-insensitive protein 1      81.6    3e-14    
ref|XP_008812874.1|  PREDICTED: coronatine-insensitive protein 1-...  81.6    3e-14    
dbj|BAJ84926.1|  predicted protein                                    81.3    4e-14    
ref|XP_009402285.1|  PREDICTED: coronatine-insensitive protein 1-...  80.9    5e-14    
gb|EYU19981.1|  hypothetical protein MIMGU_mgv1a002976mg              80.9    6e-14    
ref|XP_008775055.1|  PREDICTED: coronatine-insensitive protein 1-...  80.9    6e-14    
emb|CDM83639.1|  unnamed protein product                              80.9    6e-14    
ref|NP_001049649.1|  Os03g0265500                                     80.5    6e-14    
ref|XP_010905359.1|  PREDICTED: coronatine-insensitive protein 1-...  80.5    7e-14    
gb|EPS71226.1|  coronatine-insensitive 1                              80.5    7e-14    
ref|XP_004961907.1|  PREDICTED: coronatine-insensitive protein 1-...  80.1    1e-13    
ref|XP_009416210.1|  PREDICTED: coronatine-insensitive protein 1-...  79.7    1e-13    
ref|XP_006654488.1|  PREDICTED: coronatine-insensitive protein 1-...  79.3    1e-13    
gb|ADK66974.1|  coronatine insensitive 2-like protein                 79.7    1e-13    
ref|XP_006645032.1|  PREDICTED: coronatine-insensitive protein 1-...  79.7    2e-13    
ref|XP_009350961.1|  PREDICTED: coronatine-insensitive protein 1-...  79.3    2e-13    
gb|AAO38719.1|  COI1                                                  79.3    2e-13    
ref|XP_009590388.1|  PREDICTED: coronatine-insensitive protein 1      79.3    2e-13    
ref|XP_009762532.1|  PREDICTED: coronatine-insensitive protein 1-...  79.0    2e-13    
ref|XP_008647754.1|  PREDICTED: uncharacterized protein LOC100280...  79.0    2e-13    
ref|XP_010907624.1|  PREDICTED: coronatine-insensitive protein 1-...  79.0    2e-13    
ref|XP_004490952.1|  PREDICTED: coronatine-insensitive protein 1-...  79.0    2e-13    
ref|NP_001146577.1|  uncharacterized protein LOC100280173             79.0    2e-13    
ref|NP_001044831.2|  Os01g0853400                                     79.0    3e-13    
ref|XP_009407559.1|  PREDICTED: coronatine-insensitive protein 1 ...  78.6    3e-13    
ref|XP_004307613.1|  PREDICTED: coronatine-insensitive protein 1      78.6    3e-13    
ref|XP_009407558.1|  PREDICTED: coronatine-insensitive protein 1 ...  78.6    4e-13    
gb|AFW81725.1|  coronatine-insensitive protein 1, mRNA                78.2    4e-13    
gb|EMS66070.1|  hypothetical protein TRIUR3_35106                     78.2    4e-13    
ref|XP_004970611.1|  PREDICTED: coronatine-insensitive protein 1-...  78.2    4e-13    
ref|XP_010534174.1|  PREDICTED: coronatine-insensitive protein 1-...  78.2    5e-13    
ref|NP_001150429.1|  coronatine-insensitive protein 1                 78.2    5e-13    
ref|NP_001169230.1|  hypothetical protein                             77.8    5e-13    
gb|EMT16014.1|  hypothetical protein F775_27999                       77.0    7e-13    
gb|AES99527.2|  coronatine-insensitive protein                        77.4    8e-13    



>ref|XP_007225690.1| hypothetical protein PRUPE_ppa003137mg [Prunus persica]
 gb|EMJ26889.1| hypothetical protein PRUPE_ppa003137mg [Prunus persica]
Length=600

 Score =   363 bits (932),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ V+++DL +LA SFP FKELVL CC+ FGTSGLA VA +CR+LRVLDL + DV
Sbjct  150  KLFLKRMSVTDDDLALLAESFPGFKELVLVCCDGFGTSGLAVVASKCRQLRVLDLTESDV  209

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD+VDWI CFPE++TCLESL+F+CVEC +NF+ALE+LV RSPSLKKL LNR VSI QLY
Sbjct  210  MDDDVDWICCFPESQTCLESLMFECVECLINFEALEKLVARSPSLKKLSLNRFVSIGQLY  269

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  SE   + + ELDY SAFAACKSLVYLSGFREIL DYLPAI 
Sbjct  270  RLMVRAPQLTHLGTGSFNTSEVMAQGDQELDYRSAFAACKSLVYLSGFREILLDYLPAIN  329

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLNFSYA+I+AEQLK VICHCHKLQ  WVLDS+CDEGLKAVA TCKD
Sbjct  330  PVCGNLTTLNFSYANINAEQLKSVICHCHKLQTFWVLDSICDEGLKAVARTCKD  383



>ref|XP_008219380.1| PREDICTED: transport inhibitor response 1-like protein [Prunus 
mume]
Length=632

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ V+++DL +LA SFP FKELVL CC+ FGTSGLA VA +CR+LRVLDL + DV
Sbjct  164  KLFLKRMSVTDDDLALLAESFPGFKELVLVCCDGFGTSGLAVVASKCRQLRVLDLTESDV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD+VDWI CFPE++TCLESL+F+CVEC +NF+ALE+LV RSPSLKKL LNR VSI QLY
Sbjct  224  MDDDVDWICCFPESQTCLESLMFECVECLINFEALEKLVARSPSLKKLSLNRFVSIGQLY  283

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  SE   + + ELDY SAFAACKSLVYLSGFREIL DYLPAI 
Sbjct  284  RLMVRAPQLTHLGTGSFNTSEVMAQGDQELDYRSAFAACKSLVYLSGFREILLDYLPAIS  343

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLNFSYA+I+AEQLK VICHCHKLQ  WVLDS+CDEGLKAVA TCKD
Sbjct  344  PVCGNLTTLNFSYANINAEQLKSVICHCHKLQTFWVLDSICDEGLKAVARTCKD  397



>gb|AIT18064.1| auxin signaling F-box protein 5 [Prunus salicina]
 gb|AIT18065.1| auxin signaling F-box protein 5 [Prunus salicina]
Length=632

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ V+++DL +LA SFP FKELVL CC+ FGTSGLA VA +CR+LRVLDL + DV
Sbjct  164  KLFLKRMSVTDDDLALLAESFPGFKELVLVCCDGFGTSGLAVVASKCRQLRVLDLTESDV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD+VDWI CFPE++TCLESL+F+CVEC +NF+ALE+LV RSPSLKKL LNR VSI QLY
Sbjct  224  MDDDVDWIRCFPESQTCLESLMFECVECLINFEALEKLVARSPSLKKLSLNRFVSIGQLY  283

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  SE   + + ELDY SAFAACKSLVYLSGFREI  DYLPAI 
Sbjct  284  RLMVRAPQLTHLGTGSFNTSEVMAQGDQELDYRSAFAACKSLVYLSGFREIFLDYLPAIS  343

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLNFSYA+I+AEQLK VICHCHKLQ  WVLDS+CDEGLKAVA TCKD
Sbjct  344  PVCGNLTTLNFSYANINAEQLKSVICHCHKLQTFWVLDSICDEGLKAVARTCKD  397



>gb|AIT18062.1| auxin signaling F-box protein 5 [Prunus salicina]
 gb|AIT18063.1| auxin signaling F-box protein 5 [Prunus salicina]
Length=632

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ V+++DL +LA SFP FKELVL CC+ FGTSGLA VA +CR+LRVLDL + DV
Sbjct  164  KLFLKRMSVTDDDLALLAESFPGFKELVLVCCDGFGTSGLAVVASKCRQLRVLDLTESDV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD+VDWI CFPE++TCLESL+F+CVEC +NF+ALE+LV RSPSLKKL LNR VSI QLY
Sbjct  224  MDDDVDWIRCFPESQTCLESLMFECVECLINFEALEKLVARSPSLKKLSLNRFVSIGQLY  283

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  SE   + + ELDY SAFAACKSLVYLSGFREI  DYLPAI 
Sbjct  284  RLMVRAPQLTHLGTGSFNTSEVMAQGDQELDYRSAFAACKSLVYLSGFREIFLDYLPAIS  343

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLNFSYA+I+AEQLK VICHCHKLQ  WVLDS+CDEGLKAVA TCKD
Sbjct  344  PVCGNLTTLNFSYANINAEQLKSVICHCHKLQTFWVLDSICDEGLKAVARTCKD  397



>emb|CBI19230.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 205/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V++ DL +LA+SFP FKELVL CC+ FGTSGLA +A +CR+LRVLDLI+ +V
Sbjct  87   KVYLKRMFVTDRDLELLAQSFPAFKELVLVCCDGFGTSGLAGIASKCRQLRVLDLIEDEV  146

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE+ TCLESLIFDC+EC +NF+ALE+LV RSPSL+KL+LNR+VSI QLY
Sbjct  147  TDDEVDWISCFPESGTCLESLIFDCIECPINFEALERLVARSPSLRKLRLNRYVSIGQLY  206

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LG+GSF +S+   + + E DY SAFAACKSLV LSGFREI+ DYLPAIY
Sbjct  207  RLMIRAPQLTHLGSGSFSSSDIVAQGDQEPDYISAFAACKSLVCLSGFREIIPDYLPAIY  266

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+I+ EQLK VICHCHKLQI WVLDSVCDEGL+AVAATCK+
Sbjct  267  PVCANLTSLNFSYANINTEQLKSVICHCHKLQIFWVLDSVCDEGLQAVAATCKE  320



>ref|XP_002283927.2| PREDICTED: transport inhibitor response 1-like protein [Vitis 
vinifera]
 emb|CAN80598.1| hypothetical protein VITISV_002642 [Vitis vinifera]
Length=601

 Score =   361 bits (926),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 205/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V++ DL +LA+SFP FKELVL CC+ FGTSGLA +A +CR+LRVLDLI+ +V
Sbjct  136  KVYLKRMFVTDRDLELLAQSFPAFKELVLVCCDGFGTSGLAGIASKCRQLRVLDLIEDEV  195

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE+ TCLESLIFDC+EC +NF+ALE+LV RSPSL+KL+LNR+VSI QLY
Sbjct  196  TDDEVDWISCFPESGTCLESLIFDCIECPINFEALERLVARSPSLRKLRLNRYVSIGQLY  255

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LG+GSF +S+   + + E DY SAFAACKSLV LSGFREI+ DYLPAIY
Sbjct  256  RLMIRAPQLTHLGSGSFSSSDIVAQGDQEPDYISAFAACKSLVCLSGFREIIPDYLPAIY  315

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+I+ EQLK VICHCHKLQI WVLDSVCDEGL+AVAATCK+
Sbjct  316  PVCANLTSLNFSYANINTEQLKSVICHCHKLQIFWVLDSVCDEGLQAVAATCKE  369



>ref|XP_010098665.1| hypothetical protein L484_026040 [Morus notabilis]
 gb|EXB75568.1| hypothetical protein L484_026040 [Morus notabilis]
Length=609

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 203/234 (87%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V++EDL+++A SFPNFKELVL CC+ FGT+GLA VA +CR+LRVLDLI+ +V
Sbjct  140  KIYLKRMSVTDEDLVLIAESFPNFKELVLVCCDGFGTTGLAVVANKCRQLRVLDLIESEV  199

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D++VDWI+CFP + TCLESLIFDCV+C VNF+ALE+LV+RSPSLKKL+LNR+VSI QLY
Sbjct  200  MDEDVDWIACFPGSHTCLESLIFDCVDCLVNFEALERLVVRSPSLKKLRLNRYVSIGQLY  259

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  S+   + E E DY SAFAACKSL  LSGFRE L + LPAIY
Sbjct  260  RLMIRAPQLTHLGTGSFSTSDGMIQGEQEADYASAFAACKSLTCLSGFRETLPELLPAIY  319

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+I+AEQLKPVICHCHKLQ  W LDS+CDEGL+AVAATCK+
Sbjct  320  PVCANLTSLNFSYANINAEQLKPVICHCHKLQTFWALDSICDEGLQAVAATCKE  373



>ref|XP_004299699.1| PREDICTED: transport inhibitor response 1-like protein [Fragaria 
vesca subsp. vesca]
Length=615

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V+++DL +LA SFP FKEL+L CC+ FGTSGLA VA +CR+L+VLDLI+ +V
Sbjct  149  KVYLKRMSVTDDDLALLAESFPGFKELLLVCCDGFGTSGLAVVASKCRQLKVLDLIESEV  208

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD+VDWI CFPE+ TCLESLIFDCVEC +NF+ALE+LVMRSP LKKL+LNRHVSI QL+
Sbjct  209  LDDDVDWICCFPESLTCLESLIFDCVECHINFEALERLVMRSPLLKKLRLNRHVSIGQLH  268

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF   E   + + ELDY SAFAACKSLV LSGFREIL D LPAIY
Sbjct  269  RLMVRAPQLTHLGTGSFSTLEGNPQGDQELDYVSAFAACKSLVCLSGFREILPDQLPAIY  328

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT LNFSYA+I+AEQL PVI HCHKLQI WVLDSVCDEGLKAVAATCK+
Sbjct  329  PVCANLTNLNFSYANITAEQLIPVIRHCHKLQIFWVLDSVCDEGLKAVAATCKE  382



>ref|XP_002302328.1| hypothetical protein POPTR_0002s10310g [Populus trichocarpa]
 gb|EEE81601.1| hypothetical protein POPTR_0002s10310g [Populus trichocarpa]
Length=635

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SF  FKEL L CC+ FGTSGLA VA +CR+L+VLDLI+ +V
Sbjct  169  KIHLKRMSVTDDDLALLAESFSGFKELALVCCDGFGTSGLAVVASKCRQLKVLDLIESEV  228

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWI CFP+T+TCLESLI DCVEC ++F ALE+LV RSPSLKKL+LNR VSI QLY
Sbjct  229  SDDEVDWILCFPDTETCLESLILDCVECPIDFDALERLVTRSPSLKKLRLNRFVSIGQLY  288

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  SE+  + ELELDY SAFAACKSLV LSGFREI+ DYLPAIY
Sbjct  289  RLMVRAPQLTHLGTGSFSQSEDVAQGELELDYGSAFAACKSLVCLSGFREIIPDYLPAIY  348

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+ISAEQLKP+I +CHKLQ  WVLDS+CDEGL+AVA TCK+
Sbjct  349  PVCANLTSLNFSYANISAEQLKPIISNCHKLQTFWVLDSICDEGLQAVATTCKE  402



>ref|XP_011016884.1| PREDICTED: transport inhibitor response 1-like protein [Populus 
euphratica]
 ref|XP_011016053.1| PREDICTED: transport inhibitor response 1-like protein [Populus 
euphratica]
Length=635

 Score =   354 bits (908),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SF  FKELVL CC+ FGTSGLA VA +CR+L+VLDLI+ +V
Sbjct  169  KIHLKRMSVTDDDLALLAESFSGFKELVLVCCDGFGTSGLAVVASKCRQLKVLDLIESEV  228

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWI CFP+T+TCLESLI DCVEC ++F ALE+LV RSPSLKKL+LNR VSI QLY
Sbjct  229  SDDEVDWILCFPDTETCLESLILDCVECPIDFDALERLVARSPSLKKLRLNRFVSIGQLY  288

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  SE+  + E ELDY SAFAACKSLV LSGFREI+ DYLPAIY
Sbjct  289  RLMVRAPQLTHLGTGSFSQSEDVAQGEQELDYVSAFAACKSLVCLSGFREIIPDYLPAIY  348

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+ISAEQLKP+I +CHKLQ  WVLDS+CDEGL+AVA TCK+
Sbjct  349  PVCANLTSLNFSYANISAEQLKPIISNCHKLQTFWVLDSICDEGLQAVATTCKE  402



>emb|CDP11468.1| unnamed protein product [Coffea canephora]
Length=642

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 199/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V++EDL +LA SFPNFKELVL CC+ FGT+GLA VA ECRK+RVLDLI+ ++
Sbjct  162  KVYLKRMSVADEDLAVLAHSFPNFKELVLVCCDGFGTNGLAIVASECRKIRVLDLIESEL  221

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             +DEVDWISCFP+  TCLESLIFDCV+  +NF+ALE+LV++SPSLKKL+LNR V+IVQLY
Sbjct  222  VEDEVDWISCFPQNGTCLESLIFDCVDSPINFEALERLVVKSPSLKKLRLNRQVTIVQLY  281

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RL++RAPQLT LGTGSFG  E   + E E DY SAFAACKSLV LSGFREI A YLPAI 
Sbjct  282  RLIVRAPQLTHLGTGSFGPGEIVAQGEQEPDYVSAFAACKSLVCLSGFREINAHYLPAIV  341

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LN SYA+IS EQLK  I HCHKLQ LWVLDSVCDEGL+AVAATCKD
Sbjct  342  PVCANLTSLNLSYATISTEQLKSFIYHCHKLQTLWVLDSVCDEGLQAVAATCKD  395



>ref|XP_009373673.1| PREDICTED: transport inhibitor response 1-like protein [Pyrus 
x bretschneideri]
Length=639

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/241 (71%), Positives = 201/241 (83%), Gaps = 9/241 (4%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL LKR+ V+++DL +LA SF  FKELVL CC+ FGTSGLA +A +CR+LRVLDL D +V
Sbjct  162  KLCLKRMSVTDDDLALLAESFAGFKELVLVCCDGFGTSGLAVLASKCRQLRVLDLTDTEV  221

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD+VDWISCFPE++TCLESL+FDCVEC VNF+ALE LV RSPSLKKL+LNR+VSI QLY
Sbjct  222  MDDDVDWISCFPESQTCLESLMFDCVECRVNFEALENLVARSPSLKKLRLNRYVSIGQLY  281

Query  361  RLMLRAPQLTDLGTGSFGASE---------EEAELELDYTSAFAACKSLVYLSGFREILA  513
            RLM+RAPQLT LGTGSF  +E         ++ + ELDY SAFAACKSL+ LSGFREIL 
Sbjct  282  RLMVRAPQLTHLGTGSFNLAEGMAQGDQELDQGDQELDYVSAFAACKSLICLSGFREILL  341

Query  514  DYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            D++P IYPVC+NLT LNFSYA+I+AEQLKPVI  CHKLQ  WVLDS+CDEGLKAVAATCK
Sbjct  342  DHIPVIYPVCSNLTALNFSYANITAEQLKPVISQCHKLQSFWVLDSICDEGLKAVAATCK  401

Query  694  D  696
            +
Sbjct  402  E  402



>ref|XP_008338910.1| PREDICTED: transport inhibitor response 1-like protein [Malus 
domestica]
Length=639

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/241 (71%), Positives = 202/241 (84%), Gaps = 9/241 (4%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL LKR+ V+++DL +LA SF  FKELVL CC+ FGTSGLA +A +CR+LRVLDL + +V
Sbjct  162  KLCLKRMSVTDDDLALLAESFAGFKELVLVCCDGFGTSGLAVLASKCRQLRVLDLTETEV  221

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD+VDWISCFPE++TCLESL+FDCVEC VNF+ALE+LV RSPSLKKL+LNR+VSI QLY
Sbjct  222  MDDDVDWISCFPESQTCLESLMFDCVECHVNFEALEKLVARSPSLKKLRLNRYVSIGQLY  281

Query  361  RLMLRAPQLTDLGTGSFGASE---------EEAELELDYTSAFAACKSLVYLSGFREILA  513
            RLM+RAPQLT LGTGSF  +E         ++ + ELDY SAFAACKSLV LSGFR+IL 
Sbjct  282  RLMVRAPQLTHLGTGSFNLAEGMAQGDQELDQGDQELDYVSAFAACKSLVCLSGFRDILL  341

Query  514  DYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            DY+P IYPVC+NLT LNFSYA+I+AEQLKPVI  CHKLQ  WVLDS+CDEGLKAVAATCK
Sbjct  342  DYIPVIYPVCSNLTALNFSYANITAEQLKPVISQCHKLQSFWVLDSICDEGLKAVAATCK  401

Query  694  D  696
            +
Sbjct  402  E  402



>ref|XP_002306554.1| F-box family protein [Populus trichocarpa]
 gb|EEE93550.1| F-box family protein [Populus trichocarpa]
Length=635

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SF  FKELVL CC+ FGTSGLA V   CR+L+VLDLI+ +V
Sbjct  169  KVHLKRMSVTDDDLALLAESFSGFKELVLVCCDGFGTSGLAIVVSRCRQLKVLDLIESEV  228

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFP+T+TCLESLIFDCV+C ++F ALE+LV RSPSLKKL+LNR+VSI QLY
Sbjct  229  SDDEVDWISCFPDTETCLESLIFDCVDCPIDFDALERLVARSPSLKKLRLNRYVSIGQLY  288

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELEL--DYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAP LT LGTGSF  SE+ A++E   DY SAFAACKSLV LSGFRE++ DYLPAI 
Sbjct  289  RLMVRAPHLTHLGTGSFSPSEDVAQVEQGPDYASAFAACKSLVCLSGFRELIPDYLPAIN  348

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA +SAEQLKP+I +CHKLQI WVLDS+CDEGL+AVAATCK+
Sbjct  349  PVCANLTSLNFSYAEVSAEQLKPIISNCHKLQIFWVLDSICDEGLQAVAATCKE  402



>gb|KDP41450.1| hypothetical protein JCGZ_15857 [Jatropha curcas]
Length=617

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SF  FKELVL CC+ FGTSGLA VA  CR+LRVLDLI+ +V
Sbjct  151  KVHLKRMTVTDDDLALLAESFLGFKELVLVCCDGFGTSGLAVVASRCRQLRVLDLIESEV  210

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE++ CLESLIFDCVEC +NF ALE+LV RSPSLKK++LNRHVSI QLY
Sbjct  211  SDDEVDWISCFPESEMCLESLIFDCVECPINFSALERLVARSPSLKKIRLNRHVSIGQLY  270

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  SE+  + E E D+ SAFAACKSLV LSGFR+IL DYLPAIY
Sbjct  271  RLMVRAPQLTHLGTGSFRPSEDVAQGEQEPDFVSAFAACKSLVCLSGFRDILPDYLPAIY  330

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC  LT+LN SYA+++AEQ+KP+I +C+KLQI WVLDS+CDEGL+AVAATCK+
Sbjct  331  PVCAILTSLNLSYANVTAEQIKPIISNCYKLQIFWVLDSICDEGLQAVAATCKE  384



>ref|XP_002514006.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
 gb|EEF48589.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
Length=635

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 201/235 (86%), Gaps = 3/235 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SF  FKELVL CC+ FGTSGLA VA  CR+LRVLDLI+ +V
Sbjct  168  KVHLKRMTVTDDDLALLAESFSGFKELVLVCCDGFGTSGLAIVASRCRQLRVLDLIESEV  227

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE++ CLESLIFDCVEC +NF ALE+LV RSPSLKK++LNR+VS+ QLY
Sbjct  228  ADDEVDWISCFPESEMCLESLIFDCVECSINFDALERLVARSPSLKKIRLNRYVSVSQLY  287

Query  361  RLMLRAPQLTDLGTGSFGASEE---EAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RLM+RAPQLT LGTGSF  S++   + E E DY SAFAACKSLV LSGF+EIL+DYLPAI
Sbjct  288  RLMIRAPQLTHLGTGSFRPSDDAAAQGEQEPDYASAFAACKSLVCLSGFKEILSDYLPAI  347

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            YPVC NL +LN SYA+I+A+QLKP+I +CHKLQ  WVLDS+CDEGL+AVAATCK+
Sbjct  348  YPVCANLNSLNLSYANITADQLKPIISNCHKLQTFWVLDSICDEGLQAVAATCKE  402



>gb|AAK16647.1|AF139835_1 F-box containing protein TIR1 [Populus tremula x Populus tremuloides]
Length=635

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SF  FKELVL CCE FGTSGLA V   CR+L+VLDLI+ DV
Sbjct  169  KVHLKRMSVTDDDLALLAESFSGFKELVLVCCEGFGTSGLAIVVSRCRQLKVLDLIESDV  228

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFP+T+TCLESLIFDCV+C ++F  LE+LV RSPSLKKL+LNR+VSI QLY
Sbjct  229  SDDEVDWISCFPDTETCLESLIFDCVDCPIDFDELERLVARSPSLKKLRLNRYVSIGQLY  288

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELEL--DYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAP LT LGTGSF  SE+ +++E   DY SAFAACKSLV LSGFREI+ DYLPAI 
Sbjct  289  RLMIRAPHLTHLGTGSFSPSEDVSQVEQGPDYASAFAACKSLVCLSGFREIIPDYLPAIN  348

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFS+A +SAEQLKP+I +CHKLQI WVLDS+CDEGL+AVAATCK+
Sbjct  349  PVCANLTSLNFSFADVSAEQLKPIISNCHKLQIFWVLDSICDEGLQAVAATCKE  402



>ref|XP_008466181.1| PREDICTED: transport inhibitor response 1-like protein [Cucumis 
melo]
Length=629

 Score =   349 bits (895),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 194/234 (83%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLI+ DV
Sbjct  156  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVAARCRHLRVLDLIESDV  215

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +TCLESLIFDCVE  +NF+AL++LV RSPSLKKL +NRHVSI QLY
Sbjct  216  ADDEVDWISCFPEKETCLESLIFDCVEWPINFEALQRLVSRSPSLKKLGVNRHVSITQLY  275

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
             LM+RAP LT LGTGSF  SE     + E D+TSAFAACKSLV LSGF++IL DYLP IY
Sbjct  276  HLMIRAPHLTHLGTGSFSTSEAVVHGDSEPDFTSAFAACKSLVCLSGFKDILPDYLPCIY  335

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN S+A+I+ EQLKPVI HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  336  PVCANLTTLNLSFANITPEQLKPVISHCHKLQTFWALDSICDEGLQAVASTCKE  389



>ref|NP_001234722.1| LeTIR [Solanum lycopersicum]
 gb|ACY26209.1| LeTIR [Solanum lycopersicum]
Length=623

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 197/233 (85%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KLYLKR+ +S++DL +LAR FPNFKELVL CCE FGTSGLA VA +CR++RVLDLI+ +V
Sbjct  156  KLYLKRMSISDDDLGLLARCFPNFKELVLVCCEGFGTSGLAIVARDCRQIRVLDLIESEV  215

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWIS FP  KTCLESL FDCVEC ++F+ALE+LV+RSPSLK+L+LNR VSI QLY
Sbjct  216  SDDEVDWISYFPXNKTCLESLTFDCVECPIDFEALEKLVIRSPSLKRLRLNRFVSITQLY  275

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM+RAPQLT+LGTGS GAS    E + DY SAFAACKS+V LSGFREI  +YLPAIYPV
Sbjct  276  RLMIRAPQLTNLGTGSXGASTVTDEPDPDYASAFAACKSMVCLSGFREIAPEYLPAIYPV  335

Query  541  CTNLTTLNFSY-ASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SY A+I+ EQ K VI  CHKLQ+LWV DSVCDEGL+AVAATCKD
Sbjct  336  CGNLTSLNLSYGANINTEQFKSVISRCHKLQVLWVFDSVCDEGLEAVAATCKD  388



>ref|XP_006472518.1| PREDICTED: transport inhibitor response 1-like protein-like [Citrus 
sinensis]
Length=639

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ ++++DL +LA SF  FKEL L CCE FGT GLA +A +CR+LRVLDLI+ +V
Sbjct  171  KVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEV  230

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWIS FPE +TCLESLIFDCV+C +NF+ALE+LV RSP L+KL+LNRHVSI QLY
Sbjct  231  TDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLY  290

Query  361  RLMLRAPQLTDLGTGSFGASE---EEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RLM+RAPQLT LGTG +G SE    + + E DY +AFAACKSLV LSGFREI  DYL AI
Sbjct  291  RLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAI  350

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            YPVC NLT+LNFSYA+I+A+QLKPVIC+CHKLQI W LDS+CDEGL+AVAATCK+
Sbjct  351  YPVCANLTSLNFSYATITADQLKPVICNCHKLQIFWALDSICDEGLQAVAATCKE  405



>ref|XP_011016326.1| PREDICTED: transport inhibitor response 1-like protein [Populus 
euphratica]
Length=635

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SF  FKELVL CC+ FGTSGLA V   CR+L+VLDLI+ +V
Sbjct  169  KVHLKRMSVTDDDLALLAESFSGFKELVLVCCDGFGTSGLAIVVSRCRQLKVLDLIESEV  228

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFP+++TCLESLIFDCV+C ++F ALE+LV RSPSLKKL+LNR+VSI QLY
Sbjct  229  SDDEVDWISCFPDSETCLESLIFDCVDCPIDFDALERLVARSPSLKKLRLNRYVSIGQLY  288

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELEL--DYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAP LT LGTGSF  SE+ A++E   DY SAFAACKSLV LSGFREI+ DYLPAI 
Sbjct  289  RLMVRAPHLTHLGTGSFSPSEDVAQVEQGPDYASAFAACKSLVCLSGFREIIPDYLPAIN  348

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA +SAEQLKP+I +CHKLQI WVLDS+ DEGL+AVAATCK+
Sbjct  349  PVCANLTSLNFSYADVSAEQLKPIISNCHKLQIFWVLDSIGDEGLQAVAATCKE  402



>ref|XP_006338135.1| PREDICTED: transport inhibitor response 1-like protein-like, 
partial [Solanum tuberosum]
Length=617

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 200/233 (86%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KLYLKR+ +S++DL +LAR FP+FKELVL CC+ FGTSGLA VA +CR++RVLDLI+ +V
Sbjct  151  KLYLKRMSISDDDLGLLARCFPSFKELVLVCCDGFGTSGLAIVARDCRQIRVLDLIESEV  210

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDW+S FPE KTCLESL FDCVEC ++F+ALE+LV+RSPSLK+L+LNR VSI QLY
Sbjct  211  SDDEVDWVSYFPENKTCLESLTFDCVECPIDFEALEKLVIRSPSLKRLRLNRFVSITQLY  270

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM+RAPQLT+LGTGSFG+S    E + DY SAFAACKS+V LSGF+EI+ +YLPAIYPV
Sbjct  271  RLMIRAPQLTNLGTGSFGSSTVIDEPDPDYASAFAACKSIVCLSGFKEIVPEYLPAIYPV  330

Query  541  CTNLTTLNFSY-ASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SY A+I+ EQ K VI  CHKLQ+LWV DSVCDEGL+AVAATCKD
Sbjct  331  CGNLTSLNLSYGANINTEQFKSVISRCHKLQVLWVFDSVCDEGLEAVAATCKD  383



>ref|XP_008466180.1| PREDICTED: transport inhibitor response 1-like protein [Cucumis 
melo]
Length=626

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/234 (71%), Positives = 193/234 (82%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLID DV
Sbjct  152  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVATRCRHLRVLDLIDSDV  211

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            KDDEVDWISCFPE +TCLESLIF+CVE  +NF+ALE+LV RSPSLKKL +NRHVSI QLY
Sbjct  212  KDDEVDWISCFPEKETCLESLIFECVEWPINFEALERLVSRSPSLKKLGVNRHVSIAQLY  271

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            +LM++AP+LT LGTGSF  SE     E E DY S FAAC SLV LSGF+++L DYLP IY
Sbjct  272  QLMIQAPRLTHLGTGSFNTSEAVIHGESEPDYASVFAACNSLVCLSGFKDVLPDYLPCIY  331

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN SYA+I+ EQLKP I HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  332  PVCANLTTLNLSYANITPEQLKPAIRHCHKLQTFWALDSICDEGLQAVASTCKE  385



>ref|XP_009763830.1| PREDICTED: transport inhibitor response 1-like protein [Nicotiana 
sylvestris]
Length=623

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 199/233 (85%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KLYLKR+ ++++DL +LAR FP+FKELVL CC+ FGTSGLA +A +CR++RVLDLI+ +V
Sbjct  156  KLYLKRMSITDDDLSLLARCFPHFKELVLVCCDGFGTSGLAIIARDCRQIRVLDLIESEV  215

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWIS FPE KTCLESL FDCVEC ++F+ALE+LV+RSPSLK+L+LNR VSI QLY
Sbjct  216  SDDEVDWISFFPENKTCLESLTFDCVECPIDFEALERLVIRSPSLKRLRLNRFVSITQLY  275

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM+RAPQLT+LGTGSFG S    E + DY SAF+ACKS+V LSGFREI  +YLPAIYPV
Sbjct  276  RLMIRAPQLTNLGTGSFGPSLLIDEQDPDYASAFSACKSIVCLSGFREIAPEYLPAIYPV  335

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LNFSYA+ I+ EQ K VI  CHKLQ+LWV DSVCDEGL+AVAATCKD
Sbjct  336  CCNLTSLNFSYAANINTEQFKSVISRCHKLQVLWVFDSVCDEGLQAVAATCKD  388



>ref|XP_006433877.1| hypothetical protein CICLE_v10000564mg [Citrus clementina]
 gb|ESR47117.1| hypothetical protein CICLE_v10000564mg [Citrus clementina]
Length=639

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 197/235 (84%), Gaps = 3/235 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ ++++DL +LA SF  FKEL L CCE FGT GLA +A +CR+LRVLDLI+ +V
Sbjct  171  KVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEV  230

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWIS FPE +TCLESLIFDCV+C +NF+ALE+LV RSP L+KL+LNRHVSI QLY
Sbjct  231  TDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLY  290

Query  361  RLMLRAPQLTDLGTGSFGASE---EEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RLM+RAPQLT LGTG +G SE    + + E DY +AFAACKSLV LSGFREI  DYL AI
Sbjct  291  RLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAI  350

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            YPVC NLT+LNFSYA+I+A+QLKPVIC+CHKLQ  W LDS+CDEGL+AVAATCK+
Sbjct  351  YPVCANLTSLNFSYATITADQLKPVICNCHKLQNFWALDSICDEGLQAVAATCKE  405



>gb|KHG29069.1| hypothetical protein F383_04554 [Gossypium arboreum]
Length=615

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 199/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V+++DL  LA SF  FKELVL CC+ FGTSGLA    +CR+L+VLDLI+ +V
Sbjct  149  KVYLKRMSVTDDDLATLAESFLGFKELVLVCCDGFGTSGLAIFVSKCRQLKVLDLIESEV  208

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDE DWISCFPE ++ LESLIFDCVEC +NF+ALE+LV RSPSLKKL+LNR+VSI QLY
Sbjct  209  SDDETDWISCFPEGESHLESLIFDCVECPINFEALERLVARSPSLKKLRLNRYVSIGQLY  268

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RL+++APQLT LGTGSF  SE   + + E DY +AFAACKSLV LSGFREI+ DYLPAIY
Sbjct  269  RLLVQAPQLTHLGTGSFSPSEVAGQGDQEPDYVTAFAACKSLVCLSGFREIIPDYLPAIY  328

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            P+C NLT+LNFSYA+I+AEQLKP+I +CHKLQ+ WVLDS+CDEGL+AVAATCK+
Sbjct  329  PICANLTSLNFSYANITAEQLKPIISNCHKLQVFWVLDSICDEGLQAVAATCKE  382



>ref|XP_011010387.1| PREDICTED: transport inhibitor response 1-like protein [Populus 
euphratica]
Length=635

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/234 (71%), Positives = 198/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+  + +DL +LA SF  FKELVL CC+ FGTSGLA V   CR+L+VLDLI+ +V
Sbjct  169  KVHLKRMAGTGDDLALLAESFSGFKELVLVCCDGFGTSGLAIVVSRCRQLKVLDLIESEV  228

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFP+++TCLESLIFDCV+C ++F ALE+LV RSPSLKKL+LNR+VSI QLY
Sbjct  229  SDDEVDWISCFPDSETCLESLIFDCVDCPIDFDALERLVARSPSLKKLRLNRYVSIGQLY  288

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELEL--DYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAP LT LGTGSF  SE+ A++E   DY SAFAACKSLV LSGFREI+ DYLPAI 
Sbjct  289  RLMVRAPHLTHLGTGSFSPSEDVAQVEQGPDYASAFAACKSLVCLSGFREIIPDYLPAIN  348

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA +SAEQLKP+I +CHKLQI WVLDS+ DEGL+AVAATCK+
Sbjct  349  PVCANLTSLNFSYADVSAEQLKPIISNCHKLQIFWVLDSIGDEGLQAVAATCKE  402



>ref|XP_004160301.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis 
sativus]
Length=617

 Score =   343 bits (879),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 191/234 (82%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLID DV
Sbjct  143  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVAARCRHLRVLDLIDSDV  202

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +TCLESLIF+CVE  +NF+ALE+LV RSPSLKKL +NRHVSI QLY
Sbjct  203  GDDEVDWISCFPEKETCLESLIFECVEWPINFEALERLVSRSPSLKKLGVNRHVSIAQLY  262

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            +LM+RAP+LT LGTGSF   E     E E DY S FAAC SLV LSGF+++L DYLP IY
Sbjct  263  QLMIRAPRLTHLGTGSFNTLEAVIHGESEPDYASVFAACNSLVCLSGFKDVLPDYLPCIY  322

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN SYA+I+ EQLKP I HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  323  PVCANLTTLNLSYANITPEQLKPAIRHCHKLQTFWALDSICDEGLQAVASTCKE  376



>ref|XP_004136263.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis 
sativus]
Length=626

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 191/234 (82%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLID DV
Sbjct  152  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVAARCRHLRVLDLIDSDV  211

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +TCLESLIF+CVE  +NF+ALE+LV RSPSLKKL +NRHVSI QLY
Sbjct  212  GDDEVDWISCFPEKETCLESLIFECVEWPINFEALERLVSRSPSLKKLGVNRHVSIAQLY  271

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            +LM+RAP+LT LGTGSF   E     E E DY S FAAC SLV LSGF+++L DYLP IY
Sbjct  272  QLMIRAPRLTHLGTGSFNTLEAVIHGESEPDYASVFAACNSLVCLSGFKDVLPDYLPCIY  331

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN S+A+I+ EQLKP I HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  332  PVCANLTTLNLSFANITPEQLKPAIRHCHKLQTFWALDSICDEGLQAVASTCKE  385



>gb|KHG12530.1| hypothetical protein F383_18959 [Gossypium arboreum]
Length=611

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 195/234 (83%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL  LA  F  FKELVL CC+ FGTSGL     +CR+L+VLDLI+ +V
Sbjct  145  KVHLKRMSVTDDDLATLAELFLGFKELVLVCCDGFGTSGLGIFVNKCRQLKVLDLIESEV  204

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDE DWISCFPE ++ LESLIFDCVEC +NF+ALE+LV RSPSLKKLKLNR+VSI QLY
Sbjct  205  SDDETDWISCFPEGESNLESLIFDCVECHINFEALERLVARSPSLKKLKLNRYVSIGQLY  264

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  S+   + + E DY +AFAAC+SLV LSGFREI+ DYLPAIY
Sbjct  265  RLMVRAPQLTHLGTGSFSPSDIVGQGDQEPDYVAAFAACRSLVCLSGFREIIPDYLPAIY  324

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+I+AEQLKP+I  CHKLQ  WVLDS+CDEGL+AVAATCKD
Sbjct  325  PVCANLTSLNFSYANITAEQLKPIISKCHKLQTFWVLDSICDEGLQAVAATCKD  378



>ref|XP_004160292.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis 
sativus]
Length=637

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 193/234 (82%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLI+ DV
Sbjct  164  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVAARCRHLRVLDLIESDV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +TCLESLIFDCVE  +NF+AL++LV RSPSLKKL +NR+VSI QLY
Sbjct  224  ADDEVDWISCFPEKETCLESLIFDCVEFPINFEALQRLVSRSPSLKKLGVNRYVSIAQLY  283

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
             LM+ AP+LT LGTGSF  SE     + E D+ SAFAACKSLV LSGF++IL DYLP IY
Sbjct  284  HLMIWAPRLTHLGTGSFSTSEAVVHGDSEPDFASAFAACKSLVCLSGFKDILPDYLPCIY  343

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN S+A+I+ EQLKPVI HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  344  PVCANLTTLNLSFANITPEQLKPVISHCHKLQTFWALDSICDEGLQAVASTCKE  397



>gb|KGN60245.1| hypothetical protein Csa_3G890010 [Cucumis sativus]
Length=637

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 193/234 (82%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLI+ DV
Sbjct  164  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVAARCRHLRVLDLIESDV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +TCLESLIF+CVE  +NF+ALE+LV RSPSLKKL +NR+VSI QLY
Sbjct  224  ADDEVDWISCFPEKETCLESLIFECVEWPINFEALERLVSRSPSLKKLGVNRYVSIAQLY  283

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
             LM+ AP+LT LGTGSF  SE     + E D+ SAFAACKSLV LSGF++IL DYLP IY
Sbjct  284  HLMIWAPRLTHLGTGSFSTSEAVVHGDSEPDFASAFAACKSLVCLSGFKDILPDYLPCIY  343

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN S+A+I+ EQLKPVI HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  344  PVCANLTTLNLSFANITPEQLKPVISHCHKLQTFWALDSICDEGLQAVASTCKE  397



>gb|KJB58951.1| hypothetical protein B456_009G232000 [Gossypium raimondii]
Length=611

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 196/234 (84%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL  LA  F  FKELVL CC+ FGTSGLA    +CR+L+VLDLI+ +V
Sbjct  145  KVHLKRMSVTDDDLATLAELFLGFKELVLVCCDGFGTSGLAIFVSKCRQLKVLDLIESEV  204

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDE DWISCFPE ++ LESLIFDCVEC +NF+AL++LV RSPSLKKLKLNR+VSI QLY
Sbjct  205  SDDETDWISCFPEGESNLESLIFDCVECHINFEALDRLVARSPSLKKLKLNRYVSIGQLY  264

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF  S+   + + E DY +AFAAC+SLV LSGFREI+ DYLPAIY
Sbjct  265  RLMVRAPQLTHLGTGSFSPSDIAGQGDQEPDYVAAFAACRSLVCLSGFREIIPDYLPAIY  324

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+I+A+QLKP+I  CHKLQ  WVLDS+CDEGL+AVAATCKD
Sbjct  325  PVCANLTSLNFSYANITADQLKPIISKCHKLQTFWVLDSICDEGLQAVAATCKD  378



>gb|KJB64196.1| hypothetical protein B456_010G036400 [Gossypium raimondii]
Length=615

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 197/234 (84%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V+++DL  LA SF  FKELVL CC+ FGTSGL+    +CR+L+VLDLI+ +V
Sbjct  149  KVYLKRMSVTDDDLATLAESFLGFKELVLVCCDGFGTSGLSIFVSKCRQLKVLDLIESEV  208

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDE DWI CFPE ++ LESLIFDCVE  +NF+ALE+LV RSPSLKKLKLNR+VSI QLY
Sbjct  209  SDDETDWILCFPEGESHLESLIFDCVEYPINFEALERLVARSPSLKKLKLNRYVSIGQLY  268

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM++APQLT LGTGSF  SE   + + E DY +AFAACKSLV LSGFREI+ DYLPAIY
Sbjct  269  RLMVQAPQLTHLGTGSFSPSEIAGQGDQEPDYVTAFAACKSLVCLSGFREIIPDYLPAIY  328

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            P+C NLT+LNFSYA+I+AEQLKP+I +CHKLQ+ WVLDS+CDEGL+AVAATCK+
Sbjct  329  PICANLTSLNFSYANITAEQLKPIISNCHKLQVFWVLDSICDEGLQAVAATCKE  382



>ref|XP_009597676.1| PREDICTED: transport inhibitor response 1-like protein [Nicotiana 
tomentosiformis]
Length=623

 Score =   338 bits (868),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 197/233 (85%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KLYLKR+ ++++DL +LAR FP FKELVL CCE FGTSGLA +A +CR++RVLDLI+ +V
Sbjct  156  KLYLKRMSITDDDLSLLARCFPYFKELVLVCCEGFGTSGLAIIARDCRQIRVLDLIESEV  215

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWIS FPE KT LESL FDCVEC ++F+ALE+LV+RSPSLK+L+LNR VSI QLY
Sbjct  216  SDDEVDWISFFPENKTGLESLTFDCVECPIDFEALERLVIRSPSLKRLRLNRFVSITQLY  275

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM+RAPQLT+LGTGSFG S    + + DY SAF+ACKS+V LSGFREI  +YLPAIYPV
Sbjct  276  RLMIRAPQLTNLGTGSFGPSILIDDQDPDYASAFSACKSIVCLSGFREIAPEYLPAIYPV  335

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LNFSYA+ ++ EQ K VI  CHKLQ+LWV DSVCDEGL+AVAATCKD
Sbjct  336  CCNLTSLNFSYAANLNTEQFKSVISRCHKLQVLWVFDSVCDEGLQAVAATCKD  388



>gb|KGN60246.1| hypothetical protein Csa_3G890020 [Cucumis sativus]
Length=737

 Score =   341 bits (875),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 190/234 (81%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLI  DV
Sbjct  152  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVAARCRHLRVLDLIASDV  211

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +TCLESLIF+CVE  +NF+ALE+LV RSPSLKKL +NRHVSI QLY
Sbjct  212  GDDEVDWISCFPEKETCLESLIFECVEWPINFEALERLVSRSPSLKKLGVNRHVSIAQLY  271

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            +LM+RAP+LT LGTGSF   E     E E DY S FAAC SLV LSGF+++L DYLP IY
Sbjct  272  QLMIRAPRLTHLGTGSFNTLEAVIHGESEPDYASVFAACNSLVCLSGFKDVLPDYLPCIY  331

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN SYA+I+ EQLKP I HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  332  PVCANLTTLNLSYANITPEQLKPAIRHCHKLQTFWALDSICDEGLQAVASTCKE  385



>ref|XP_004136426.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis 
sativus]
Length=623

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 192/234 (82%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++YLKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA  CR LRVLDLI+ DV
Sbjct  150  RVYLKRMSVTDDDLALLADSFPGFKELVLFCCEGFGTSGIAVVAARCRHLRVLDLIESDV  209

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +TCLESLIFDCVE  +NF+AL++LV RSPSLKKL +NR+VSI QLY
Sbjct  210  ADDEVDWISCFPEKETCLESLIFDCVEFPINFEALQRLVSRSPSLKKLGVNRYVSIAQLY  269

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
             LM+ AP+LT LGTGSF  SE     + E D+ SAFAACKSLV LSGF++IL DYLP IY
Sbjct  270  HLMIWAPRLTHLGTGSFSTSEAVVHGDSEPDFASAFAACKSLVCLSGFKDILPDYLPCIY  329

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLTTLN S+A+I+ EQLKP I HCHKLQ  W LDS+CDEGL+AVA+TCK+
Sbjct  330  PVCANLTTLNLSFANITPEQLKPAIRHCHKLQTFWALDSICDEGLQAVASTCKE  383



>ref|XP_007018160.1| Auxin F-box protein 5 isoform 1 [Theobroma cacao]
 gb|EOY15385.1| Auxin F-box protein 5 isoform 1 [Theobroma cacao]
Length=640

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 198/255 (78%), Gaps = 23/255 (9%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECR------------  144
            K+YLKR+ V+++DL  LA SF  FKELVL CC+ FGTSGLA    +CR            
Sbjct  153  KVYLKRMSVTDDDLATLAESFSGFKELVLVCCDGFGTSGLAIFVSKCRLNFLDLLCFFFD  212

Query  145  ---------KLRVLDLIDCDVKDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLV  297
                     +LRVLDLI+ +V DDE DWISCFPE ++ LESLIFDCVEC +NF+ALE+LV
Sbjct  213  LGMDWEMETQLRVLDLIESEVTDDETDWISCFPEGESHLESLIFDCVECPINFEALERLV  272

Query  298  MRSPSLKKLKLNRHVSIVQLYRLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAAC  471
             RSPSLKKL+LNRHVSI QLYRLM+RAPQLT LGTGSF   E   + + E DY +AFAAC
Sbjct  273  ARSPSLKKLRLNRHVSIGQLYRLMIRAPQLTHLGTGSFSPLEVAGQGDQEPDYVTAFAAC  332

Query  472  KSLVYLSGFREILADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDS  651
            +SLV LSGFREI+ DYLPAIYPVC+NLT+LNFSYA+I AEQLKP+I +CHKLQ+ WVLDS
Sbjct  333  RSLVCLSGFREIIPDYLPAIYPVCSNLTSLNFSYANIDAEQLKPIISNCHKLQVFWVLDS  392

Query  652  VCDEGLKAVAATCKD  696
            +CDEGL+AVAATCK+
Sbjct  393  ICDEGLQAVAATCKE  407



>ref|XP_003615232.1| F-box family protein [Medicago truncatula]
 gb|AES98190.1| transport inhibitor response protein, putative [Medicago truncatula]
Length=617

 Score =   332 bits (852),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 199/236 (84%), Gaps = 5/236 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR++V+++DL ++A SF  F+EL+L CCE FGT GLA +A +CR LRVL+L++  +
Sbjct  151  KLHLKRMNVTDDDLGVIADSFAGFRELLLVCCEGFGTPGLAAIASKCRLLRVLELVESVI  210

Query  181  ---KDDEVDWISCFP-ETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
                D+EVDW+SCFP E +T LESL FDCVEC VNF+ALE+LV RSP+LKKL+LNR VS+
Sbjct  211  DAENDEEVDWVSCFPIEGQTHLESLAFDCVECPVNFEALERLVARSPNLKKLRLNRSVSM  270

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPA  528
            VQL+RLMLRAPQLT LGTGSF A+E   + E DY SAFAAC+SLV LSGFREI  DYLPA
Sbjct  271  VQLHRLMLRAPQLTHLGTGSFCANEN-VDQEPDYASAFAACRSLVCLSGFREIWPDYLPA  329

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            I+PVC NLT+LNFSYA ++AEQLK VICHCHKLQILWVLDS+CDEGL+AVAATCKD
Sbjct  330  IFPVCANLTSLNFSYADVNAEQLKSVICHCHKLQILWVLDSICDEGLQAVAATCKD  385



>ref|XP_007141239.1| hypothetical protein PHAVU_008G179000g [Phaseolus vulgaris]
 gb|ESW13233.1| hypothetical protein PHAVU_008G179000g [Phaseolus vulgaris]
Length=628

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 194/237 (82%), Gaps = 5/237 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR++VS+ DL +LA SF  F+ELVL CCE FGT GLA VA +CR LRVL+L++  V
Sbjct  158  KLHLKRMNVSDADLALLADSFSTFRELVLVCCEGFGTPGLANVAAKCRLLRVLELVESVV  217

Query  181  K---DDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +   D+E+DWISCFPE++T +ESL+FDCVEC +NF+ALE LV RSP LKKL+LN+ VS+ 
Sbjct  218  EAEDDEEIDWISCFPESQTNMESLVFDCVECPINFEALESLVARSPRLKKLRLNQFVSMA  277

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEE--AELELDYTSAFAACKSLVYLSGFREILADYLP  525
            QL+RL+LRAPQLT LGTGSF A+E     ELE DYT+ F AC+SLV LSGFREI ADYLP
Sbjct  278  QLHRLLLRAPQLTHLGTGSFSATEPGVVGELEPDYTATFEACRSLVCLSGFREIWADYLP  337

Query  526  AIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            AIYPVC NLT+LN SYA ++A QLK VI  CHKLQI WVLDS+CDEGL+AVAATCKD
Sbjct  338  AIYPVCANLTSLNLSYADVNAHQLKAVIRLCHKLQIFWVLDSICDEGLQAVAATCKD  394



>ref|XP_010266476.1| PREDICTED: transport inhibitor response 1-like protein isoform 
X2 [Nelumbo nucifera]
Length=510

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V++EDL++LA SFP FKELVL CC+ FGT+GLA VA  CR+LRVLDLID +V
Sbjct  161  KIYLKRVSVTDEDLILLAHSFPAFKELVLVCCDGFGTAGLAAVA-RCRQLRVLDLIDDEV  219

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             +D+VDWISCFPE+ TCLESLIFDCVE  VNF ALE+LV RSPSLK+LKLNRHV+++QL+
Sbjct  220  NEDDVDWISCFPESVTCLESLIFDCVESPVNFDALERLVARSPSLKRLKLNRHVNLMQLH  279

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYT-SAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF  S+  A+ + +   SAFA  KSLV LSGFR+I+ DYLPAIYP
Sbjct  280  RLMVRAPQLTHLGTGSFSTSDNPAQADQEPDLSAFATSKSLVCLSGFRDIVPDYLPAIYP  339

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC  LT+LNFSYA+I+AEQL+PVIC C+ LQ LWVLDSVCDEGL+AVAATCK+
Sbjct  340  VCARLTSLNFSYANINAEQLRPVICQCYNLQTLWVLDSVCDEGLQAVAATCKE  392



>ref|XP_004490408.1| PREDICTED: transport inhibitor response 1-like protein-like [Cicer 
arietinum]
Length=625

 Score =   328 bits (841),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 195/236 (83%), Gaps = 5/236 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ V++++L ++A SF  F+EL+L CCE FGT GLA +A +CR LRVL+L++  +
Sbjct  159  KLHLKRMTVTDDNLAVIADSFAGFRELLLVCCEGFGTPGLAAIAAKCRLLRVLELVESVI  218

Query  181  K---DDEVDWISCFP-ETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
            +   D+EVDW+SCFP E +T LESL FDCVEC VNF+ALE LV RSP LKKL+LNR VS+
Sbjct  219  EVEDDEEVDWVSCFPNEGQTHLESLAFDCVECPVNFEALEGLVARSPCLKKLRLNRSVSM  278

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPA  528
             QL+RLMLRAPQLT LGTGSF A+E   + E DY SAFAAC+SLV LSGFREI  DYLPA
Sbjct  279  AQLHRLMLRAPQLTHLGTGSFSANEN-VDQEPDYASAFAACRSLVCLSGFREIWPDYLPA  337

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            IYPVC NLT+LNFSYA ++AEQLK VICHCH LQILWVLDSVCD+GL+AVAATCKD
Sbjct  338  IYPVCANLTSLNFSYADVNAEQLKSVICHCHNLQILWVLDSVCDDGLQAVAATCKD  393



>ref|XP_010441379.1| PREDICTED: transport inhibitor response 1-like protein [Camelina 
sativa]
Length=636

 Score =   328 bits (841),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A VA +CRKL+VLDLI+ +V
Sbjct  171  KVDLKRMFVTDDDLALLADSFPGFKELILVCCEGFGTSGIAIVANKCRKLKVLDLIESEV  230

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  TCLESL FDCVE  +NF+ALE LV RSP LKKL+LNR VS+V+L+
Sbjct  231  TDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPFLKKLRLNRFVSLVELH  290

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+L APQLT LGTGSF   EE ++E E DY +AF+ACKS+V LSGFRE++ +YLPAIYP
Sbjct  291  RLLLGAPQLTSLGTGSFSHDEEPQSEQEPDYAAAFSACKSVVCLSGFRELMPEYLPAIYP  350

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQ+ W LDS+CDEGL+AVA TCK+
Sbjct  351  VCANLTSLNFSYANISPDMFKPIIQNCHKLQVFWALDSICDEGLQAVAETCKE  403



>ref|XP_010530111.1| PREDICTED: transport inhibitor response 1-like protein [Tarenaya 
hassleriana]
Length=629

 Score =   328 bits (840),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 193/233 (83%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA  FP FKEL L CCE FGTSG+A VA +CR+LRVLDLI+ +V
Sbjct  165  KVHLKRMFVTDDDLALLAEGFPGFKELSLVCCEGFGTSGIAMVASKCRQLRVLDLIESEV  224

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +  LESL FDCVE  +NF+ALE+LV+RSP L+KL++NR VSI +L+
Sbjct  225  TDDEVDWISCFPEGEIHLESLTFDCVEAPINFEALERLVIRSPFLRKLRVNRFVSIEELH  284

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQ+T +GTGSF      + ELE DY SAF ACKS+V LSGFRE++ +YLPAIYP
Sbjct  285  RLMVRAPQITSIGTGSFSPDNMPDPELETDYASAFRACKSIVCLSGFRELMPEYLPAIYP  344

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+I+ E LKPVI +CHKLQ+ W LDS+CDEGL+AVAATCK+
Sbjct  345  VCANLTSLNFSYANITPEMLKPVIRNCHKLQVFWTLDSICDEGLQAVAATCKE  397



>ref|XP_006280173.1| hypothetical protein CARUB_v10026074mg [Capsella rubella]
 gb|EOA13071.1| hypothetical protein CARUB_v10026074mg [Capsella rubella]
Length=635

 Score =   328 bits (840),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 193/233 (83%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A VA +CRKL+VLDLI+ +V
Sbjct  170  KVDLKRMFVTDDDLALLAESFPGFKELILVCCEGFGTSGIAIVANKCRKLKVLDLIESEV  229

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  TCLESL FDCVE  +NF+ALE LV RSP LKKL+LNR VS+V+L+
Sbjct  230  TDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPCLKKLRLNRFVSLVELH  289

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+L APQLT LGTGSF   EE ++E E DY +AF ACKS+V LSGFRE++ +YLPAIYP
Sbjct  290  RLLLGAPQLTSLGTGSFSHDEEPQSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIYP  349

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQ+ W LDS+CDEGL+AVA TCK+
Sbjct  350  VCANLTSLNFSYANISPDMFKPIIHNCHKLQVFWALDSICDEGLQAVAETCKE  402



>ref|XP_010445996.1| PREDICTED: transport inhibitor response 1-like protein [Camelina 
sativa]
Length=626

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 193/233 (83%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A VA +CRKL+VLDLI+ +V
Sbjct  172  KVDLKRMFVTDDDLALLAESFPGFKELILVCCEGFGTSGIAIVANKCRKLKVLDLIESEV  231

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  TCLESL FDCVE  +NF+ALE LV RSP LKKL+LNR VS+V+L+
Sbjct  232  TDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPFLKKLRLNRFVSLVELH  291

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+L APQLT LGTGSF   EE ++E E DY +AF ACKS+V LSGFRE++ +YLPAIYP
Sbjct  292  RLLLGAPQLTSLGTGSFSHDEEPQSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIYP  351

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQ+ W LDS+CDEGL+AVA TCK+
Sbjct  352  VCANLTSLNFSYANISPDMFKPIIQNCHKLQVFWALDSICDEGLQAVAETCKE  404



>ref|NP_568718.1| auxin F-box protein 5 [Arabidopsis thaliana]
 sp|Q9LTX2.1|TIR1L_ARATH RecName: Full=Transport inhibitor response 1-like protein; Short=TIR1-like 
protein [Arabidopsis thaliana]
 dbj|BAA97019.1| transport inhibitor response 1 protein [Arabidopsis thaliana]
 gb|AAL08287.1| AT5g49980/K9P8_12 [Arabidopsis thaliana]
 gb|AAM98092.1| AT5g49980/K9P8_12 [Arabidopsis thaliana]
 gb|AAO42782.1| AT5g49980/K9P8_12 [Arabidopsis thaliana]
 gb|AED95880.1| auxin F-box protein 5 [Arabidopsis thaliana]
Length=619

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG++ VA +CRKL+VLDLI+ +V
Sbjct  154  KVDLKRMFVTDDDLALLADSFPGFKELILVCCEGFGTSGISIVANKCRKLKVLDLIESEV  213

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  TCLESL FDCVE  +NF+ALE LV RSP LKKL+LNR VS+V+L+
Sbjct  214  TDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPFLKKLRLNRFVSLVELH  273

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+L APQLT LGTGSF   EE ++E E DY +AF ACKS+V LSGFRE++ +YLPAI+P
Sbjct  274  RLLLGAPQLTSLGTGSFSHDEEPQSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIFP  333

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQ+ W LDS+CDEGL+AVAATCK+
Sbjct  334  VCANLTSLNFSYANISPDMFKPIILNCHKLQVFWALDSICDEGLQAVAATCKE  386



>ref|XP_002865768.1| auxin F-box protein 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42027.1| auxin F-box protein 5 [Arabidopsis lyrata subsp. lyrata]
Length=608

 Score =   326 bits (835),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 192/233 (82%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A V  +CRKL+VLDLI+ +V
Sbjct  143  KVDLKRMFVTDDDLALLADSFPGFKELILVCCEGFGTSGIAIVTNKCRKLKVLDLIESEV  202

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  TCLESL FDCVE  +NF+ALE LV RSP LKKL+LNR VS+V+L+
Sbjct  203  TDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPFLKKLRLNRFVSLVELH  262

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+L APQLT LGTGSF   EE  +E E DY +AF ACKS+V LSGFRE++ +YLPAI+P
Sbjct  263  RLLLGAPQLTSLGTGSFSHDEEPRSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIFP  322

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQ+ W LDS+CDEGL+AVAATCK+
Sbjct  323  VCANLTSLNFSYANISPDMFKPIILNCHKLQVFWALDSICDEGLQAVAATCKE  375



>gb|KHN09006.1| Transport inhibitor response 1-like protein [Glycine soja]
Length=491

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 195/236 (83%), Gaps = 6/236 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDC--  174
            KL+LKR+ +++ DL++L+ SFP+F++LVL CCE FGT+GLA +   CR LRVL+L++C  
Sbjct  26   KLHLKRMSLTDHDLILLSHSFPSFQDLVLTCCEGFGTTGLAALTSNCRLLRVLELVECVV  85

Query  175  DVKDDEVDWISCFPET--KTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
            +V D+E+DWISCFPE+  +T LESL+FDCVEC VNF ALE+LV RSP L+KL+LNR+VS+
Sbjct  86   EVGDEEMDWISCFPESDAQTHLESLVFDCVECPVNFDALERLVARSPLLRKLRLNRYVSM  145

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPA  528
             QL+RLM RAPQLT LGTGSF ASE + EL  D+ SAFA+CKSLV LSGFRE  ADYLPA
Sbjct  146  SQLHRLMHRAPQLTHLGTGSFSASELDQEL--DFASAFASCKSLVCLSGFREFWADYLPA  203

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            IYP C NL +LNFS+A ISA+QLK VI HCHKLQ  WVLD++CDEGL+AVA TCKD
Sbjct  204  IYPACANLISLNFSFADISADQLKSVIRHCHKLQTFWVLDTICDEGLQAVAETCKD  259



>ref|XP_010266465.1| PREDICTED: transport inhibitor response 1-like protein isoform 
X1 [Nelumbo nucifera]
Length=625

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ V++EDL++LA SFP FKELVL CC+ FGT+GLA VA  CR+LRVLDLID +V
Sbjct  161  KIYLKRVSVTDEDLILLAHSFPAFKELVLVCCDGFGTAGLAAVA-RCRQLRVLDLIDDEV  219

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             +D+VDWISCFPE+ TCLESLIFDCVE  VNF ALE+LV RSPSLK+LKLNRHV+++QL+
Sbjct  220  NEDDVDWISCFPESVTCLESLIFDCVESPVNFDALERLVARSPSLKRLKLNRHVNLMQLH  279

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYT-SAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF  S+  A+ + +   SAFA  KSLV LSGFR+I+ DYLPAIYP
Sbjct  280  RLMVRAPQLTHLGTGSFSTSDNPAQADQEPDLSAFATSKSLVCLSGFRDIVPDYLPAIYP  339

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC  LT+LNFSYA+I+AEQL+PVIC C+ LQ LWVLDSVCDEGL+AVAATCK+
Sbjct  340  VCARLTSLNFSYANINAEQLRPVICQCYNLQTLWVLDSVCDEGLQAVAATCKE  392



>ref|XP_010482301.1| PREDICTED: transport inhibitor response 1-like protein [Camelina 
sativa]
Length=637

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 192/233 (82%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A VA +CRKL+VLDLI+ +V
Sbjct  172  KVDLKRMFVTDDDLALLADSFPGFKELILVCCEGFGTSGIAIVANKCRKLKVLDLIESEV  231

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  TCLESL FDCVE  +NF+ALE LV RSP LKKL+LNR VS+V+L+
Sbjct  232  NDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALECLVARSPFLKKLRLNRFVSLVELH  291

Query  361  RLMLRAPQLTDLGTGSFGASEEE-AELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+L APQLT LGTGSF   EE  +E E DY +AF ACKS+V LSGFRE++ +YLPAIYP
Sbjct  292  RLLLGAPQLTSLGTGSFSHDEEPLSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIYP  351

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQ+ W LDS+CDEGL+AVA TCK+
Sbjct  352  VCANLTSLNFSYANISPDMFKPIIQNCHKLQVFWALDSICDEGLQAVAETCKE  404



>ref|XP_010525658.1| PREDICTED: transport inhibitor response 1-like protein [Tarenaya 
hassleriana]
Length=626

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 192/233 (82%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SFP FKEL L CC+ FGTSG+A VA +CR+LRVLDLI+ +V
Sbjct  163  KVHLKRMFVTDDDLALLAESFPGFKELSLVCCDGFGTSGIAMVASKCRQLRVLDLIESEV  222

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  T LESL FDCVE  +NFQALE+LV+RSP LKKL++NR VSI QL+
Sbjct  223  TDDEVDWISCFPEGGTHLESLTFDCVEAPINFQALERLVIRSPFLKKLRVNRFVSIEQLH  282

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RA QL  LGTGSF      + E E+DY SAF ACKS+V LSGFRE++ +YLPAIYP
Sbjct  283  RLMVRALQLMSLGTGSFSPDNMPDPEQEMDYASAFRACKSIVCLSGFRELMPEYLPAIYP  342

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+I+ E  KPVI +CHKLQ++W +DS+CDEGL+AVAA+C++
Sbjct  343  VCANLTSLNFSYANITPEMFKPVIRNCHKLQVIWTMDSICDEGLQAVAASCRE  395



>ref|XP_003526541.1| PREDICTED: transport inhibitor response 1-like protein-like [Glycine 
max]
Length=587

 Score =   322 bits (826),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 195/236 (83%), Gaps = 6/236 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDC--  174
            KL+LKR+ +++ DL++L+ SFP+F++LVL CCE FGT+GLA +   CR LRVL+L++C  
Sbjct  122  KLHLKRMSLTDHDLILLSHSFPSFQDLVLTCCEGFGTTGLAALTSNCRLLRVLELVECVV  181

Query  175  DVKDDEVDWISCFPET--KTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
            +V D+E+DWISCFPE+  +T LESL+FDCVEC VNF ALE+LV RSP L+KL+LNR+VS+
Sbjct  182  EVGDEEMDWISCFPESDAQTHLESLVFDCVECPVNFDALERLVARSPLLRKLRLNRYVSM  241

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPA  528
             QL+RLM RAPQLT LGTGSF ASE   + ELD+ SAFA+CKSLV LSGFRE  ADYLPA
Sbjct  242  SQLHRLMHRAPQLTHLGTGSFSASE--LDQELDFASAFASCKSLVCLSGFREFWADYLPA  299

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            IYP C NL +LNFS+A ISA+QLK VI HCHKLQ  WVLD++CDEGL+AVA TCKD
Sbjct  300  IYPACANLISLNFSFADISADQLKSVIRHCHKLQTFWVLDTICDEGLQAVAETCKD  355



>gb|KFK26632.1| hypothetical protein AALP_AA8G273700 [Arabis alpina]
Length=616

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 191/233 (82%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKRI V+++DL +LA SFP+FKEL+L CCE FGT+G+A VA +CRKL+VLDLI+ +V
Sbjct  151  KVDLKRIFVTDDDLALLAHSFPSFKELILVCCEGFGTTGIAIVANKCRKLKVLDLIESEV  210

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE  T LESL FDCVE  +NFQALE LV RSPSL+KL+LNR VS+ +L+
Sbjct  211  TDDEVDWISCFPEDVTNLESLAFDCVEAPINFQALESLVARSPSLRKLRLNRFVSLEELH  270

Query  361  RLMLRAPQLTDLGTGSFGA-SEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+L AP LT LGTGSF   +  +++ E DY +AF ACKS+V LSGFRE++ +YLPAI+P
Sbjct  271  RLLLGAPHLTSLGTGSFSHDNAPQSDQESDYAAAFRACKSVVCLSGFRELMPEYLPAIFP  330

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQ+ W LDS+CDEGL AVAATCK+
Sbjct  331  VCANLTSLNFSYANISPDMFKPIIHNCHKLQVFWALDSICDEGLLAVAATCKE  383



>gb|KDO81096.1| hypothetical protein CISIN_1g044749mg [Citrus sinensis]
Length=413

 Score =   311 bits (797),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 179/215 (83%), Gaps = 3/215 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+YLKR+ ++++DL +LA SF  FKEL L CCE FGT GLA +A +CR+LRVLDLI+ +V
Sbjct  171  KVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEV  230

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWIS FPE +TCLESLIFDCV+C +NF+ALE+LV RSP L+KL+LNRHVSI QLY
Sbjct  231  TDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLY  290

Query  361  RLMLRAPQLTDLGTGSFGASE---EEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RLM+RAPQLT LGTG +G SE    + + E DY +AFAACKSLV LSGFREI  DYL AI
Sbjct  291  RLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAI  350

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQIL  636
            YPVC NLT+LNFSYA+I+A+QLKPVIC+CHKLQI 
Sbjct  351  YPVCANLTSLNFSYATITADQLKPVICNCHKLQIF  385



>ref|XP_003523780.1| PREDICTED: transport inhibitor response 1-like protein-like [Glycine 
max]
Length=583

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 192/236 (81%), Gaps = 6/236 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDC--  174
            KL+LKR+ +++ DL +L+ S P+F++L+L CCE FGT+ LA +A  CR LRVL+L++C  
Sbjct  118  KLHLKRMSLTDHDLTLLSHSLPSFQDLLLTCCEGFGTTALAALASNCRLLRVLELVECVV  177

Query  175  DVKDDEVDWISCFPE--TKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
            +V D+E+DWISCFPE   +T LESL+FDCVEC +N +ALE+LV RSPSL+KL+LNR+VS+
Sbjct  178  EVGDEELDWISCFPEIDAQTYLESLVFDCVECPINLEALERLVARSPSLRKLRLNRYVSM  237

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPA  528
             QL+RLM RAPQLT LGTGSF ASE + EL  D+ SAFAACKSLV LSGFREI  DYLPA
Sbjct  238  SQLHRLMHRAPQLTHLGTGSFSASELDQEL--DFASAFAACKSLVCLSGFREIWPDYLPA  295

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            IYP C NL +LNFSYA ISA+QL  VI HCHKLQ  WVLD++CDEGL+AVA TCKD
Sbjct  296  IYPACANLISLNFSYADISADQLISVIRHCHKLQTFWVLDTICDEGLQAVAETCKD  351



>emb|CDY21439.1| BnaC03g27580D [Brassica napus]
Length=604

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 189/233 (81%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A VA +CRKL+VLDLI+ +V
Sbjct  139  KVDLKRMFVTDDDLALLAESFPGFKELILVCCEGFGTSGIAVVANKCRKLKVLDLIESEV  198

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDW+SCFPE  TCLESL FDCVE  +NF+ALE LV RSP L+KL+LNR VS+ +++
Sbjct  199  TDDEVDWVSCFPEDVTCLESLAFDCVEAPINFKALEGLVGRSPLLRKLRLNRFVSLEEVH  258

Query  361  R-LMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            R L+L APQLT LGTGSF   ++  +   DY +AF ACKSLV LSGFRE++ +YLPAI P
Sbjct  259  RLLLLGAPQLTSLGTGSFSRGDQSQQEPPDYAAAFRACKSLVCLSGFRELMPEYLPAILP  318

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS +  KP+I +CHKLQI W LDS+CDEGL+AVAATCK+
Sbjct  319  VCANLTSLNFSYANISPDMFKPIIHNCHKLQIFWALDSICDEGLQAVAATCKE  371



>ref|XP_009138011.1| PREDICTED: F-box protein FBX14 [Brassica rapa]
Length=607

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 190/234 (81%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ VS++DL +LA SFP FKELVL CCE FGTSG+A VA +CR+L+VLDLI+ +V
Sbjct  135  KVSLKRMFVSDDDLALLAVSFPGFKELVLLCCEGFGTSGVAVVANKCRQLKVLDLIESEV  194

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +T LESL FDCVE  +NF+ALE LV+RSP LKKL+ NR VS+ +L+
Sbjct  195  TDDEVDWISCFPEGETHLESLSFDCVESPINFKALEGLVVRSPCLKKLRTNRFVSLEELH  254

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
             LM+RAPQLT LGTG+F ++ +  + E E DY SAF AC+SLV LSGFRE+ A+YLPAI 
Sbjct  255  TLMVRAPQLTSLGTGAFSSTHDGAQGEQEPDYASAFRACRSLVCLSGFRELTAEYLPAIS  314

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+IS +  KP+I +CH +++ W LDS+CDEGL+AVA TCK+
Sbjct  315  PVCANLTSLNFSYANISPDVFKPIIRNCHNIRVFWALDSICDEGLQAVAETCKE  368



>emb|CDY34286.1| BnaA01g13890D [Brassica napus]
Length=609

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 189/235 (80%), Gaps = 3/235 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ VS++DL +LA SFP FKELVL CCE FGTSG+A VA +CR+L+VLDLI+ +V
Sbjct  136  KVSLKRMFVSDDDLALLAVSFPGFKELVLLCCEGFGTSGVAVVANKCRQLKVLDLIESEV  195

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +T LESL FDCVE  +NF+ALE LV+RSP L+KL+ NR VS+ +L+
Sbjct  196  TDDEVDWISCFPEGETHLESLSFDCVESPINFKALEGLVVRSPCLRKLRTNRFVSLEELH  255

Query  361  RLMLRAPQLTDLGTGSFGASEE---EAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
             LM+RAPQLT LGTGSF +S     + E E DY SAF AC+SLV LSGFRE+ A+YLPAI
Sbjct  256  TLMVRAPQLTSLGTGSFSSSTHDGAQGEQEPDYASAFRACRSLVCLSGFRELTAEYLPAI  315

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             PVC NLT+LNFSYA+IS +  KP+I +CH +++ W LDS+CDEGL+A+A TCK+
Sbjct  316  SPVCANLTSLNFSYANISPDVFKPIIRNCHNIRVFWALDSICDEGLQALAETCKE  370



>emb|CDY03450.1| BnaC01g16320D [Brassica napus]
Length=610

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 188/234 (80%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ VS++DL +LA SFP FKELVL CCE FGTSG+A VA +CR+L+VLDLI+ +V
Sbjct  134  KVSLKRMFVSDDDLALLAASFPGFKELVLLCCEGFGTSGVAVVANKCRQLKVLDLIESEV  193

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +T LESL FDCVE  +NF+ALE LV+RSP LKKL+ NR VS+ +L+
Sbjct  194  TDDEVDWISCFPEGETHLESLSFDCVESPINFKALEGLVVRSPFLKKLRTNRFVSLEELH  253

Query  361  RLMLRAPQLTDLGTGSFGASEE--EAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
             LM+RAPQLT LGTG+F ++ +  + E E DY SAF AC+SLV LSGFRE+  +YLPAI 
Sbjct  254  TLMVRAPQLTSLGTGAFSSTHDGAQGEQEPDYASAFRACRSLVCLSGFRELTVEYLPAIS  313

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+IS +  KP+I +CH +++ W LDS+ DEGL+AVA TCK+
Sbjct  314  PVCANLTSLNFSYANISPDVFKPIIRNCHNIRVFWALDSIGDEGLQAVAETCKE  367



>ref|XP_010448570.1| PREDICTED: F-box protein FBX14-like [Camelina sativa]
Length=633

 Score =   308 bits (788),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 188/233 (81%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SFP FKEL L CCE FGTSG+A VA +CR+L+VLDL++ +V
Sbjct  164  KVHLKRMFVTDDDLALLAESFPGFKELTLVCCEGFGTSGIAVVANKCRQLKVLDLLESEV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDW+SCFP ++T LESL FDCVE  +NF+ALE+LV+RSP LKKL+ NR VS+  L+
Sbjct  224  TDDEVDWLSCFPASETHLESLSFDCVESPINFKALEELVVRSPFLKKLRTNRFVSLEVLH  283

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF      + E E DY +AF ACKS+  LSGFR++  +YLPAI P
Sbjct  284  RLMVRAPQLTSLGTGSFSPENVLQGEQEPDYAAAFRACKSISCLSGFRDLTPEYLPAISP  343

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS + LKP+I +CH +++ W LDS+CDEGL+AVAATCK+
Sbjct  344  VCANLTSLNFSYANISPDMLKPIIRNCHNIRVFWALDSICDEGLQAVAATCKE  396



>ref|XP_006285271.1| hypothetical protein CARUB_v10006645mg [Capsella rubella]
 gb|EOA18169.1| hypothetical protein CARUB_v10006645mg [Capsella rubella]
Length=622

 Score =   307 bits (786),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 186/233 (80%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SFP FK+L L CCE FGTSG+A VA +CR+LRVLDL++ +V
Sbjct  154  KVHLKRMLVTDDDLALLADSFPGFKDLTLVCCEGFGTSGIAVVANKCRQLRVLDLLESEV  213

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFP  +T LESL FDCVE  +NF+ALE LV+RSP LKKL+ NR VS+ +L+
Sbjct  214  TDDEVDWISCFPAGETHLESLSFDCVESPINFKALEGLVVRSPFLKKLRTNRFVSLEELH  273

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF      +   E DY +AF ACKS+  LSGFRE+  +YLPAI P
Sbjct  274  RLMVRAPQLTSLGTGSFSPDNVPQGAQEPDYAAAFRACKSISCLSGFRELTPEYLPAISP  333

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS + LKP+I +CH +++ W LDS+CDEGL+AVAATCK+
Sbjct  334  VCANLTSLNFSYANISPDMLKPIIRNCHNIRVFWALDSICDEGLQAVAATCKE  386



>ref|XP_010272955.1| PREDICTED: transport inhibitor response 1-like protein [Nelumbo 
nucifera]
Length=627

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 196/233 (84%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V++++L +LA SFP FKELVL CC+ F T+GLA VA +CR+LRVLDLID +V
Sbjct  163  KVHLKRMSVTDDNLTLLAHSFPGFKELVLVCCDGFSTAGLAAVA-KCRQLRVLDLIDDEV  221

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             +D+VDWISCFPE  TCLESLIFDCVE  VNF+ALE+LV RSPSL++LKLNRHV++VQL 
Sbjct  222  IEDDVDWISCFPEPVTCLESLIFDCVESPVNFEALERLVARSPSLRRLKLNRHVNLVQLQ  281

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYT-SAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+R PQLT LGTGSF   +  A+++ +   SAFA CKSLV LSGFR+I+ DYL AIYP
Sbjct  282  RLMVRVPQLTHLGTGSFSTLDNPAQVDQEPDLSAFATCKSLVCLSGFRDIVPDYLSAIYP  341

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC+ LT+LNFSYA+I+AEQLK VI +CH LQ LWVLDSVCDEGL+AVAATCK+
Sbjct  342  VCSRLTSLNFSYANINAEQLKSVIRYCHNLQTLWVLDSVCDEGLQAVAATCKE  394



>emb|CDX83172.1| BnaA03g23340D [Brassica napus]
Length=607

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 189/234 (81%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA +CRKL+VLDLI+ +V
Sbjct  141  KVDLKRMFVTDDDLALLAESFPGFKELVLVCCEGFGTSGIAVVANKCRKLKVLDLIESEV  200

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDW+SCFPE  TCLESL FDCVE  +NF+ALE LV RSPSL+KL+LNR VS+ ++ 
Sbjct  201  TDDEVDWVSCFPEDVTCLESLAFDCVEAPINFKALEGLVGRSPSLRKLRLNRFVSLEEVR  260

Query  361  RLMLR-APQLTDLGTGSFGASEEEAELE-LDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RL+L  APQLT LGTGSF   ++  E E  DY +AF ACKS+V LSGFRE++ +YLPAI 
Sbjct  261  RLLLLGAPQLTSLGTGSFSRGDQSDEQEPPDYAAAFRACKSVVCLSGFRELMPEYLPAIL  320

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+IS +  KP+I  CHKLQI W LDS+CDEGL+AVAATCK+
Sbjct  321  PVCANLTSLNFSYANISPDMFKPIIHSCHKLQIFWALDSICDEGLQAVAATCKE  374



>ref|XP_010439045.1| PREDICTED: F-box protein FBX14 [Camelina sativa]
Length=633

 Score =   304 bits (779),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 187/233 (80%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SFP FK+L L CCE FGTSG+A VA +CR+L+VLDL++ +V
Sbjct  164  KVHLKRMFVTDDDLALLAESFPGFKDLTLVCCEGFGTSGIAVVANKCRQLKVLDLLESEV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDW+SCFP  +T LESL FDCVE  ++F ALE+LV+RSP LKKL+ NR VS+ +L+
Sbjct  224  TDDEVDWLSCFPAGETHLESLSFDCVESPISFNALEELVVRSPFLKKLRTNRFVSLEELH  283

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF      + E E DY +AF ACKS+  LSGFR++  +YLPAI P
Sbjct  284  RLMVRAPQLTSLGTGSFSPDNVLQGEQEPDYAAAFRACKSISCLSGFRDLTPEYLPAISP  343

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS + LKP+I +CH +++ W LDS+CDEGL+AVAATCK+
Sbjct  344  VCANLTSLNFSYANISPDMLKPIIRNCHNIRVFWALDSICDEGLQAVAATCKE  396



>ref|XP_009134037.1| PREDICTED: transport inhibitor response 1-like protein [Brassica 
rapa]
Length=607

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 188/234 (80%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKELVL CCE FGTSG+A VA +CRKL+VLDLI+ +V
Sbjct  141  KVDLKRMFVTDDDLALLAESFPGFKELVLVCCEGFGTSGIAVVANKCRKLKVLDLIESEV  200

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDW+SCFPE  TCLESL FDCVE  +NF+ALE LV RSPSL+KL+LNR VS+ +L 
Sbjct  201  TDDEVDWVSCFPEDVTCLESLAFDCVEAPINFKALEGLVGRSPSLRKLRLNRFVSLEELR  260

Query  361  RLMLR-APQLTDLGTGSFGASEEEAEL-ELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RL+L  APQLT LGTGSF   ++  E    DY +AF ACKS+V LSGFRE++ +YLPAI 
Sbjct  261  RLLLLGAPQLTSLGTGSFSRGDQSDEQGPPDYAAAFRACKSVVCLSGFRELMPEYLPAIL  320

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LNFSYA+IS +  KP+I  CHKLQI W LDS+CDEGL+AVAATCK+
Sbjct  321  PVCANLTSLNFSYANISPDMFKPIIHSCHKLQIFWALDSICDEGLQAVAATCKE  374



>ref|XP_010433773.1| PREDICTED: F-box protein FBX14-like [Camelina sativa]
Length=633

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 186/233 (80%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SFP FKEL L CCE FGTSG+A VA +CR+L+VLDL++ +V
Sbjct  164  KVHLKRMFVTDDDLALLAESFPGFKELTLVCCEGFGTSGMAVVANKCRQLKVLDLLESEV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDW+SCFP  +T LESL FDCVE  ++F ALE LV+RSP LKKL++NR VS+ +L+
Sbjct  224  TDDEVDWLSCFPAGETHLESLSFDCVESPISFNALEGLVVRSPFLKKLRMNRFVSLDELH  283

Query  361  RLMLRAPQLTDLGTGSFGASEE-EAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF      + E E DY +AF ACKS+  LSGFR++  + LPAI P
Sbjct  284  RLMVRAPQLTSLGTGSFSPDNVLQGEQEPDYAAAFRACKSITCLSGFRDLTPESLPAISP  343

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS + LKP+I +CH +++ W LD++CDEGL+AVAATCK+
Sbjct  344  VCANLTSLNFSYANISPDMLKPIIRNCHNIRVFWALDTICDEGLQAVAATCKE  396



>ref|XP_003519193.1| PREDICTED: transport inhibitor response 1-like protein-like [Glycine 
max]
Length=630

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 190/237 (80%), Gaps = 5/237 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ V++ DL ++A SF  F+ELVL CCE FGT GLA VA +CR LRVL+L++  V
Sbjct  160  KLHLKRMLVTDADLALIADSFAGFRELVLVCCEGFGTPGLAAVASKCRLLRVLELVESVV  219

Query  181  KDDEVD---WISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            + ++ +   WISCFPET+T +ESL+FDCVE  +NF+ALE LV RSP LKKL+LN+ VS+ 
Sbjct  220  EVEDDEEVDWISCFPETQTNMESLVFDCVEVPINFEALEGLVARSPRLKKLRLNQFVSMA  279

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEE--AELELDYTSAFAACKSLVYLSGFREILADYLP  525
            QLYRL+LRAPQLT LGTGSF A+E     + E DY +AF AC+SLV LSGFREI ADYLP
Sbjct  280  QLYRLLLRAPQLTHLGTGSFSATEAGVVGDQEPDYAAAFEACRSLVCLSGFREIWADYLP  339

Query  526  AIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            AIYPVC NLT+LN SYA I+ +QLK VICHCHKLQI WVLDS+ DEGL+AVAATCKD
Sbjct  340  AIYPVCANLTSLNLSYADINTDQLKSVICHCHKLQIFWVLDSIRDEGLQAVAATCKD  396



>emb|CAB45074.1| transport inhibitor response-like protein [Arabidopsis thaliana]
 emb|CAB79349.1| transport inhibitor response-like protein [Arabidopsis thaliana]
Length=614

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 185/233 (79%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SFP FKEL L CCE FGTSG+A VA +CR+L+VLDL++ +V
Sbjct  145  KVHLKRMFVTDDDLALLAESFPGFKELTLVCCEGFGTSGIAIVANKCRQLKVLDLMESEV  204

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDE+DWISCFPE +T LESL FDCVE  +NF+ALE+LV+RSP LKKL+ NR VS+ +L+
Sbjct  205  TDDELDWISCFPEGETHLESLSFDCVESPINFKALEELVVRSPFLKKLRTNRFVSLEELH  264

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF      + E + DY +AF ACKS+V LSGFRE   +YL AI  
Sbjct  265  RLMVRAPQLTSLGTGSFSPDNVPQGEQQPDYAAAFRACKSIVCLSGFREFRPEYLLAISS  324

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS   LKP+I +CH +++ W LDS+ DEGL+AVAATCK+
Sbjct  325  VCANLTSLNFSYANISPHMLKPIISNCHNIRVFWALDSIRDEGLQAVAATCKE  377



>ref|NP_567702.2| auxin signaling F-BOX 4 [Arabidopsis thaliana]
 ref|NP_974607.1| auxin signaling F-BOX 4 [Arabidopsis thaliana]
 sp|Q8RWQ8.1|FBX14_ARATH RecName: Full=F-box protein FBX14; AltName: Full=Transport inhibitor 
response 1-like protein; Short=TIR1-like protein [Arabidopsis 
thaliana]
 gb|AAM10320.1| AT4g24390/T22A6_220 [Arabidopsis thaliana]
 gb|AAP21148.1| At4g24390/T22A6_220 [Arabidopsis thaliana]
 dbj|BAH19581.1| AT4G24390 [Arabidopsis thaliana]
 gb|AEE84897.1| auxin signaling F-BOX 4 [Arabidopsis thaliana]
 gb|AEE84898.1| auxin signaling F-BOX 4 [Arabidopsis thaliana]
Length=623

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 185/233 (79%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V+++DL +LA SFP FKEL L CCE FGTSG+A VA +CR+L+VLDL++ +V
Sbjct  154  KVHLKRMFVTDDDLALLAESFPGFKELTLVCCEGFGTSGIAIVANKCRQLKVLDLMESEV  213

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDE+DWISCFPE +T LESL FDCVE  +NF+ALE+LV+RSP LKKL+ NR VS+ +L+
Sbjct  214  TDDELDWISCFPEGETHLESLSFDCVESPINFKALEELVVRSPFLKKLRTNRFVSLEELH  273

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM+RAPQLT LGTGSF      + E + DY +AF ACKS+V LSGFRE   +YL AI  
Sbjct  274  RLMVRAPQLTSLGTGSFSPDNVPQGEQQPDYAAAFRACKSIVCLSGFREFRPEYLLAISS  333

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS   LKP+I +CH +++ W LDS+ DEGL+AVAATCK+
Sbjct  334  VCANLTSLNFSYANISPHMLKPIISNCHNIRVFWALDSIRDEGLQAVAATCKE  386



>ref|XP_003544234.1| PREDICTED: transport inhibitor response 1-like protein-like [Glycine 
max]
Length=640

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 191/240 (80%), Gaps = 8/240 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ +++ DL ++A SF  F+ELVL CCE FGT GLA V  +CR LRVL+L++ +V
Sbjct  160  KLHLKRMLLTDADLALIADSFAAFRELVLVCCEGFGTPGLAVVVSKCRLLRVLELVESEV  219

Query  181  KDDEVD-WISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQL  357
            +DDE   WISCFPE++T LESL+FDCV+  +NF+ALE LV RSP LKKL+LNR+VS+ +L
Sbjct  220  EDDEEVDWISCFPESQTNLESLVFDCVDVPINFEALEGLVARSPRLKKLRLNRYVSMAEL  279

Query  358  YRLMLRAPQLTDLGTGSFGASE-------EEAELELDYTSAFAACKSLVYLSGFREILAD  516
            YRL+LRAPQLT LGTGSF A+E       E    E DY +AF AC+SLV LSGFREI AD
Sbjct  280  YRLLLRAPQLTHLGTGSFSATEAGAVGDQEPDYQEPDYAAAFEACRSLVCLSGFREIWAD  339

Query  517  YLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            YLPAIYPVCTNLT+LN SYA ++ +QLK VI HCHKLQI WVLDS+ DEGL+AVAATCKD
Sbjct  340  YLPAIYPVCTNLTSLNLSYADVNTDQLKSVIRHCHKLQIFWVLDSIRDEGLQAVAATCKD  399



>ref|XP_006413438.1| hypothetical protein EUTSA_v10024672mg [Eutrema salsugineum]
 gb|ESQ54891.1| hypothetical protein EUTSA_v10024672mg [Eutrema salsugineum]
Length=631

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 187/233 (80%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A  A +CR+L+VLDLI+ +V
Sbjct  164  KVNLKRMFVTDDDLALLAESFPGFKELILRCCEGFGTSGIALFANKCRQLKVLDLIESEV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +T LESL F+CVE  +NF+ALE LV+RSP LKKL+ +R VS+ +L+
Sbjct  224  TDDEVDWISCFPEGETHLESLSFECVESPINFKALEGLVLRSPFLKKLRTSRFVSLEELH  283

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM++A QLT LGTGSF  ++  + E E DY SAF A KS+V LSGFRE+  +YLPAI P
Sbjct  284  RLMVQASQLTSLGTGSFSPNDVPQGEQEPDYASAFRASKSIVCLSGFRELTPEYLPAISP  343

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LN SYA+IS + LKP+I +CH +++ W LDS+CDEGL+AVAATCK+
Sbjct  344  VCANLTSLNLSYANISPDILKPIIRNCHNIRVFWALDSICDEGLQAVAATCKE  396



>ref|XP_006413440.1| hypothetical protein EUTSA_v10024671mg [Eutrema salsugineum]
 gb|ESQ54893.1| hypothetical protein EUTSA_v10024671mg [Eutrema salsugineum]
Length=631

 Score =   300 bits (767),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 187/233 (80%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FKEL+L CCE FGTSG+A  A +CR+L+VLDLI+ +V
Sbjct  164  KVNLKRMFVTDDDLALLAESFPGFKELILRCCEGFGTSGIALFANKCRQLKVLDLIESEV  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWISCFPE +T LESL F+CVE  +NF+ALE LV+RSP LKKL+ +R VS+ +L+
Sbjct  224  TDDEVDWISCFPEGETHLESLSFECVESPINFKALEGLVLRSPFLKKLRTSRFVSLEELH  283

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RLM++A QLT LGTGSF  ++  + E E DY SAF A KS+V LSGFRE+  +YLPAI P
Sbjct  284  RLMVQASQLTSLGTGSFSPNDVPQGEQEPDYASAFRASKSIVCLSGFRELTPEYLPAISP  343

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LN SYA+IS + LKP+I +CH +++ W LDS+CDEGL+AVAATCK+
Sbjct  344  VCANLTSLNLSYANISPDILKPIIRNCHNIRVFWALDSICDEGLQAVAATCKE  396



>ref|XP_002867664.1| hypothetical protein ARALYDRAFT_492408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43923.1| hypothetical protein ARALYDRAFT_492408 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 182/233 (78%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL+LKR+ V+++DL +LA SFP FKEL L CCE FGTSG+A VA +CR+L+ LDL++ +V
Sbjct  135  KLHLKRMFVTDDDLALLAESFPGFKELTLVCCEGFGTSGIALVANKCRQLKALDLMESEV  194

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDEVDWI CFPE +T LESL FDCVE  +NF+ALE LV+RSP LKKL+ NR VS+ +L+
Sbjct  195  TDDEVDWIFCFPEGETHLESLSFDCVESPINFKALEGLVVRSPFLKKLRTNRFVSLEELH  254

Query  361  RLMLRAPQLTDLGTGSFGASE-EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
            +LM+RAPQLT LGTGSF      + E   DY SAF ACKS+V LSGFRE   +YL AI P
Sbjct  255  QLMVRAPQLTSLGTGSFSPDNVPQGEQLPDYASAFRACKSIVCLSGFREFRPEYLLAISP  314

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC NLT+LNFSYA+IS   LKP+I +CH +++ W LDS+ DEGL+AVAATCK+
Sbjct  315  VCANLTSLNFSYANISPHMLKPIIRNCHNIRVFWALDSIRDEGLQAVAATCKE  367



>emb|CDP01403.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   281 bits (720),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 157/185 (85%), Gaps = 2/185 (1%)
 Frame = +1

Query  148  LRVLDLIDCDVKDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLK  327
            +RVLDLI+ ++ +DEVDWISCFP+  TCLESLIFDCV+  +NF+ALE+LV++SPSLKKL+
Sbjct  13   IRVLDLIESELVEDEVDWISCFPQNGTCLESLIFDCVDSPINFEALERLVVKSPSLKKLR  72

Query  328  LNRHVSIVQLYRLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFR  501
            LNRHV+IVQLYRLM+RAPQLT L TGSFG  E   + E E DY SAFAACKSLV LSGFR
Sbjct  73   LNRHVTIVQLYRLMVRAPQLTHLRTGSFGPGEIVAQGEQEPDYVSAFAACKSLVCLSGFR  132

Query  502  EILADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVA  681
            EI A YLPAI PVC NLT+LN SYA+IS EQLK  I HCHKLQ LWVLDSVCDEGL+AVA
Sbjct  133  EINAHYLPAIVPVCANLTSLNLSYATISTEQLKSFIYHCHKLQTLWVLDSVCDEGLQAVA  192

Query  682  ATCKD  696
            ATCKD
Sbjct  193  ATCKD  197



>ref|XP_003602960.1| F-box family protein [Medicago truncatula]
 gb|AES73211.1| transport inhibitor response 1 protein [Medicago truncatula]
Length=594

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 182/242 (75%), Gaps = 10/242 (4%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDL----I  168
            K +LKR+ V+++DL +LA SF  FKELVL CCE FGT GLA VA +CR LRVLDL    +
Sbjct  121  KFHLKRMSVTDDDLSLLADSFVGFKELVLVCCEGFGTPGLAAVASKCRFLRVLDLEESMV  180

Query  169  DCDVKDDE--VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHV  342
            D +V D +  +DWISCFPE +T LESL FDCV+  +NF++LE+LV RSPSLK+L+LNRH+
Sbjct  181  DVNVSDYDGILDWISCFPEGETHLESLGFDCVDSPINFESLERLVARSPSLKRLRLNRHI  240

Query  343  SIVQLYRLMLRAPQLTDLGTGSFGASEEEAEL----ELDYTSAFAACKSLVYLSGFREIL  510
             + QLYRLM +AP LT LGTGSF   E+   +    EL Y + FAA KSLV LSGFR+ L
Sbjct  241  KLSQLYRLMYKAPHLTHLGTGSFVVPEDTMNVVGDDELIYETPFAASKSLVSLSGFRDTL  300

Query  511  ADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
             +YLPAIYPVC NLT+LNFSYA I  +Q+K ++  CHKLQ LWVLD++ DEGL+ VA TC
Sbjct  301  PEYLPAIYPVCANLTSLNFSYADIDTDQIKSIVSRCHKLQTLWVLDAIFDEGLQVVAETC  360

Query  691  KD  696
            KD
Sbjct  361  KD  362



>gb|KHN26118.1| Transport inhibitor response 1-like protein [Glycine soja]
Length=466

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 183/230 (80%), Gaps = 6/230 (3%)
 Frame = +1

Query  25   VSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDEVD--  198
            V++ DL ++A SF  F+ELVL CCE FGT GLA VA +CR LRVL+L++  V+ ++ +  
Sbjct  3    VTDADLALIADSFAGFRELVLVCCEGFGTPGLAAVASKCRLLRVLELVESVVEVEDDEEV  62

Query  199  -WISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLMLR  375
             WISCFPET+T +ESL+FDCVE  +NF+ALE LV RSP LKKL+LN+ VS+ QLYRL+LR
Sbjct  63   DWISCFPETQTNMESLVFDCVEVPINFEALEGLVARSPRLKKLRLNQFVSMAQLYRLLLR  122

Query  376  APQLTDLGTGSFGASEEE--AELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVCTN  549
            APQLT LGTGSF A+E     + E DY +AF AC+SLV LSGFREI ADYLPAIYPVC N
Sbjct  123  APQLTHLGTGSFSATEAGVVGDQEPDYAAAFEACRSLVCLSGFREIWADYLPAIYPVCAN  182

Query  550  LTTLNFSYASISAEQLKPV-ICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            LT+LN SYA I+ +QLK V ICHCHKLQI WVLDS+ DEGL+AVAATCKD
Sbjct  183  LTSLNLSYADINTDQLKSVIICHCHKLQIFWVLDSIRDEGLQAVAATCKD  232



>ref|XP_010942647.1| PREDICTED: transport inhibitor response 1-like protein [Elaeis 
guineensis]
Length=610

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 185/243 (76%), Gaps = 11/243 (5%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL LKR+ V++ DL +LA SFPNF+EL L CCE F T+GLA +A +CR LRVLDLI+  +
Sbjct  135  KLCLKRMSVADGDLSLLAHSFPNFRELSLICCEGFSTAGLAVIAEKCRHLRVLDLIEDYL  194

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +DDE   VDWIS FPET TCLESL FDCV   VNF+ALE LV RSP+L++L++N HVS+ 
Sbjct  195  EDDEDEMVDWISRFPETTTCLESLGFDCVGGAVNFEALEALVTRSPALRRLRVNHHVSVE  254

Query  352  QLYRLMLRAPQLTDLGTGSFGAS--------EEEAELELDYTSAFAACKSLVYLSGFREI  507
            QL+RLM RAPQLT LGTGSFG++         +     +D  S FAA KSLV LSGFR++
Sbjct  255  QLHRLMARAPQLTHLGTGSFGSAAAAAAAAIPQGGNNVVDLVSTFAASKSLVCLSGFRDM  314

Query  508  LADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAAT  687
               YLPAIYPVC +LT+LNFS+A ISAE+L PVI HCH LQI WVLD+V DEGL+AVAAT
Sbjct  315  APQYLPAIYPVCASLTSLNFSFAEISAEELIPVIRHCHSLQIFWVLDTVRDEGLQAVAAT  374

Query  688  CKD  696
            CKD
Sbjct  375  CKD  377



>ref|XP_010675461.1| PREDICTED: transport inhibitor response 1-like protein [Beta 
vulgaris subsp. vulgaris]
Length=605

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 186/234 (79%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K++LKR+ V++ DL ++++SFP  KEL L CCE FGTSGLA +A  CR+LRVLDL + DV
Sbjct  137  KIHLKRMSVTDYDLEIVSKSFPFLKELTLVCCEAFGTSGLALLAANCRQLRVLDLFEDDV  196

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DDE DWISCFPE  TCLESL F+C++  VNF ALE+L+ RSP+ KKL++NR VSI QL+
Sbjct  197  NDDEEDWISCFPENGTCLESLSFECIDFPVNFSALEKLLARSPNFKKLRVNRFVSIDQLH  256

Query  361  RLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM+RAPQLT LGTGSF   E  +  E +LDY +AF ACKSLV LSGFREI   +LP+I 
Sbjct  257  RLMVRAPQLTHLGTGSFSPPEVWQPFEQDLDYRAAFVACKSLVCLSGFREIAPMFLPSIS  316

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            P C NLT+LNFS+A+I+AE+L+ VICHCH LQ  WVLD++ DEGL+AV++TCKD
Sbjct  317  PACANLTSLNFSFANINAEELRSVICHCHNLQTFWVLDTIRDEGLQAVSSTCKD  370



>ref|XP_010916693.1| PREDICTED: transport inhibitor response 1-like protein [Elaeis 
guineensis]
Length=606

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 181/236 (77%), Gaps = 4/236 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+ DL +LARSFP+F +L L CC+ FGT+GLA +A  CR LRVLDLI+ DV
Sbjct  130  RLCLKRMSVSDADLYLLARSFPSFHDLTLICCDGFGTAGLAAIAEHCRHLRVLDLIENDV  189

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +D E   +DW+S FPE+ T LESL+FDCV C+VN  ALE LV RSPSL++L++N+ VS+ 
Sbjct  190  EDLEDQALDWVSRFPESTTSLESLVFDCVGCEVNMDALEALVARSPSLRRLRVNQRVSVG  249

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELEL-DYTSAFAACKSLVYLSGFREILADYLPA  528
            QL RLM+RAPQLTDLGTGSF   + E E+E+ +  +AFAA +SLV LSGFR    +Y PA
Sbjct  250  QLRRLMVRAPQLTDLGTGSFEVGQGEWEMEIAELEAAFAASRSLVCLSGFRNHSLEYFPA  309

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            IY VC NL +LN  Y+ I+ E+ +PVI HCH LQ LWVLD+V DEGL+AVAATCKD
Sbjct  310  IYVVCANLVSLNLGYSVITTEEFEPVIIHCHNLQTLWVLDTVQDEGLQAVAATCKD  365



>ref|XP_008812967.1| PREDICTED: transport inhibitor response 1-like protein [Phoenix 
dactylifera]
Length=605

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 181/240 (75%), Gaps = 8/240 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL LKR+ V++ DL +LA SFPNFKEL L CCE F T+GLA +A +CR LRVLDLI+  +
Sbjct  133  KLCLKRMSVADSDLSLLAHSFPNFKELSLICCEGFSTAGLAVIAEKCRHLRVLDLIEDYL  192

Query  181  K---DDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +   D+ VDW+S FPET T LESL FDCV   VNF+ALE LV RSP+L++L++N HVS+ 
Sbjct  193  EGEEDETVDWVSRFPETTTSLESLGFDCVGSAVNFEALEALVARSPALRRLRVNHHVSVE  252

Query  352  QLYRLMLRAPQLTDLGTGSFGAS-----EEEAELELDYTSAFAACKSLVYLSGFREILAD  516
            QL RLM RAPQLT LGTGSFG++     +      +D    FAA KSLV LSGFR++   
Sbjct  253  QLCRLMARAPQLTHLGTGSFGSAAAPLLQGGGCSVVDLARTFAAFKSLVCLSGFRDVAPH  312

Query  517  YLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             LPAIYPVC NLT+LNFS+A+I+AE+LKPVI HCH LQ  WVLD+V DEGL+AVAATCKD
Sbjct  313  CLPAIYPVCANLTSLNFSFANITAEELKPVIRHCHNLQNFWVLDAVRDEGLQAVAATCKD  372



>ref|XP_006841245.1| hypothetical protein AMTR_s00135p00080850 [Amborella trichopoda]
 gb|ERN02920.1| hypothetical protein AMTR_s00135p00080850 [Amborella trichopoda]
Length=606

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 177/232 (76%), Gaps = 0/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++ED+ +LAR FP FKEL L CC+ F T GLA +A  CR+LR L+LI+ DV
Sbjct  142  RVSLKRMSVTDEDIGVLARVFPGFKELSLVCCDGFSTKGLAVLAGGCRQLRGLELIEDDV  201

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             DD VDW++CFPET T L SL FDCVEC VNF ALE LV RS SLKKL LNRHVS+ QL 
Sbjct  202  VDDGVDWLACFPETTTSLVSLCFDCVECAVNFDALESLVARSRSLKKLTLNRHVSVGQLQ  261

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLMLRAPQLT LGTGSF       + E+D  SAF ACK L  LSGFREILA+YLPAI PV
Sbjct  262  RLMLRAPQLTHLGTGSFSPDPNAPDQEVDLVSAFNACKFLHCLSGFREILAEYLPAISPV  321

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN S A I+A +L+ ++  CHKLQ+LWVLDSV D GL+AVA+TCKD
Sbjct  322  CANLTSLNLSLADITAAELEAIVFQCHKLQLLWVLDSVRDRGLQAVASTCKD  373



>ref|XP_008806378.1| PREDICTED: F-box protein FBX14-like [Phoenix dactylifera]
Length=606

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 181/239 (76%), Gaps = 7/239 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V++ DL +LA SFPNFKEL L CCE F T+GLA +A +CR LRVLDLI+  +
Sbjct  135  KICLKRMSVADGDLSLLAYSFPNFKELSLICCEGFSTAGLAVIAEKCRHLRVLDLIEDYL  194

Query  181  KDDEV---DWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +DDE    DW+S FPET T LESL+FDCV   VNF+ALE LV RSP+L++L++N HVS+ 
Sbjct  195  EDDEDEMSDWMSRFPETTTSLESLVFDCVGSAVNFEALEALVTRSPALRRLRVNHHVSVE  254

Query  352  QLYRLMLRAPQLTDLGTGSFGAS----EEEAELELDYTSAFAACKSLVYLSGFREILADY  519
            QL RLM  APQLT LGTGSFG++     +     +D  + FAA KSLV LSGFR++   Y
Sbjct  255  QLRRLMALAPQLTHLGTGSFGSAAAAIPQGGNNVVDLVNTFAASKSLVCLSGFRDVAPQY  314

Query  520  LPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            LPAIYPVC NLT+LNFS+A ISAE+L PVI HCH LQ  WVLD+V DEGL+AVAATCKD
Sbjct  315  LPAIYPVCANLTSLNFSFADISAEELNPVIRHCHNLQNFWVLDTVRDEGLQAVAATCKD  373



>ref|XP_008795194.1| PREDICTED: F-box protein FBX14-like [Phoenix dactylifera]
Length=595

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 178/237 (75%), Gaps = 5/237 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+ DL  LARSFP+F++L L CC+ FGT GLA +A  CR LRVLDLI+ DV
Sbjct  120  RLCLKRMSVSDADLSRLARSFPSFRDLTLICCDGFGTVGLAAIAEHCRHLRVLDLIENDV  179

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D  +DW+S FPE+ T LESL+FDCV C+VN  ALE LV RSPSL++L++N+ VS+ QL 
Sbjct  180  EDQGLDWVSRFPESTTSLESLVFDCVGCEVNMDALEALVARSPSLRRLRVNQRVSVRQLR  239

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELEL-----DYTSAFAACKSLVYLSGFREILADYLP  525
             LM+RAPQL+DLGTGSFG   E  E E      D  +AFAA +SLV LSGFR     ++P
Sbjct  240  SLMVRAPQLSDLGTGSFGEGGEVGEGEGEVEVADLEAAFAASRSLVCLSGFRNHAPQFIP  299

Query  526  AIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            AIYPVC NL +LN  Y+ I+AE+L+PVI HCH LQ  WVLD+V DEGL+AVAATCKD
Sbjct  300  AIYPVCANLISLNLGYSVITAEELEPVIIHCHNLQTFWVLDTVHDEGLQAVAATCKD  356



>gb|ACV87280.1| TIR1/AFB auxin receptor protein PintaAFB4A [Pinus taeda]
Length=558

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +LYLKR+ +++ DL +LA SF  FKELV+ CC+ F T GLA++A +CR+L  LDL + ++
Sbjct  97   RLYLKRMTITDYDLTLLANSFLYFKELVMVCCDGFSTGGLASIASKCRQLTTLDLNEDEI  156

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D+  DW++CFPET T L SL FDC+E  VNF ALE+LV R PSLKKL+LNR+VSIVQL 
Sbjct  157  HDNGEDWLACFPETLTSLRSLCFDCLEGPVNFDALERLVARCPSLKKLRLNRNVSIVQLQ  216

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL+++APQLT LGTGSF   E + E   D  +AF+ CK L  LSGFRE++ +Y+PA+YPV
Sbjct  217  RLIIKAPQLTHLGTGSF-FYEFQLEQVADLLAAFSNCKQLQCLSGFREVVPEYIPAVYPV  275

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LNFSYA I + +L+ ++CHC KLQ+LWVLDSV D+GL+A A TCKD
Sbjct  276  CSNLTSLNFSYAVIGSRELEGIVCHCRKLQLLWVLDSVGDKGLEAAATTCKD  327



>gb|ACV87281.1| TIR1/AFB auxin receptor protein PintaAFB4A [Pinus taeda]
Length=585

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +LYLKR+ +++ DL +LA SF  FKELV+ CC+ F T GLA++A +CR+L  LDL + ++
Sbjct  124  RLYLKRMTITDYDLTLLANSFLYFKELVMVCCDGFSTGGLASIASKCRQLTTLDLNEDEI  183

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D+  DW++CFPET T L SL FDC+E  VNF ALE+LV R PSLKKL+LNR+VSIVQL 
Sbjct  184  HDNGEDWLACFPETLTSLRSLCFDCLEGPVNFDALERLVARCPSLKKLRLNRNVSIVQLQ  243

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL+++APQLT LGTGSF   E + E   D  +AF+ CK L  LSGFRE++ +Y+PA+YPV
Sbjct  244  RLIIKAPQLTHLGTGSF-FYEFQLEQVADLLAAFSNCKQLQCLSGFREVVPEYIPAVYPV  302

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LNFSYA I + +L+ ++CHC KLQ+LWVLDSV D+GL+A A TCKD
Sbjct  303  CSNLTSLNFSYAVIGSRELEGIVCHCRKLQLLWVLDSVGDKGLEAAATTCKD  354



>emb|CDP12732.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 165/217 (76%), Gaps = 13/217 (6%)
 Frame = +1

Query  58   SFPNFK--ELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDEVDWISCFPETKTC  231
            +FP ++  EL  A CE      LA + CE      L L   ++ +DEVDWISCFP   TC
Sbjct  33   AFPKYELSELAFAECELID---LAFLKCE------LILGMRELVEDEVDWISCFPHNGTC  83

Query  232  LESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLMLRAPQLTDLGTGSF  411
            LESLIFDCV+  +NF+ALE+LV++SPSLKKL+LNRHV+IVQLY LM+RAPQLT LGTGSF
Sbjct  84   LESLIFDCVDSPINFEALERLVVKSPSLKKLRLNRHVTIVQLYCLMVRAPQLTHLGTGSF  143

Query  412  GASE--EEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVCTNLTTLNFSYASIS  585
            G  E   + E E DY SAFAACKSLV LSGFREI A YLPAI PVC NLT+LN SYA+IS
Sbjct  144  GPGEIVAQGEQEPDYVSAFAACKSLVCLSGFREINAHYLPAIVPVCANLTSLNLSYATIS  203

Query  586  AEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             EQLK  I HCHKLQ LWVLDSVCDEGL+AVAATCKD
Sbjct  204  TEQLKSFIYHCHKLQTLWVLDSVCDEGLQAVAATCKD  240



>ref|XP_010939729.1| PREDICTED: transport inhibitor response 1-like protein [Elaeis 
guineensis]
Length=614

 Score =   278 bits (712),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 179/242 (74%), Gaps = 10/242 (4%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            KL LKRI V++ DL +LA SFPNFKEL L CCE FGT+GLA +A +CR LRVLDLI+  V
Sbjct  140  KLCLKRISVADGDLSLLAHSFPNFKELSLICCEGFGTAGLAIIAEKCRHLRVLDLIEDCV  199

Query  181  KDD---EVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +D+    VDWIS FP T T LESL FDCV   VNF+ALE LV RSP+L+ L++N HVS+ 
Sbjct  200  EDEEDETVDWISRFPGTTTSLESLGFDCVGSAVNFEALEALVARSPALRWLRVNHHVSVE  259

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELEL-------DYTSAFAACKSLVYLSGFREIL  510
            QL RLM RAPQLT LGTGSFG++   A L         D    FAA KSLV LSGFR++ 
Sbjct  260  QLRRLMARAPQLTHLGTGSFGSAAAAAPLLQGGGSSVEDLAWTFAASKSLVCLSGFRDVE  319

Query  511  ADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
              YLPAI+PVC NLT+LNFS+A ++AE+L+PVI  CH LQ  WVLD+V DEGL+AVAATC
Sbjct  320  PHYLPAIHPVCANLTSLNFSFAEVTAEELEPVIRRCHNLQNFWVLDTVGDEGLQAVAATC  379

Query  691  KD  696
            KD
Sbjct  380  KD  381



>ref|XP_009391335.1| PREDICTED: transport inhibitor response 1-like protein [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 182/237 (77%), Gaps = 5/237 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            K+ LKR+ V+++DL +LA SFP FK L L CC+ FGT+GLA  A +CR LR+LDLI+   
Sbjct  165  KICLKRMSVTDDDLSLLALSFPFFKGLTLICCDGFGTAGLAVFAEKCRHLRLLDLIEDYF  224

Query  181  KDDEVD---WISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +++E +   WIS FPET T LE+L FDC+   VNF+ALE L+ RSP+L++L++N HV++ 
Sbjct  225  EEEEYEVVDWISKFPETTTSLETLGFDCLPSAVNFEALEALIARSPALRQLRVNHHVTVD  284

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEE--AELELDYTSAFAACKSLVYLSGFREILADYLP  525
            QL RLM+RAPQLT LGTGSF + EE    E E    SAFAA +SLV LSGFRE+ + +LP
Sbjct  285  QLRRLMVRAPQLTHLGTGSFRSPEEGEGMEHEAHLVSAFAASRSLVSLSGFREVASQFLP  344

Query  526  AIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            AIYPVC+N+T LNFS+A I+AE+LKPVI HCH LQ  WVLD+V DEGL+AVAATCKD
Sbjct  345  AIYPVCSNITFLNFSFAEITAEELKPVIRHCHNLQNFWVLDTVRDEGLQAVAATCKD  401



>ref|XP_009399685.1| PREDICTED: transport inhibitor response 1-like protein [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399686.1| PREDICTED: transport inhibitor response 1-like protein [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399687.1| PREDICTED: transport inhibitor response 1-like protein [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399688.1| PREDICTED: transport inhibitor response 1-like protein [Musa 
acuminata subsp. malaccensis]
Length=629

 Score =   276 bits (706),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 183/242 (76%), Gaps = 10/242 (4%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDC--  174
            ++ LKR+ +++ DL +LA SFP FK+L L CC+ FGT GLA +A +CR LRVLDLI+   
Sbjct  156  RICLKRMSIADYDLSLLAFSFPFFKDLTLICCDGFGTLGLAVIAEKCRHLRVLDLIEAYL  215

Query  175  --DVKDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
              + +D+ VDW+S FP+T T LE+L FDCV   VNF+ALE LV RSP+L++L++N HV++
Sbjct  216  EEEEEDEVVDWVSKFPQTTTSLETLGFDCVVSTVNFEALEALVARSPALRQLRVNHHVTV  275

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEA------ELELDYTSAFAACKSLVYLSGFREIL  510
             QL+RLM+RAPQLT LGTGSFG     A      E + D  SAFAA KS+V LSGFR++ 
Sbjct  276  DQLFRLMVRAPQLTHLGTGSFGHPAALALQGDVMEHDADLVSAFAASKSIVSLSGFRDVA  335

Query  511  ADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            + YLPAIYPVC NLTTLN S+A I+A++LKPVI HCH LQ  WVLD+V DEGL+AVAATC
Sbjct  336  SQYLPAIYPVCANLTTLNCSFAEITADELKPVIHHCHNLQKFWVLDTVRDEGLQAVAATC  395

Query  691  KD  696
            KD
Sbjct  396  KD  397



>gb|AHW83201.1| auxin F-box protein 2 [Larix kaempferi]
Length=586

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ +++ DL +LA SF  FKELVL CC+ F TSGLA++A +CR+L  LDL + ++
Sbjct  124  RLCLKRMTITDYDLTLLANSFLCFKELVLVCCDGFSTSGLASIASKCRQLTTLDLNEDEI  183

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D+  DW++CFPET T L SL FDC++  +NF ALE+LV R PSLKKL+LNR VSIVQL 
Sbjct  184  TDNGEDWLACFPETLTSLRSLSFDCLDGPINFDALERLVARCPSLKKLRLNRAVSIVQLQ  243

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL+LRAPQLT LGTGSF   E   E   D  +AF+ CK L  LSGFRE++ +YLPA++PV
Sbjct  244  RLILRAPQLTHLGTGSF-FYEFLPEQGADLHAAFSNCKQLQCLSGFREVVPEYLPAVFPV  302

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LNFSYA I + +L+ +I HCHKLQ LWVLDSV D GL+AVA TCKD
Sbjct  303  CSNLTSLNFSYAVIGSRELEGIIRHCHKLQQLWVLDSVEDTGLEAVATTCKD  354



>ref|XP_003570592.1| PREDICTED: transport inhibitor response 1-like protein [Brachypodium 
distachyon]
Length=635

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 177/241 (73%), Gaps = 13/241 (5%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +++LKR+ VS+++L ++ +SFP FKEL L CC+ F T GLAT+A  CR LRVLDL +   
Sbjct  165  RIFLKRMTVSDDELALIPKSFPLFKELSLVCCDGFSTRGLATIAEGCRHLRVLDLTEDYF  224

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             +DE   VDWIS FPE  T LESL+FDCV    NF+ALE LV RSP+L++L++N HVSI 
Sbjct  225  HEDENQVVDWISKFPECNTMLESLVFDCVGVPFNFEALEALVARSPALRQLRVNDHVSIE  284

Query  352  QLYRLMLRAPQLTDLGTGSF------GASEEEAELELDYTSAFAACKSLVYLSGFREILA  513
            QL RLM RAP +T LGTGSF      G +   +EL     ++FAA +SLV LSGF +  A
Sbjct  285  QLRRLMARAPHITHLGTGSFHSEPGSGGASSVSEL----ATSFAATRSLVCLSGFLDFNA  340

Query  514  DYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            +YLPAIYPVC NLT+LNFS+AS++AE+L PVICHC  L+I WVLD+V DEGL+AVA TC 
Sbjct  341  EYLPAIYPVCVNLTSLNFSFASLTAEELIPVICHCISLRIFWVLDTVGDEGLQAVAETCS  400

Query  694  D  696
            D
Sbjct  401  D  401



>gb|EMS64215.1| hypothetical protein TRIUR3_23956 [Triticum urartu]
Length=464

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 169/234 (72%), Gaps = 12/234 (5%)
 Frame = +1

Query  19   IDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLID--CDVKDDE  192
            + V+++DL ++ARSFP FKEL L CC+ F T GLA +A  CR LRVLDLI+   D +D+ 
Sbjct  1    MTVTDDDLGLVARSFPGFKELSLVCCDGFSTLGLAVIAERCRHLRVLDLIEDYVDQEDEA  60

Query  193  VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLML  372
            VDWIS FP + T LESL+FDCV    NF+ALE LV RSPSL++L++N +VS+ QL RLM 
Sbjct  61   VDWISKFPVSNTSLESLMFDCVAVPFNFEALEALVARSPSLRRLRVNHYVSVEQLRRLMA  120

Query  373  RAPQLTDLGTGSF------GASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RAPQLT LGTG+F      G     +EL      +FAA  S+V LSGF+E+  +YLPAIY
Sbjct  121  RAPQLTHLGTGAFRPEAPQGGGMSVSEL----APSFAASTSIVCLSGFQEVNPEYLPAIY  176

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LN S+AS++AE L PVI  CHKLQ  WVLD+V DEGL+AVA TC D
Sbjct  177  PVCGNLTSLNVSFASLTAEDLTPVIRQCHKLQTFWVLDTVGDEGLRAVAETCSD  230



>ref|XP_010926346.1| PREDICTED: transport inhibitor response 1-like protein [Elaeis 
guineensis]
Length=606

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 181/234 (77%), Gaps = 4/234 (2%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++DL +LA+SFP+F++L L CC+ FGT+GLA +A  CR LRVLDLI+ DV
Sbjct  142  RLCLKRMFVSDDDLFLLAKSFPSFRDLTLICCDGFGTAGLAAIAEHCRHLRVLDLIENDV  201

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +++ VDW+S F  + T LESL+FDCV C V+  ALE LV RSPSL++L++N+HVS+  L 
Sbjct  202  EEEMVDWVSRF--STTSLESLVFDCVGCAVDLDALEALVARSPSLRRLRVNQHVSVAHLR  259

Query  361  RLMLRAPQLTDLGTGSFGASEEEA-ELEL-DYTSAFAACKSLVYLSGFREILADYLPAIY  534
            RLM RAPQLT LGTGSFG       E+E+ D  +AFAA +SLV LSGFR++  +YLPAIY
Sbjct  260  RLMARAPQLTHLGTGSFGDGGGGGGEMEVADLRAAFAASRSLVCLSGFRDLAPEYLPAIY  319

Query  535  PVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PVC NLT+LN S+A I+A+QL PVI  CH LQ  WVLD+V DEGL+ VAATCKD
Sbjct  320  PVCANLTSLNLSFADITADQLMPVIIRCHNLQTFWVLDTVGDEGLRLVAATCKD  373



>ref|XP_006656778.1| PREDICTED: transport inhibitor response 1-like protein-like, 
partial [Oryza brachyantha]
Length=542

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 176/242 (73%), Gaps = 14/242 (6%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS++DL ++A SFP FKEL + CC+ F T GLA +A  CR LRVLDLI+  V
Sbjct  71   RICLKRMTVSDDDLGLIALSFPQFKELSMVCCDGFSTLGLAVIAERCRHLRVLDLIEDYV  130

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +D+E   VDWIS FP++ T LESL+FDCV    NF+ALE LV RSPSL++L +N HVS+ 
Sbjct  131  EDEEDELVDWISKFPQSNTSLESLVFDCVGVPFNFEALEALVARSPSLRRLCVNHHVSVE  190

Query  352  QLYRLMLRAPQLTDLGTGSF-------GASEEEAELELDYTSAFAACKSLVYLSGFREIL  510
            QL RLM RAPQLT LGTG+F       G     +EL    +++FAA +S+  LSGFRE+ 
Sbjct  191  QLRRLMARAPQLTHLGTGAFRPETAAGGGGISVSEL----SASFAASRSIASLSGFREVN  246

Query  511  ADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
             +YLP IYPVC NLT+LNFS+A+++AE+L PVI  CHKL+  WVLD+V DEGL AVA TC
Sbjct  247  PEYLPGIYPVCANLTSLNFSFANVTAEELLPVIRQCHKLRTFWVLDTVGDEGLHAVAETC  306

Query  691  KD  696
             D
Sbjct  307  SD  308



>ref|XP_008782182.1| PREDICTED: transport inhibitor response 1-like protein [Phoenix 
dactylifera]
Length=606

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 172/236 (73%), Gaps = 7/236 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ +S+ DL +LA SFP F++L L CC+ FGT+GLA +A  CR LRVLDLI+ DV
Sbjct  139  RLCLKRMSISDADLSLLALSFPTFRDLTLICCDGFGTAGLAAIAEHCRHLRVLDLIENDV  198

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +++E   VDW+S F  + T LESL+FD V C VN  ALE LV RSPSL++L++N+HVS+ 
Sbjct  199  EEEEEEMVDWVSRF--STTSLESLVFDFVGCAVNLDALEALVARSPSLRRLRVNQHVSVG  256

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELEL--DYTSAFAACKSLVYLSGFREILADYLP  525
             L RLM RAPQLT LGTGSFG            D  +AFAA +SLV LSGFR++  +YLP
Sbjct  257  HLRRLMERAPQLTHLGTGSFGEGGGGGGEVEVADLEAAFAASRSLVCLSGFRDLAPEYLP  316

Query  526  AIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            AI P C NL +LN SYA I+AEQLKPVI HCH LQ  WVLD+V DEGL+ VAATCK
Sbjct  317  AICPACANLASLNLSYADITAEQLKPVIIHCHNLQTFWVLDTVGDEGLQVVAATCK  372



>gb|EMT11181.1| hypothetical protein F775_20551 [Aegilops tauschii]
Length=694

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 174/246 (71%), Gaps = 14/246 (6%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLID--C  174
            ++ LKR+ V+++DL ++ARSFP F+EL L CC+ F T GLA +A  CR LRVLDLI+   
Sbjct  215  RICLKRMTVTDDDLGLVARSFPGFQELSLVCCDGFSTLGLAVIAEGCRHLRVLDLIEDYV  274

Query  175  DVKDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQ  354
            D +D+ VDWIS FP + T LESL+FDCV    NF+ALE LV RSPSL++L++N HVS+ Q
Sbjct  275  DQEDEAVDWISKFPVSNTSLESLMFDCVGAPFNFEALEALVARSPSLRRLRVNHHVSVEQ  334

Query  355  LYRLMLRAPQLTDLGTGSFG--ASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPA  528
            L RLM RAPQLT LGTG+F   A + E     +   +FAA  S+V LSGF+E+  +YLPA
Sbjct  335  LRRLMARAPQLTHLGTGAFRPEAPQGEGMSVSELAPSFAASTSIVCLSGFQEVNPEYLPA  394

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILW----------VLDSVCDEGLKAV  678
            IYPVC NLT+LN S+AS++AE L PVI  CHKLQ  W          VLD+V DEGL+AV
Sbjct  395  IYPVCGNLTSLNVSFASLTAEDLTPVIRQCHKLQTFWVGPYSYLFAMVLDTVGDEGLRAV  454

Query  679  AATCKD  696
            A TC D
Sbjct  455  AETCSD  460



>gb|EEC74038.1| hypothetical protein OsI_09014 [Oryza sativa Indica Group]
Length=586

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 179/238 (75%), Gaps = 7/238 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VSN+DL ++A+SFP FKEL L CC+ F T GLA +A  CR LRVLDLI+  +
Sbjct  116  RICLKRMTVSNDDLALIAKSFPLFKELSLVCCDGFSTLGLAAIAERCRHLRVLDLIEDYI  175

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             ++E   VDWIS FPE+ T LESL+FDCV    NF+ALE LV RSP++++L++N HV++ 
Sbjct  176  DEEEDELVDWISKFPESNTSLESLVFDCVSVPFNFEALEALVARSPAMRRLRMNHHVTVE  235

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYL  522
            QL RLM RAPQLT LGTG+F  SE      L  T   ++FAA +SL+ LSGFR++  +YL
Sbjct  236  QLRRLMARAPQLTHLGTGAF-RSEPGPGGALSVTELATSFAASRSLICLSGFRDVNPEYL  294

Query  523  PAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PAI+PVC NLT+LNFS+A+++AE+L P+I +C +L+  WVLD+V DEGL+AVA TC D
Sbjct  295  PAIHPVCANLTSLNFSFANLTAEELTPIIRNCVRLRTFWVLDTVGDEGLRAVAETCSD  352



>ref|XP_009409171.1| PREDICTED: F-box protein FBX14-like [Musa acuminata subsp. malaccensis]
Length=632

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 174/239 (73%), Gaps = 15/239 (6%)
 Frame = +1

Query  10   LKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLID---CDV  180
            LKR+ VS+ DL +LARSF +F++L L CC+ FGT GLA VA  CR LRVLDLI+    D 
Sbjct  164  LKRMTVSDADLALLARSFSSFRDLTLICCDGFGTPGLAAVAELCRNLRVLDLIENDVEDE  223

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             ++ VDWIS FPET T LESL F+CV C VNF ALE LV RSPSL++L++N+HVS+ QL 
Sbjct  224  DEEVVDWISRFPETDTRLESLSFECVNCPVNFAALEALVARSPSLRRLRVNQHVSVGQLR  283

Query  361  RLMLRAPQLTDLGTGSF-------GASE-EEAELELDYTSAFAACKSLVYLSGFREILAD  516
             LM+RAPQLT LG+GSF       GA+E + AELE    S+F A KSLV LSGFR +  +
Sbjct  284  CLMVRAPQLTHLGSGSFETVPVADGAAELDVAELE----SSFVASKSLVCLSGFRMVAPE  339

Query  517  YLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            YLPAIYPVC  L +LN SYA  +AEQLKPVI  CH LQ  WVLD+V DEGL+A A TCK
Sbjct  340  YLPAIYPVCAGLVSLNLSYAMTTAEQLKPVILRCHNLQTFWVLDTVGDEGLRAAAKTCK  398



>ref|XP_003570593.1| PREDICTED: transport inhibitor response 1-like protein [Brachypodium 
distachyon]
Length=643

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 175/241 (73%), Gaps = 13/241 (5%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+++L ++ RSFP FKEL L CC+ F T GLA +A  CR LRVLDL +   
Sbjct  173  RICLKRMTVSDDELALIPRSFPLFKELSLVCCDGFSTRGLAIIAEGCRHLRVLDLTEDYF  232

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             ++E   VDWIS FPE+ T LESL+FDCV    NF+ALE LV RSP+L++L++N HVSI 
Sbjct  233  HEEENEVVDWISKFPESNTSLESLVFDCVSVPFNFEALEALVARSPALRRLRVNDHVSIE  292

Query  352  QLYRLMLRAPQLTDLGTGSF------GASEEEAELELDYTSAFAACKSLVYLSGFREILA  513
            QL  LM RAP+LT LGTGSF      G +   +EL     ++FAA +SLV LSGF ++ A
Sbjct  293  QLRCLMARAPRLTHLGTGSFRSEPGSGGTSSVSEL----ATSFAASRSLVCLSGFLDVNA  348

Query  514  DYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            +YLPAIYPVC NLT+LNFS+AS++AE++ PVI HC  L+  WVLD+V DEGL+AVA TC 
Sbjct  349  EYLPAIYPVCANLTSLNFSFASLTAEEIIPVINHCVSLRTFWVLDTVGDEGLRAVAETCS  408

Query  694  D  696
            D
Sbjct  409  D  409



>ref|NP_001048183.1| Os02g0759700 [Oryza sativa Japonica Group]
 dbj|BAD19396.1| putative F-box containing protein TIR1 [Oryza sativa Japonica 
Group]
 dbj|BAF10097.1| Os02g0759700 [Oryza sativa Japonica Group]
 gb|EEE57841.1| hypothetical protein OsJ_08461 [Oryza sativa Japonica Group]
Length=637

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 179/238 (75%), Gaps = 7/238 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VSN+DL ++A+SFP FKEL L CC+ F T GLA +A  CR LRVLDLI+  +
Sbjct  167  RICLKRMTVSNDDLALIAKSFPLFKELSLVCCDGFSTLGLAAIAERCRHLRVLDLIEDYI  226

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             ++E   VDWIS FPE+ T LESL+FDCV    NF+ALE LV RSP++++L++N HV++ 
Sbjct  227  DEEEDELVDWISKFPESNTSLESLVFDCVSVPFNFEALEALVARSPAMRRLRMNHHVTVE  286

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYL  522
            QL RLM RAPQLT LGTG+F  SE      L  T   ++FAA +SL+ LSGFR++  +YL
Sbjct  287  QLRRLMARAPQLTHLGTGAF-RSEPGPGGALSVTELATSFAASRSLICLSGFRDVNPEYL  345

Query  523  PAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PAI+PVC NLT+LNFS+A+++AE+L P+I +C +L+  WVLD+V DEGL+AVA TC D
Sbjct  346  PAIHPVCANLTSLNFSFANLTAEELTPIIRNCVRLRTFWVLDTVGDEGLRAVAETCSD  403



>ref|XP_006647937.1| PREDICTED: transport inhibitor response 1-like protein-like, 
partial [Oryza brachyantha]
Length=603

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 177/238 (74%), Gaps = 7/238 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ +SN+DL ++A+SFP FKEL L CC+ F T GLA VA  CR LRVLDLI+  +
Sbjct  133  RICLKRMTISNDDLALVAKSFPLFKELSLVCCDGFSTQGLAAVAERCRYLRVLDLIEDYI  192

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             ++E   VDWIS FPE+   LESL+FDCV    NFQALE LV RSP+L++L++N HV++ 
Sbjct  193  DEEEDELVDWISKFPESNRTLESLVFDCVSVPFNFQALEALVARSPALRRLRMNHHVTVE  252

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYL  522
            QL RLM +APQLT LGTG+F  SE      L  T   ++FAA +SL  LSGFR++  ++L
Sbjct  253  QLRRLMAKAPQLTHLGTGAF-RSEPGPGGALSVTELATSFAASRSLTCLSGFRDVNPEFL  311

Query  523  PAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PAI+PVC NLT+LNFS+A+++AE+L P+I +C +L+  WVLD+V DEGL+AVA TC D
Sbjct  312  PAIHPVCANLTSLNFSFANLTAEELTPIIRNCVRLRTFWVLDTVGDEGLRAVAETCSD  369



>ref|XP_004953988.1| PREDICTED: F-box protein FBX14-like [Setaria italica]
Length=665

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 178/238 (75%), Gaps = 7/238 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ +S++DL ++A+SFP F+EL L CC+ F T GLA +A  CR LRVLDLI+  V
Sbjct  195  RICLKRMTISDDDLHLVAKSFPLFRELSLVCCDGFSTVGLAAIAKLCRHLRVLDLIEDYV  254

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +D++   VDWIS FPE+ T LESL+FDCV    NF+ALE LV RSP+L++L++N HVS+ 
Sbjct  255  EDEDDELVDWISKFPESNTSLESLVFDCVSVPFNFEALEVLVARSPALRRLRVNHHVSVE  314

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYL  522
            QL RLM RAPQLT  GTG+F  SE      L  T   ++FAA +SL+ LSGFR++  +YL
Sbjct  315  QLRRLMARAPQLTHFGTGAF-RSEAAPGGGLSVTELATSFAASRSLICLSGFRDVNPEYL  373

Query  523  PAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PAIYPVC  LT+LNFS+AS++AE+LKPVI +C  L+  WVLD+V DEGL+AVA TC +
Sbjct  374  PAIYPVCAKLTSLNFSFASLTAEELKPVIRNCINLRTFWVLDTVGDEGLRAVADTCSE  431



>ref|XP_008677495.1| PREDICTED: uncharacterized protein LOC100381660 isoform X1 [Zea 
mays]
 gb|AFW64385.1| hypothetical protein ZEAMMB73_610033 [Zea mays]
 gb|AFW64386.1| hypothetical protein ZEAMMB73_610033 [Zea mays]
Length=666

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 175/238 (74%), Gaps = 7/238 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS++DL ++A SFP  ++L L CC+ F T GLA +A  CR LRVLDLI+  V
Sbjct  196  RICLKRMAVSDDDLALVASSFPFLRDLSLVCCDGFSTLGLAVIAERCRHLRVLDLIEDYV  255

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +DD+   VDWIS FPE+ T LESL+FDCV C  NF+ALE LV RSP+L++L++N HVS+ 
Sbjct  256  EDDDEELVDWISKFPESNTSLESLVFDCVSCPFNFEALEALVARSPALRRLRVNHHVSVE  315

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYL  522
            QL RLM RAPQLT  GTG+F  SE      L  T   ++FAA +SLV LSGFRE+  +YL
Sbjct  316  QLRRLMARAPQLTHFGTGAF-RSEGAPGGGLAVTELATSFAASRSLVCLSGFREVDPEYL  374

Query  523  PAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PAIYPVC NLT+LNFS+AS++A +LKP I +C  L+  WVLD+V DEGL+AVA  C D
Sbjct  375  PAIYPVCANLTSLNFSFASLTAAELKPAIRNCTNLRTFWVLDTVGDEGLRAVADACSD  432



>ref|XP_002452866.1| hypothetical protein SORBIDRAFT_04g033850 [Sorghum bicolor]
 gb|EES05842.1| hypothetical protein SORBIDRAFT_04g033850 [Sorghum bicolor]
Length=662

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 175/238 (74%), Gaps = 7/238 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS++DL ++A+SFP F+EL L CC+ F T GLA +   CR LRVLDLI+  +
Sbjct  192  RICLKRMTVSDDDLALIAKSFPLFRELSLVCCDGFSTVGLAVIVERCRHLRVLDLIEDYL  251

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +D+E   VDWIS F E+ T LESL+FDCV    NF+ALE LV RSP+L++L++N HVS+ 
Sbjct  252  EDEEDELVDWISKFSESNTSLESLVFDCVSVPFNFEALEALVARSPALRRLRVNHHVSVE  311

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYL  522
            QL RLM RAPQLT  GTG+F  SE   +  L  T   ++FAA +SLV LSGFRE+   YL
Sbjct  312  QLRRLMARAPQLTHFGTGAF-RSEGAPDGGLAVTELATSFAAARSLVCLSGFREVDPQYL  370

Query  523  PAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PAIYPVC  LT+LNFS+AS++A +LKPVI +C  L+  WVLD+V DEGL+AVA TC D
Sbjct  371  PAIYPVCAKLTSLNFSFASLTAAELKPVIRNCTNLRTFWVLDTVGDEGLRAVADTCSD  428



>gb|AFW73532.1| hypothetical protein ZEAMMB73_849714 [Zea mays]
Length=665

 Score =   254 bits (648),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 174/238 (73%), Gaps = 7/238 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS++DL ++A SFP F++L L CC+ F T GLA VA  CR LRVLDLI+  V
Sbjct  195  RICLKRMTVSDDDLALVATSFPCFRDLSLVCCDGFSTLGLAVVAERCRHLRVLDLIEDYV  254

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
            +DDE   VDWIS FPE  T LESL+FDCV    NF+ALE LV RSP+L++L++N HVS+ 
Sbjct  255  EDDEDELVDWISKFPECNTSLESLVFDCVSVPFNFEALEALVARSPALRQLRVNHHVSVE  314

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYL  522
            QL RLM RAPQLT  GTG+F  SE      L  T   ++FAA +SL+ LSGFRE+  +YL
Sbjct  315  QLRRLMARAPQLTHFGTGAF-RSEGAPGGGLAVTELATSFAASRSLICLSGFREVDPEYL  373

Query  523  PAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            PAIYPVC  LT+LNFS+AS++A +LKPVI +C  L+  WVLD+V DEGL+AVA  C D
Sbjct  374  PAIYPVCAKLTSLNFSFASLTAAELKPVIRNCTNLRTFWVLDTVGDEGLRAVADACSD  431



>ref|NP_001145982.1| uncharacterized protein LOC100279510 [Zea mays]
 gb|ACL52977.1| unknown [Zea mays]
Length=465

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 169/232 (73%), Gaps = 7/232 (3%)
 Frame = +1

Query  19   IDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDE--  192
            + VS++DL ++A SFP F++L L CC+ F T GLA VA  CR LRVLDLI+  V+DDE  
Sbjct  1    MTVSDDDLALVATSFPCFRDLSLVCCDGFSTLGLAVVAERCRHLRVLDLIEDYVEDDEDE  60

Query  193  -VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLM  369
             VDWIS FPE  T LESL+FDCV    NF+ALE LV RSP+L++L++N HVS+ QL RLM
Sbjct  61   LVDWISKFPECNTSLESLVFDCVSVPFNFEALEALVARSPALRQLRVNHHVSVEQLRRLM  120

Query  370  LRAPQLTDLGTGSFGASEEEAELELDYT---SAFAACKSLVYLSGFREILADYLPAIYPV  540
             RAPQLT  GTG+F  SE      L  T   ++FAA +SL+ LSGFRE+  +YLPAIYPV
Sbjct  121  ARAPQLTHFGTGAF-RSEGAPGGGLAVTELATSFAASRSLICLSGFREVDPEYLPAIYPV  179

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  LT+LNFS+AS++A +LKPVI +C  L+  WVLD+V DEGL+AVA  C D
Sbjct  180  CAKLTSLNFSFASLTAAELKPVIRNCTNLRTFWVLDTVGDEGLRAVADACSD  231



>gb|EMS50853.1| hypothetical protein TRIUR3_18749 [Triticum urartu]
Length=462

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 165/235 (70%), Gaps = 13/235 (6%)
 Frame = +1

Query  19   IDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDE--  192
            + VS+++L ++ +SFP FKEL L CC+ F T GLA +A  CR LRVLDL +    ++E  
Sbjct  1    MTVSDDELALIPKSFPLFKELSLVCCDGFTTRGLAVIAEGCRHLRVLDLTEDYFHEEESE  60

Query  193  -VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLM  369
             VDWIS FPE+ T LESL+FDCV    NF+ALE LV RSP+L++L++N HVSI QL RLM
Sbjct  61   VVDWISKFPESNTSLESLVFDCVSVPFNFEALEALVARSPALRRLRVNDHVSIEQLRRLM  120

Query  370  LRAPQLTDLGTGSF------GASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
             RAP LT LGTGSF      G +   +EL     ++FAA +SLV LSGF +  A YLPAI
Sbjct  121  ARAPHLTHLGTGSFRSEPGPGGALSVSEL----ATSFAASRSLVCLSGFLDANAAYLPAI  176

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            Y VC NLT+LNFS+A ++ E+  PVI HC  L+ LWVLD+V DEGL+AVA TC +
Sbjct  177  YQVCANLTSLNFSFAGLTDEEFIPVIRHCVNLRTLWVLDTVGDEGLRAVAETCSN  231



>dbj|BAK00859.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=652

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 171/241 (71%), Gaps = 13/241 (5%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+++L ++ +SFP FK+L L CC+ F T GLA +A  CR LRVLDL +   
Sbjct  185  RICLKRMTVSDDELALIPKSFPLFKDLSLVCCDGFTTRGLAVIAEGCRHLRVLDLTEDYF  244

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             ++E   VDWIS FPE  T +ESL+FDCV    NF+ALE LV RSP+L++L++N HVSI 
Sbjct  245  HEEESEVVDWISKFPECNTSIESLVFDCVSVPFNFEALEALVARSPALRRLRVNDHVSIE  304

Query  352  QLYRLMLRAPQLTDLGTGSF------GASEEEAELELDYTSAFAACKSLVYLSGFREILA  513
            QL RLM RAP LT LGTGSF      G +   +EL     ++FAA +SLV LSGF ++  
Sbjct  305  QLRRLMARAPHLTHLGTGSFRSEPGPGGALSVSEL----AASFAASRSLVCLSGFLDVNG  360

Query  514  DYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
             YLPAIY VC NLT+LNFS+A+++AE+  PVI HC  L+ LWVLD+V DEGL+AVA TC 
Sbjct  361  AYLPAIYQVCPNLTSLNFSFAALTAEEFIPVIRHCINLRTLWVLDTVGDEGLRAVAETCS  420

Query  694  D  696
            +
Sbjct  421  N  421



>gb|EMT26241.1| hypothetical protein F775_11202 [Aegilops tauschii]
Length=462

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 164/235 (70%), Gaps = 13/235 (6%)
 Frame = +1

Query  19   IDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDE--  192
            + VS+++L ++ +SFP FKEL L CC+ F T GLA +A  CR LRVLDL +    ++E  
Sbjct  1    MTVSDDELALIPKSFPLFKELSLVCCDGFTTRGLAVIAEGCRHLRVLDLTEDYFHEEESE  60

Query  193  -VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLM  369
             VDWIS FPE  T LESL+FDCV    NF+ALE LV RSP+L++L++N HVSI QL RLM
Sbjct  61   VVDWISKFPECSTSLESLVFDCVSVPFNFEALEALVARSPALRRLRVNDHVSIEQLRRLM  120

Query  370  LRAPQLTDLGTGSF------GASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
             RAP LT LGTGSF      G +   +EL     ++FAA +SLV LSGF +  A YLPAI
Sbjct  121  ARAPHLTHLGTGSFRSEPGPGGALSVSEL----ATSFAASRSLVCLSGFLDANAAYLPAI  176

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            Y VC NLT+LNFS+A ++ E+  PVI HC  L+ LWVLD+V DEGL+AVA TC +
Sbjct  177  YQVCANLTSLNFSFAGLTDEEFIPVIRHCVNLRTLWVLDTVGDEGLRAVAETCSN  231



>gb|KHN08256.1| Transport inhibitor response 1-like protein [Glycine soja]
Length=551

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 159/236 (67%), Gaps = 43/236 (18%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDC--  174
            KL+LKR+ +++ DL +L+ S P+F++L+L CCE FGT+ LA +A  CR LRVL+ ++C  
Sbjct  123  KLHLKRMSLTDHDLTLLSHSLPSFQDLLLTCCEGFGTTALAALASNCRLLRVLEPVECVV  182

Query  175  DVKDDEVDWISCFPET--KTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
            +V D+E+DWISCFPE+  +T LESL                                   
Sbjct  183  EVGDEELDWISCFPESDAQTHLESL-----------------------------------  207

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPA  528
              L+RLM RAPQLT LGTGSF AS  E + ELD+ SAFAACKSLV LSGFREI  DYLPA
Sbjct  208  --LHRLMHRAPQLTHLGTGSFSAS--ELDQELDFASAFAACKSLVCLSGFREIWPDYLPA  263

Query  529  IYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            IYP C NL +LNFSYA ISA+QL  VI HCHKLQ  WVLD++CDEGL+AVA TCKD
Sbjct  264  IYPACANLISLNFSYADISADQLISVIRHCHKLQTFWVLDTICDEGLQAVAETCKD  319



>ref|XP_006844497.1| hypothetical protein AMTR_s00016p00126140 [Amborella trichopoda]
 gb|ERN06172.1| hypothetical protein AMTR_s00016p00126140 [Amborella trichopoda]
Length=575

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ ++++ L +++ +FPNFK LVL  CE F T GLA++A  CR LR LDL +C++
Sbjct  104  ELKLKRMLITDDCLDLISHAFPNFKALVLISCEGFSTDGLASIAANCRNLRELDLQECEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            ++    W+SCFPET T L SL F C++ +VN   LE+LV R P+LK LK+NR V +  L+
Sbjct  164  EEKNTPWLSCFPETCTSLVSLNFACLKGEVNPAVLERLVARCPNLKSLKMNRSVPLEMLH  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAPQL +LGTG+F   E  +E  +   +AF  CK++  LSGF E+   YLP+IY V
Sbjct  224  KILARAPQLVELGTGAF-TQEPRSEHYIKLFNAFHNCKNIKSLSGFWEVAPVYLPSIYSV  282

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA I   +L  +I  CHKLQ LW+LD + D+GL+AVA+TCKD
Sbjct  283  CANLTSLNLSYALIQGPELIKLIQQCHKLQRLWILDFIEDKGLEAVASTCKD  334



>gb|ACV87279.1| TIR1/AFB auxin receptor protein PintaTIR1 [Pinus taeda]
Length=574

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ +++E L +LARSFPNFK LVL  C+ F T GLA +A  CR +  LDL + D+
Sbjct  109  ELRLKRMVITDESLQLLARSFPNFKVLVLTSCDGFSTDGLAAIAAHCRHITELDLQESDI  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   +W+SCFP++ T L SL F C+  +VNF+ALE+LV R  SL+ LKLNR V +  L+
Sbjct  169  DDRGGNWLSCFPDSCTSLVSLNFACLTKEVNFEALERLVARCTSLRSLKLNRLVPLELLH  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++RAP L DLGTG+F   E   E       A   CK L  LSGF E+   YLP +  +
Sbjct  229  RLLVRAPHLEDLGTGAF-LHEPRTEQYSKLKVALQNCKRLQSLSGFWEVAPGYLPLVESL  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA+I + +L  ++ HCHKLQ LWVLD + D+GL+ VA+TCKD
Sbjct  288  CSNLTSLNLSYATIQSAELTNLLGHCHKLQRLWVLDYIEDKGLEVVASTCKD  339



>gb|AHW83200.1| auxin F-box protein 1 [Larix kaempferi]
Length=574

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 156/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +LARSFPNFK LVL  C+ F T GLAT+A  CR +  LDL + D+
Sbjct  109  ELRLKRMVVTDESLELLARSFPNFKVLVLTSCDGFSTDGLATIAAHCRHITELDLQENDI  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP++ T L SL F C+  +VNF+ALE+LV R  SL+ LKLNR V +  L+
Sbjct  169  DDRGGHWLSSFPDSCTSLVSLNFACLNDEVNFEALERLVARCTSLRSLKLNRLVPLELLH  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++RAP L DLGTG++   E   E       A   CK+L  LSGF E+   YLP++  V
Sbjct  229  RLLIRAPHLEDLGTGAY-LQEPRTEQYSKLKGALQNCKALRSLSGFWEVTPGYLPSVDTV  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA+I + +L  ++ HCHKLQ LWVLD + D+GL+ VA+TCKD
Sbjct  288  CVNLTCLNLSYATIQSAELTKLLGHCHKLQRLWVLDYIEDKGLEVVASTCKD  339



>gb|AHA44842.1| TIR1 [Larix kaempferi]
Length=574

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 156/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +LARSFPNFK LVL  C+ F T GLAT+A  CR +  LDL + D+
Sbjct  109  ELRLKRMVVTDESLELLARSFPNFKVLVLTSCDGFSTDGLATIAAHCRHITELDLQENDI  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP++ T L SL F C+  +VNF+ALE+LV R  SL+ LKLNR V +  L+
Sbjct  169  DDRGGHWLSSFPDSCTSLVSLNFACLNDEVNFEALERLVARCTSLRSLKLNRLVPLELLH  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++RAP L DLGTG++   E   E       A   CK+L  LSGF E+   YLP++  V
Sbjct  229  RLLIRAPHLEDLGTGAY-LQEPRTEQYSKLKGALQNCKALRSLSGFWEVTPGYLPSVDTV  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA+I + +L  ++ HCHKLQ LWVLD + D+GL+ VA+TCKD
Sbjct  288  CVNLTCLNLSYATIQSAELTKLLGHCHKLQRLWVLDYIEDKGLEVVASTCKD  339



>ref|XP_006651114.1| PREDICTED: transport inhibitor response 1-like protein-like, 
partial [Oryza brachyantha]
Length=483

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 162/240 (68%), Gaps = 10/240 (4%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFP-NFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            L+LKRI V+++DL +++RS P +F++L L  C+ F ++GLA++A  CR LRVLD++DC++
Sbjct  10   LFLKRITVTDDDLDLVSRSLPASFRDLSLLLCDGFSSAGLASIASHCRGLRVLDVVDCEM  69

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             DDE   VDW++ FP   T LESL F+C    V+F ALE LV RSP L +L +N HVS+ 
Sbjct  70   NDDEDEVVDWVAAFPPGPTDLESLSFECYVRPVSFAALEALVARSPRLSRLGVNEHVSLG  129

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELD---YTSAFAAC---KSLVYLSGFREILA  513
            QL RLM   P+L+ LGTG+F   +   ++ LD     SAFA+     +LV LSGFR+   
Sbjct  130  QLRRLMANTPRLSHLGTGAFRPGDGPEDVGLDVEQMASAFASAGRTNTLVSLSGFRDFEP  189

Query  514  DYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            +YLPAI  V  NLT+L+FS+  I+ +Q  P +  CH L+ L VLDSV DEGL+A A TCK
Sbjct  190  EYLPAIAAVSVNLTSLDFSFCPITPDQFLPFVGQCHNLERLHVLDSVRDEGLQATARTCK  249



>gb|ADE76203.1| unknown [Picea sitchensis]
Length=570

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +LA SFPNF+ L LA CE F T GLA +A +CR L  LDL + D+
Sbjct  109  ELRLKRMVVTDESLELLAHSFPNFRVLSLASCEGFSTYGLAIIARDCRNLTELDLQENDI  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ + L SL F C+   VNF +LE+LV R  SLK LKLN++V++ QL 
Sbjct  169  DDRGGYWLSCFPESCSSLVSLNFACMNSAVNFDSLERLVARCTSLKSLKLNKNVTLEQLQ  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELD-YTSAFAACKSLVYLSGFREILADYLPAIYP  537
            RL+++APQLT+LGTGS+  S+E    + D  ++AF  CK L  +SGF ++   YLPAIYP
Sbjct  229  RLLVKAPQLTELGTGSY--SQEIRSRQFDNLSAAFNNCKELRIISGFWDVAPVYLPAIYP  286

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC+ L  LNFSYA+I +  L  V+ +C  LQ LWVLD+V D GL+ V+++CKD
Sbjct  287  VCSKLKFLNFSYATIRSSDLGRVVINCPHLQRLWVLDTVEDAGLEIVSSSCKD  339



>ref|XP_010660695.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Vitis vinifera]
Length=572

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 159/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VSNE L +LARSF NFK LVL  CE F T GLA VA  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSNEGLELLARSFVNFKSLVLVSCEGFTTDGLAAVAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D +  W+SCFP++ T L SL F C++ +VN  ALE+LV R P+LK L+LNR V +  L 
Sbjct  164  EDRKGQWLSCFPDSCTSLVSLNFACLKGEVNLTALERLVARCPNLKSLRLNRAVPLDALQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R+++ APQL DLGTGS+   + +AE      S F  CKS+  +SGF E+    LPAIYP+
Sbjct  224  RILMHAPQLVDLGTGSY-VHDPDAETVNKLISTFQKCKSIRSMSGFLEVAPLCLPAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  I  ++L  +I +C KLQ LW+LD + D+GL  VA TCK+
Sbjct  283  CSNLTSLNLSYAPGIHGDELIKLIRYCRKLQRLWILDCIGDKGLGVVACTCKE  335



>ref|XP_007031984.1| Auxin signaling F-box 2 [Theobroma cacao]
 gb|EOY02910.1| Auxin signaling F-box 2 [Theobroma cacao]
Length=572

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 159/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L++SF NFK LVL  CE F T G+A +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLSKSFLNFKSLVLVSCEGFTTDGIAAIAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C++ ++N  ALE+LV+RSP+LK L+LNR V +  L 
Sbjct  164  DDHRGHWLSCFPESCTSLVSLNFACLKGEINLGALERLVVRSPNLKSLRLNRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++RAPQ+ DLGTGS+   +  +E+     SAF  CKS+  LSGF E+    + AIYP+
Sbjct  224  KILMRAPQVVDLGTGSY-VHDPSSEVYNKLKSAFQRCKSIRSLSGFLEVAPRCMSAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            CTNLT LN SYA  +   +L  +I HC KLQ LW+LD + D+GL  VA+TCK+
Sbjct  283  CTNLTFLNLSYAPGLHGNELTKLIQHCRKLQRLWILDCIGDKGLGVVASTCKE  335



>ref|XP_010682986.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 160/233 (69%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L++SF +FK L+L  CE F T GLA +A  CR LR LDL + +V
Sbjct  105  ELRLKRMVVSDESLELLSKSFLHFKSLILVSCEGFTTDGLAAIASNCRYLRELDLQENEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D +  W+SCFPE  T L SL F C++ +VN  ALE+LV RSP+L+ L+LN  V    L 
Sbjct  165  DDRKGHWLSCFPEGCTSLISLNFACLKGEVNLAALERLVARSPNLRSLRLNLAVPFETLQ  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++++APQLTDLGTGSF   + ++E     TSA + C+S+  LSGF E+ A  LPAIYP+
Sbjct  225  KILVKAPQLTDLGTGSF-VHDPKSETYNKLTSAISKCESIRSLSGFLEVAARCLPAIYPI  283

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL  VA TCK+
Sbjct  284  CSNLTSLNLSYAPGIGGSELTQLILHCKKLQRLWILDCIGDKGLAIVADTCKE  336



>ref|XP_003553972.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Glycine max]
 gb|KHN28562.1| Protein AUXIN SIGNALING F-BOX 3 [Glycine soja]
Length=572

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF +FK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  105  ELRLKRMVVSDESLELLSRSFTHFKSLVLVSCEGFSTDGLAAIAANCRFLRELDLQENEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D +  W+SCFP+  T L SL F C++ +V+  ALE+ V RSP+LK LKLNR V +  L 
Sbjct  165  EDHKGQWLSCFPDNCTSLVSLNFACLKGEVSLGALERFVARSPNLKSLKLNRSVPVDALQ  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R+M+RAPQL+DLG GS    + E+E  +   +    CKS+  LSGF E+    L AIYP+
Sbjct  225  RIMMRAPQLSDLGIGSL-VHDPESEAYIKLKNTILKCKSITSLSGFLEVAPHCLAAIYPI  283

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW++D + D+GL  VA TCKD
Sbjct  284  CPNLTSLNLSYAAGIQGSALVKLIHHCVKLQRLWIMDCIGDKGLGVVATTCKD  336



>emb|CDP03546.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 159/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++++SF NFK LVL+ CE F T GLA +A  CR LR LDL + +V
Sbjct  10   EIRLKRMVVTDESLELISKSFKNFKVLVLSTCEGFSTDGLAAIAANCRNLRELDLRESEV  69

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FPET T L SL   C+  +V+F ALE+LV RSP+L+ L+LNR V + +L 
Sbjct  70   EDLSGHWLSHFPETCTSLVSLNIACLGSEVSFSALERLVARSPNLRTLRLNRAVPLEKLP  129

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAP L +LGTG++ A E   ++  +   AF+ACK L  LSGF +++  YLPA+Y V
Sbjct  130  ILLHRAPHLVELGTGAYSA-ESRPDVFSNLAEAFSACKQLKGLSGFWDLVPAYLPAVYSV  188

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I +  L  +IC CH LQ LWVLD + D GL+ +A +CKD
Sbjct  189  CSKLTSLNLSYATIQSPDLVKLICQCHSLQRLWVLDYIEDAGLEILARSCKD  240



>ref|XP_002269127.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Vitis vinifera]
Length=576

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 156/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +++RSF NFK LVL+ CE F T GLA +A  CR LR LDL + +V
Sbjct  105  ELRLKRMVVTDESLELISRSFKNFKVLVLSSCEGFSTDGLAAIAANCRNLRELDLRESEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++ FP++ T L SL   C+  +V+F ALE+LV R PSL+ L+LNR V + +L 
Sbjct  165  DDFSGHWLTHFPDSCTSLVSLNISCLASEVSFSALERLVGRCPSLRTLRLNRAVPLDRLP  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG++ A E   E+      AF+ CK L  LSGF +++ DYLPA+YP 
Sbjct  225  NLLRRAPQLVELGTGAYSA-EHRPEVFSSLAGAFSNCKELKSLSGFWDVVPDYLPAVYPA  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ +T+LN SYA+I +  L  ++  C  LQ LWVLD + D GL A+AA+CKD
Sbjct  284  CSGITSLNLSYATIQSPDLIKLVTQCQNLQRLWVLDYIEDSGLDALAASCKD  335



>ref|XP_006663433.1| PREDICTED: uncharacterized protein LOC102708848 [Oryza brachyantha]
Length=2487

 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 168/240 (70%), Gaps = 8/240 (3%)
 Frame = +1

Query  1     KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
             +++LKR+ V++ DLM++A+SFP  +EL L  C++F  +GLA +A +CR L VLDLI+  +
Sbjct  2013  RIFLKRMTVTDNDLMLMAQSFPKLRELKLVSCDKFSATGLAIIAGQCRHLCVLDLINDRI  2072

Query  181   KD---DEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             +D   ++VDWIS FP+  T LESL+F+CV+   NFQALE LV+RSP+L++L++N HV++ 
Sbjct  2073  EDTVNEQVDWISMFPQPSTSLESLMFECVDTPCNFQALEALVLRSPALRRLRVNHHVTVE  2132

Query  352   QLYRLMLRAPQLTDLGTGSF----GASEEEAELEL-DYTSAFAACKSLVYLSGFREILAD  516
             QL  LM  AP LT LGTG F    G    EA   + D  ++FAACKSL+ LSGF ++  +
Sbjct  2133  QLCCLMAIAPNLTHLGTGVFRSRTGYPAGEAPTSVSDLATSFAACKSLISLSGFLDMNPE  2192

Query  517   YLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             YLPAIYPVC NLT+L     SI+A+QL P+I  C KLQ L V  +V D+ L AVA TC D
Sbjct  2193  YLPAIYPVCANLTSLVLISMSITAQQLTPIIQCCGKLQTLCVSHTVGDDALCAVAKTCFD  2252



>gb|KCW64321.1| hypothetical protein EUGRSUZ_G01952 [Eucalyptus grandis]
Length=438

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 158/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++ L +++RSF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVTDDGLELISRSFVNFKSLVLVSCEGFTTDGLAAIAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W++CFP++ T L SL F C++ D+N  ALE+LV RSP LK L+L+R V +  L 
Sbjct  164  EDHRGQWLNCFPDSCTSLVSLNFACLKGDINLAALERLVARSPYLKSLRLSRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++RAPQL DLG GSF   + ++E      +A   CKS+  LSGF E+ A  LPAIYP+
Sbjct  224  KILVRAPQLVDLGVGSF-VHDPDSETYNKLVTAIEKCKSMRSLSGFLEVSAYCLPAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL  VA++CK+
Sbjct  283  CSGLTSLNLSYAPGIPGSELTKLIRHCRKLQRLWILDCIGDKGLGVVASSCKE  335



>ref|XP_006841829.1| hypothetical protein AMTR_s00003p00270130 [Amborella trichopoda]
 gb|ERN03504.1| hypothetical protein AMTR_s00003p00270130 [Amborella trichopoda]
Length=579

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 157/235 (67%), Gaps = 7/235 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V +E L  L +SFPNFK L L  C+ F T GLA +A  CR L  LDL +  +
Sbjct  118  ELRLKRMTVEDESLEFLGQSFPNFKALSLVSCDGFSTDGLAAIASSCRNLEELDLQENGI  177

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            KD    W+SCFPE+ T + +L F  +  +VNF ALE+LV R  SLK LKLNR VS+ QL 
Sbjct  178  KDYGGHWLSCFPESFTSMVALNFANLNSEVNFDALERLVTRCKSLKVLKLNRSVSLEQLQ  237

Query  361  RLMLRAPQLTDLGTGSFGAS---EEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RL++RAPQLT+LGTGSF      ++ +ELE     AF+ CKS+  LSG  E+ + YLP I
Sbjct  238  RLLVRAPQLTELGTGSFSQDLSLKQYSELE----QAFSNCKSIHTLSGLWEVTSLYLPTI  293

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            YPVC+NL  LN SYA + + +L  ++  C  LQ LWVLD+V D+GL+AVA++C +
Sbjct  294  YPVCSNLKFLNLSYAGLRSPELARLLESCPNLQCLWVLDTVGDKGLEAVASSCPN  348



>ref|XP_009403780.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403781.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403782.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403783.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 156/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++DL +LARSFP+FK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVTDDDLELLARSFPSFKSLVLVSCEGFSTDGLAAIATYCRGLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ ++N  ALE+LV R P L+ LKLNR +S+  L 
Sbjct  164  EDHGRQWLSCFPDSCTSLVSLNFACLKGEINTNALERLVARCPDLRSLKLNRAISVESLN  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R++ RAP L DLGTGS   +    E      +AF  CKSL  LSGF +  +  L A+YPV
Sbjct  224  RILARAPHLVDLGTGSMMVN-HHTEAYHRLINAFLGCKSLRSLSGFWDASSCCLQAVYPV  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA +I  + L  +IC C KLQ LWVLD + D+GL AVA+TCKD
Sbjct  283  CVNLTALNLSYAPAIQGDDLIKLICLCFKLQKLWVLDCIGDKGLAAVASTCKD  335



>emb|CBI21294.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 153/225 (68%), Gaps = 2/225 (1%)
 Frame = +1

Query  25   VSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDEVDWI  204
            VSNE L +LARSF NFK LVL  CE F T GLA VA  CR LR LDL + +V+D +  W+
Sbjct  3    VSNEGLELLARSFVNFKSLVLVSCEGFTTDGLAAVAANCRFLRELDLQENEVEDRKGQWL  62

Query  205  SCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLMLRAPQ  384
            SCFP++ T L SL F C++ +VN  ALE+LV R P+LK L+LNR V +  L R+++ APQ
Sbjct  63   SCFPDSCTSLVSLNFACLKGEVNLTALERLVARCPNLKSLRLNRAVPLDALQRILMHAPQ  122

Query  385  LTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVCTNLTTLN  564
            L DLGTGS+   + +AE      S F  CKS+  +SGF E+    LPAIYP+C+NLT+LN
Sbjct  123  LVDLGTGSY-VHDPDAETVNKLISTFQKCKSIRSMSGFLEVAPLCLPAIYPICSNLTSLN  181

Query  565  FSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             SYA  I  ++L  +I +C KLQ LW+LD + D+GL  VA TCK+
Sbjct  182  LSYAPGIHGDELIKLIRYCRKLQRLWILDCIGDKGLGVVACTCKE  226



>dbj|BAK07267.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=606

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 163/241 (68%), Gaps = 11/241 (5%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFP-NFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            L LKRI V+++DL +LARS P +F+EL L  C+ F + GLA++A  CR LRVLD++DC++
Sbjct  132  LSLKRITVTDDDLDLLARSLPPSFRELSLLLCDGFSSRGLASLASHCRGLRVLDVVDCEL  191

Query  181  ---KDDEV-DWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
               +DDEV DW++ FP   T LESL F+C    V F ALE LV RSP L++L++N+HVS+
Sbjct  192  NEEEDDEVSDWVAAFPRGHTDLESLSFECFTPQVPFAALEALVARSPRLRRLRVNQHVSL  251

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT---SAFAA---CKSLVYLSGFREIL  510
             QL RLM   P+LT LGTGSF   +   +  LD+    +AFA+     SLV LSGFR++ 
Sbjct  252  GQLRRLMTLTPRLTHLGTGSFRPGDGADDEGLDFGQMLTAFASAGRANSLVSLSGFRDLA  311

Query  511  ADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
             +YLP I  V  NLTT++ S+A ++ +Q+   I  C  L+ LWVLDSV DEGL+AVA  C
Sbjct  312  PEYLPTIATVAANLTTMDLSFAPVNPDQVLLFIGQCRSLETLWVLDSVRDEGLQAVAMCC  371

Query  691  K  693
            K
Sbjct  372  K  372



>ref|XP_003624463.1| Protein AUXIN SIGNALING F-BOX [Medicago truncatula]
 gb|AES80681.1| transport inhibitor response 1 protein [Medicago truncatula]
Length=571

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 157/237 (66%), Gaps = 10/237 (4%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA VA  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLSRSFVNFKSLVLVSCEGFTTDGLAAVAANCRSLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D +  W+SCFPE+ T L SL F C++ D+N  ALE+LV RSP+LK L+LNR V +  L 
Sbjct  164  EDHKGQWLSCFPESCTSLVSLNFACLKGDINLGALERLVSRSPNLKSLRLNRSVPVDALQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAA----CKSLVYLSGFREILADYLPA  528
            R++ RAPQL DLG GSF       +L  D  + F A    CKS+  LSGF E+    L A
Sbjct  224  RILTRAPQLMDLGIGSF-----FHDLNSDAYAMFKATILKCKSITSLSGFLEVAPFSLAA  278

Query  529  IYPVCTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            IYP+C NLT+LN SYA+ I   +L  +I HC KLQ LW++D + D GL  VA+TCK+
Sbjct  279  IYPICQNLTSLNLSYAAGILGIELIKLIRHCGKLQRLWIMDRIGDLGLGVVASTCKE  335



>ref|XP_003558633.1| PREDICTED: transport inhibitor response 1-like protein [Brachypodium 
distachyon]
Length=603

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 158/241 (66%), Gaps = 11/241 (5%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFP-NFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            L LKRI V++ DL +LARS P +F+EL L  C+ F + GLA++A  CR LRVLD++DC++
Sbjct  129  LSLKRITVTDADLDLLARSLPASFRELSLLLCDGFSSRGLASIASHCRGLRVLDVVDCEM  188

Query  181  ---KDDEV-DWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSI  348
               +DDEV DW++ FP   T LESL F+C    V F ALE LV RSP L +L +N+HVS+
Sbjct  189  NEEEDDEVSDWVAAFPGGHTHLESLSFECFTPQVPFAALEALVARSPRLHRLGVNQHVSL  248

Query  349  VQLYRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKS------LVYLSGFREIL  510
             QL RLM   P+LT LGTGSF   +   +  LD+     A  S      LV LSGFR++ 
Sbjct  249  GQLRRLMALTPRLTHLGTGSFRPGDGVEDQGLDFGQILTAFTSAGRPNTLVSLSGFRDLA  308

Query  511  ADYLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
             +YLPAI  V  NLT+L+ SYA ++ +Q+ P I  C  L+ LWVLDSV DEGL+AVA  C
Sbjct  309  PEYLPAIAVVSANLTSLDLSYAPVTPDQILPFIGQCCSLETLWVLDSVRDEGLEAVAMYC  368

Query  691  K  693
            K
Sbjct  369  K  369



>ref|XP_010249158.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Nelumbo nucifera]
Length=573

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 158/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSFPNF+ LVL  CE F T GLA++A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLSRSFPNFQSLVLVSCEGFSTDGLASIAANCRVLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+ CFP++ T L SL F C++ +VN  ALE+LV R P+L+ L+LNR V +  L+
Sbjct  164  EDRRGHWLGCFPDSCTSLVSLNFACLKGEVNLGALERLVARCPNLRSLRLNRAVPLEALH  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAPQL D+G GS+   E  +E  +   +A   CKS+  LSGF E+    LPA YP+
Sbjct  224  KILTRAPQLVDIGIGSY-VHESNSEAYVKLCNAVLNCKSVQSLSGFLEVAPCCLPAFYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL+ VA+TCK+
Sbjct  283  CLNLTSLNLSYAPGIQGNELINLIRHCRKLQRLWILDYIGDKGLEVVASTCKE  335



>ref|XP_002512866.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
 gb|EEF49369.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
Length=571

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 158/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA+VA  CR +R LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLSRSFLNFKSLVLVSCEGFTTDGLASVAANCRYIRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ TCL SL F C++ D+N   LE+LV RSP+L+ L+LNR V +  L 
Sbjct  164  EDHRGHWLSCFPDSSTCLTSLNFACLKGDINLGVLERLVARSPNLRSLRLNRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++++APQL DLG GS+   + ++E      +A   CKS+  LSGF ++    LPA + +
Sbjct  224  KILMQAPQLVDLGVGSY-VHDPDSETYSKLVAAVQKCKSVRSLSGFLDVAPHCLPAFHLM  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL+ VA+TCKD
Sbjct  283  CPNLTSLNLSYAPGIQGSELTKLIRHCRKLQRLWILDCIGDKGLEVVASTCKD  335



>ref|XP_010038170.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Eucalyptus 
grandis]
 gb|KCW49983.1| hypothetical protein EUGRSUZ_K03439 [Eucalyptus grandis]
Length=581

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++ARSF NFK LVL+ CE F T GLA VA  CR LR LDL + +V
Sbjct  105  EIRLKRMVVTDESLELIARSFKNFKVLVLSSCEGFSTDGLAAVAANCRNLRELDLRESEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP++ T L SL   C+  +V+F ALE+LV R P L+ L+LNR V + +L 
Sbjct  165  EDMSGHWLSHFPDSYTSLVSLNISCLGSEVSFSALERLVSRCPDLRSLRLNRTVPLDRLA  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG + A     +   +   A A C+ L  LSGF +++  YLPA+YP+
Sbjct  225  NLLRRAPQLAELGTGVYSAELRSDDFS-NLVGALAGCRELRSLSGFWDVVPAYLPAVYPL  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I + +L  +I  CH LQ LWVLD + D GL+A+AA CKD
Sbjct  284  CSGLTSLNLSYATIQSSELTKLISQCHSLQRLWVLDYIEDSGLEALAACCKD  335



>ref|XP_006479877.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Citrus 
sinensis]
 gb|KDO87391.1| hypothetical protein CISIN_1g007912mg [Citrus sinensis]
Length=585

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L ++A+SF NFK LVL+ CE F T GLA +A +C+ L+ LDL + DV
Sbjct  110  ELKLKRMVVTDESLELIAKSFKNFKVLVLSSCEGFSTHGLAAIAADCKNLKELDLWESDV  169

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   +W+S FP+T T L SL   C+  +V+F ALE+LV+R P+L+ L+LNR V + +L 
Sbjct  170  EDPSGNWLSKFPDTCTSLVSLNIACLGSEVSFSALERLVVRCPNLRTLRLNRAVPLEKLA  229

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ +APQL +LGTG++ A +   ++  +   AF+ CK L  LSGF +++  YLPA+Y V
Sbjct  230  HLLRQAPQLVELGTGTYSA-DLRPDIFSNLAGAFSGCKELKSLSGFWDVVPAYLPAVYSV  288

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA+I +  L  ++  C KLQ LWVLD + D GL+A+AATCKD
Sbjct  289  CSGLTTLNLSYATIQSPDLIKLVSQCPKLQCLWVLDYIEDSGLEALAATCKD  340



>gb|AIT18061.1| auxin signaling F-box protein 2 [Prunus salicina]
Length=572

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 156/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA +A  CR L+ LDL + D+
Sbjct  104  ELKLKRMVVSDESLELLSRSFLNFKSLVLVSCEGFTTDGLAAIAANCRFLKELDLQENDI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE  T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V    L 
Sbjct  164  DDHRGQWLSCFPENCTSLVSLNFACLKGEINLAALERLVARSPNLKVLRLNRAVPSDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++RAPQL DLGTGS+   + ++E      +    CKS+  LSGF E+    LPAIYP+
Sbjct  224  KVLMRAPQLVDLGTGSY-VLDPDSETYNKLKATILKCKSIKSLSGFLEVAPRCLPAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  +   +L  +I HC KLQ LW+LD + D+GL  +A+TCK+
Sbjct  283  CSNLTSLNLSYAPGVHGSELIKLIRHCGKLQRLWILDCIGDKGLGVIASTCKE  335



>emb|CDY28523.1| BnaC02g36370D [Brassica napus]
Length=575

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDEGLELLSRSFVNFKSLVLVSCEGFSTDGLASIASNCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPET T L +L F C+E + N  ALE+LV RSP+L+ LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPETYTSLVTLNFACLEGETNLVALERLVARSPNLRSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+   E+++E  L   +A   C SL  LSGF E     L A +PV
Sbjct  224  RLMACAPQIVDLGVGSY-EDEQDSESCLKLQAAIRKCTSLRSLSGFLEAAPHCLSAFHPV  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIEHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>gb|EYU31866.1| hypothetical protein MIMGU_mgv1a003473mg [Erythranthe guttata]
Length=583

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 161/233 (69%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +LA+SFPNFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  111  ELRLKRMLVSDESLELLAKSFPNFKSLVLVSCEGFTTDGLAAIASNCRFLRELDLQENEV  170

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D +  W+SCFP++ T L SL F C++ +VN  ALE+LV R  +L+ L++N  V +  L 
Sbjct  171  DDRKGHWLSCFPDSCTSLVSLNFACLKGEVNVAALERLVARCHNLRSLRVNHAVPLEALQ  230

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++++APQ+ DLGTGSF   + ++E      +    CKS+  LSGF ++    LPA+YP+
Sbjct  231  KILVKAPQINDLGTGSF-VHDPDSETSKKMKNTLENCKSVRSLSGFLDVNPHCLPAVYPI  289

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            CT+LT+LN SYA  I + +L  +ICHC KL+ LW+LD++ D+GL AVA+TCK+
Sbjct  290  CTDLTSLNLSYAPGIYSNELIKLICHCKKLERLWILDTIGDKGLGAVASTCKE  342



>ref|XP_008805287.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
 ref|XP_008805288.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
 ref|XP_008805289.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
Length=575

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +LARSFPNFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLARSFPNFKVLVLVSCEGFSTDGLAAIATHCRVLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ DVN  ALE+LV R P+++ L+LNR VS+  L 
Sbjct  164  EDRGPQWLSCFPDSCTSLVSLNFACLKGDVNAGALERLVARCPNIRTLRLNRAVSVDSLS  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAP L DLGTGSF   +  AE      + F  CKSL  LSGF +     LPA+YP+
Sbjct  224  KILARAPHLVDLGTGSF-TMDHRAEAYHRLMNNFTKCKSLKSLSGFWDASPRCLPAVYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA +I    L  +I  C KLQ LWVLD + D+GL  VA+TCK+
Sbjct  283  CRNLTGLNLSYAPAIQGADLIKLIRLCLKLQRLWVLDCIGDKGLAVVASTCKE  335



>gb|EYU34827.1| hypothetical protein MIMGU_mgv1a003674mg [Erythranthe guttata]
Length=570

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 158/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +LA+SFP F+ LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVTDESLELLAKSFPTFRSLVLVSCEGFTTDGLAAIASGCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D +  W+SCFP+T T L SL F C++ +VN  ALE+LV R P+L  L+LN  V +  L+
Sbjct  164  DDRKGQWLSCFPDTCTSLVSLNFACLKGEVNVSALERLVGRCPNLTSLRLNHTVPLDALH  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAPQL DLGTGSF   + ++E      +    C S+  LSGF ++    LP+IYP+
Sbjct  224  KILARAPQLNDLGTGSF-VHDPDSESCNKLKNVLRMCTSIRSLSGFLDVNGRSLPSIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            CTNLT+LN SYA  I + +L  +ICHC KL+ LW+LD++ D+GL  VA+TCK+
Sbjct  283  CTNLTSLNLSYAPGIYSNELIKLICHCKKLERLWILDTIGDKGLGVVASTCKE  335



>ref|XP_010502624.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Camelina sativa]
Length=575

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP+T T L +L F C+E + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+  ++ E+E  L   +A   C SL  LSGF E     L A +P+
Sbjct  224  RLMSCAPQMVDLGVGSY-ENDPESESYLKLQAAIKKCTSLRSLSGFLEAAPHCLSAFHPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_006395519.1| hypothetical protein EUTSA_v10003903mg [Eutrema salsugineum]
 gb|ESQ32805.1| hypothetical protein EUTSA_v10003903mg [Eutrema salsugineum]
Length=575

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++  L +L+RSFPNFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDVSLELLSRSFPNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP+T T L +L F C+E + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM+ APQ+ DLG GS+  ++ ++E  L   +A   C SL  LSGF E     L A +P+
Sbjct  224  RLMVCAPQIVDLGVGSY-ENDPDSESYLKLQAAIKKCTSLKRLSGFLEASPHCLSAFHPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL  VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLAVVASTCKE  335



>ref|XP_007217221.1| hypothetical protein PRUPE_ppa003465mg [Prunus persica]
 gb|AFB74453.1| transport inhibitor response protein [Prunus persica]
 gb|EMJ18420.1| hypothetical protein PRUPE_ppa003465mg [Prunus persica]
Length=572

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA +A  CR L+ LDL + D+
Sbjct  104  ELRLKRMVVSDESLELLSRSFLNFKSLVLVSCEGFTTDGLAAIAANCRFLKELDLQENDI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE  T L SL F C++ ++N  ALE+LV RSP LK L+LNR V    L 
Sbjct  164  DDHRGQWLSCFPENCTSLVSLNFACLKGEINLAALERLVARSPDLKVLRLNRAVPPDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++RAPQL DLGTGS+   + ++E      +    CKS+  LSGF E+    LPA YP+
Sbjct  224  KVLMRAPQLVDLGTGSY-VLDPDSETYNKLKATILKCKSIKSLSGFLEVAPRCLPAFYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  +   +L  +I HC KLQ LW+LD + D+GL  +A+TCK+
Sbjct  283  CSNLTSLNLSYAPGVHGSELIKIIRHCGKLQRLWILDCIGDKGLGVIASTCKE  335



>ref|XP_010112739.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus notabilis]
 gb|EXC34697.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus notabilis]
Length=582

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 156/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++A+SF NFK LVL+ CE F T GLA +A  CR LR LDL + DV
Sbjct  105  EIRLKRMVVTDESLELIAKSFKNFKALVLSSCEGFSTDGLAAIAANCRNLRELDLRESDV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP+T T L SL   C+  +++F ALE+LV R P+L+ L+LNR V I +L 
Sbjct  165  DDLSGHWLSHFPDTYTSLVSLDISCLGSEMSFTALERLVGRCPNLRSLRLNRTVPIEKLA  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ +APQL +LGTG++ A E   E+  +   A + CK L  LSGF E +  YLPA+Y +
Sbjct  225  NLLRQAPQLVELGTGAYSA-ELRPEVFSNLAGALSGCKELKSLSGFWEAVPAYLPAVYSI  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  LT+LN SYA+I +  L  ++ HC KLQ LWVLD + D GL+A+AA+CKD
Sbjct  284  CPGLTSLNLSYAAIQSPHLIKLLSHCPKLQRLWVLDYIEDVGLEALAASCKD  335



>ref|XP_009386581.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009386582.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009386583.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 157/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++DL +LARSFPNFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVTDDDLELLARSFPNFKSLVLVSCEGFSTDGLAAIATYCRGLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ +VN  ALE+LV R P+L+ LKLN  +S+  L 
Sbjct  164  EDHGRQWLSCFPDSCTSLVSLNFACLKGEVNASALERLVARCPNLRSLKLNHSISVESLN  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAP L DLGTGSF A +  +E      ++F  CKSL  LSGF +     L A+YPV
Sbjct  224  KILARAPHLVDLGTGSF-AIDNRSETYHRLINSFFKCKSLRSLSGFWDASPFCLQALYPV  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            CTNLT LN SYA +I +  L  +I  C KLQ LWVLD + D+GL  VA+TCK+
Sbjct  283  CTNLTVLNLSYAPAIQSADLTKLIGLCFKLQKLWVLDCIGDKGLAVVASTCKE  335



>ref|XP_010523990.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Tarenaya hassleriana]
 ref|XP_010523991.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Tarenaya hassleriana]
Length=590

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 158/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++A+SF NFK LVL+ CE F T GLA +A  CR LR LDL +CDV
Sbjct  109  EIRLKRMVVTDECLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAANCRNLRELDLRECDV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP++ T L SL   C+  +V+F ALE+LV R P+LK L+LNR V + +L 
Sbjct  169  EDVSGHWLSHFPDSYTSLVSLNISCLSSEVSFSALERLVSRCPNLKSLRLNRAVPLERLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG + A E   ++    ++AF+ CK L  LSGF + +  YLPAIY  
Sbjct  229  TLLQRAPQLVELGTGGYTA-ELRPDVFSSLSAAFSGCKGLKSLSGFWDAVPAYLPAIYSA  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA++ +  L  ++  C KLQ LWVLD + D GL+A+A++CKD
Sbjct  288  CSGLTTLNLSYATVQSSDLVKLLSQCQKLQRLWVLDYIEDVGLEALASSCKD  339



>ref|XP_010066425.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Eucalyptus grandis]
 gb|KCW64320.1| hypothetical protein EUGRSUZ_G01952 [Eucalyptus grandis]
Length=572

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 158/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++ L +++RSF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVTDDGLELISRSFVNFKSLVLVSCEGFTTDGLAAIAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W++CFP++ T L SL F C++ D+N  ALE+LV RSP LK L+L+R V +  L 
Sbjct  164  EDHRGQWLNCFPDSCTSLVSLNFACLKGDINLAALERLVARSPYLKSLRLSRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++RAPQL DLG GSF   + ++E      +A   CKS+  LSGF E+ A  LPAIYP+
Sbjct  224  KILVRAPQLVDLGVGSF-VHDPDSETYNKLVTAIEKCKSMRSLSGFLEVSAYCLPAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL  VA++CK+
Sbjct  283  CSGLTSLNLSYAPGIPGSELTKLIRHCRKLQRLWILDCIGDKGLGVVASSCKE  335



>emb|CBI32265.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 150/224 (67%), Gaps = 1/224 (0%)
 Frame = +1

Query  25   VSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDEVDWI  204
            V++E L +++RSF NFK LVL+ CE F T GLA +A  CR LR LDL + +V D    W+
Sbjct  3    VTDESLELISRSFKNFKVLVLSSCEGFSTDGLAAIAANCRNLRELDLRESEVDDFSGHWL  62

Query  205  SCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLMLRAPQ  384
            + FP++ T L SL   C+  +V+F ALE+LV R PSL+ L+LNR V + +L  L+ RAPQ
Sbjct  63   THFPDSCTSLVSLNISCLASEVSFSALERLVGRCPSLRTLRLNRAVPLDRLPNLLRRAPQ  122

Query  385  LTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVCTNLTTLN  564
            L +LGTG++ A E   E+      AF+ CK L  LSGF +++ DYLPA+YP C+ +T+LN
Sbjct  123  LVELGTGAYSA-EHRPEVFSSLAGAFSNCKELKSLSGFWDVVPDYLPAVYPACSGITSLN  181

Query  565  FSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             SYA+I +  L  ++  C  LQ LWVLD + D GL A+AA+CKD
Sbjct  182  LSYATIQSPDLIKLVTQCQNLQRLWVLDYIEDSGLDALAASCKD  225



>ref|XP_006290819.1| hypothetical protein CARUB_v10016928mg [Capsella rubella]
 gb|EOA23717.1| hypothetical protein CARUB_v10016928mg [Capsella rubella]
Length=575

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 156/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP+T T L +L F C+E + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  EDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+  ++ ++E  L   +A   C SL  LSGF E     L A +P+
Sbjct  224  RLMACAPQIVDLGVGSY-ENDPDSESYLKLKAAIKKCTSLRSLSGFLEAAPHCLSAFHPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>gb|AIT18060.1| auxin signaling F-box protein 2 [Prunus salicina]
Length=572

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSFPN K LVL  C  F T GLA +A  CR L+ LDL + D+
Sbjct  104  ELRLKRMVVSDESLELLSRSFPNLKSLVLVSCGGFTTDGLAAIAANCRFLKELDLQENDI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE  T L SL F C++ ++N  ALE+LV RSP+L+ L+LNR V    L 
Sbjct  164  DDHRGQWLSCFPENCTSLVSLNFACLKGEINLAALERLVARSPNLRVLRLNRAVPSDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++RAPQL DLGTGS+   + ++E      +    CKS+  LSGF E+    LPAIYP+
Sbjct  224  KVLMRAPQLVDLGTGSY-VLDPDSETYNKLKATVLKCKSIKSLSGFLEVSPRCLPAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  +   +L  +I HC KLQ LW+LD + D+GL  +A+TCK+
Sbjct  283  CSNLTSLNLSYAPGVHGSELIKLIRHCGKLQRLWILDCIGDKGLGVIASTCKE  335



>gb|AIG99441.1| transport inhibitor response 1 [Morus alba var. multicaulis]
Length=585

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 156/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++A+SF NFK LVL+ CE F T GLA +A  CR LR LDL + DV
Sbjct  108  EIRLKRMVVTDESLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAANCRNLRELDLRESDV  167

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP+T T L SL   C+  +++F ALE+LV R P+L+ L+LNR V I +L 
Sbjct  168  DDLSGHWLSHFPDTYTSLVSLDISCLGSEMSFTALERLVGRCPNLRSLRLNRTVPIERLA  227

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ +APQL +LGTG++ A E   E+  +   A + CK L  LSGF E +  YLPA+Y +
Sbjct  228  NLLRQAPQLVELGTGAYSA-ELRPEVFSNLAGALSGCKELKSLSGFWEAVPAYLPAVYSI  286

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  LT+LN SYA+I +  L  ++ HC KLQ LWVLD + D GL+A+AA+CKD
Sbjct  287  CPGLTSLNLSYAAIQSPHLVKLLSHCPKLQRLWVLDYIEDVGLEALAASCKD  338



>ref|XP_009129474.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Brassica rapa]
Length=575

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR L+ LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFSTDGLASIASNCRHLQDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPET T L +L F C+E + N  ALE+LV RSP+L+ LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPETYTSLVTLNFACLEGETNLVALERLVARSPNLRSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+   E+++E  L   +A   C SL  LSGF E     L A +PV
Sbjct  224  RLMACAPQIVDLGVGSY-EDEQDSESCLKLQAAIRKCTSLRSLSGFLEAAPHCLSAFHPV  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIEHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>gb|KFK30917.1| hypothetical protein AALP_AA6G042500 [Arabis alpina]
Length=586

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ +++E L M+A SF  FK LVL  CE F T G+A +A  CR L VL+L +C V
Sbjct  105  EIRLKRMVITDECLEMIAASFKEFKALVLVSCEGFTTDGIAAIAATCRNLEVLELRECIV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   DW+S FPE+ T L SL F C++ +V    LE+LV RSP+LK LKLNR V++  L 
Sbjct  165  EDLGGDWLSYFPESLTSLVSLDFSCLDSEVKLSDLERLVSRSPNLKSLKLNRAVTLEGLE  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQLTDLGTGSF A E E E+    + AFA CK L  LSG  +++ +YLPA+Y V
Sbjct  225  SLLRRAPQLTDLGTGSFSA-EFEPEMFSKLSKAFAECKQLKSLSGLWDVIPEYLPALYSV  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  LT+LN SYA++    L  ++  C KLQ LWV+D + D+GL+ VA  CKD
Sbjct  284  CPGLTSLNLSYATVRMPDLVGILRRCWKLQKLWVMDLIEDKGLQTVAMRCKD  335



>ref|XP_008800392.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Phoenix 
dactylifera]
Length=590

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 159/227 (70%), Gaps = 1/227 (0%)
 Frame = +1

Query  10   LKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDD  189
            LKR+ V++E L  LARSFP FK L L  C+ F T GLA++A  CR L  LD+ +  + D 
Sbjct  126  LKRMTVTDESLDFLARSFPEFKALSLVSCDGFSTDGLASIATYCRNLTELDIQESGIDDL  185

Query  190  EVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLM  369
               W+SCFP++ T LE+L F  +  +VNF ALE+LV R  SLK LK+N+HV++ Q+ RL+
Sbjct  186  GGSWLSCFPDSFTSLEALNFANLHSEVNFDALERLVARCKSLKVLKVNKHVTLEQIRRLL  245

Query  370  LRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVCTN  549
            +R+PQLT+LGTGSF + +++   + D  SAF+ CK+   LSG  E+ + YLPA+YPVC N
Sbjct  246  VRSPQLTELGTGSF-SQDQKLRSDADLESAFSNCKNFNTLSGLWEVSSVYLPALYPVCAN  304

Query  550  LTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            LT LN SY ++ + +L  ++ +C  L+ LWVLD+V D+GL+AVA++C
Sbjct  305  LTFLNLSYTALQSTELAKLLQNCPLLRRLWVLDTVEDKGLEAVASSC  351



>ref|XP_010052384.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Eucalyptus 
grandis]
 gb|KCW76344.1| hypothetical protein EUGRSUZ_D00716 [Eucalyptus grandis]
 gb|KCW76345.1| hypothetical protein EUGRSUZ_D00716 [Eucalyptus grandis]
Length=584

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 149/230 (65%), Gaps = 1/230 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L  LA  FPNF+ L L  C+ F T GLA +A  CR L  LD+ +  +
Sbjct  122  ELRLKRMTVTDESLKFLALKFPNFRALSLMSCDGFSTDGLAAIATRCRNLTELDIQENGI  181

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   DW+SCFPE  T LE L F  +  DV+F ALE+LV R  SLK LK+NR +S+ QL 
Sbjct  182  DDISGDWLSCFPENFTSLEVLNFASLNSDVDFDALERLVSRCNSLKVLKVNRTISLDQLQ  241

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++RAP+LT+LGTGSF   E  A    +   AF  CK+L  LSG  E +A YLP +YP 
Sbjct  242  RLLVRAPRLTELGTGSF-LQELNAHQYSELERAFGGCKTLHTLSGLYEAMAPYLPVLYPA  300

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            C NLT LN + A++  E+L  ++ HC  LQ LWVLD+V DEGL AVA +C
Sbjct  301  CANLTFLNLNDAALQNEELAKLVVHCPCLQRLWVLDTVGDEGLGAVARSC  350



>ref|XP_009405455.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 153/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +LARSFPNFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLARSFPNFKALVLVSCEGFTTDGLAAIATHCRGLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T LESL F C++ +VN  ALE+LV R  +L+ LKLNR +S+  L 
Sbjct  164  EDHGRQWLSCFPDSCTSLESLNFACLKGEVNAGALERLVARCVNLRSLKLNRAISVESLA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R++ R P L +LGTGSF   E  AE       AF  CKSL  LSGF ++    L +IY +
Sbjct  224  RMLARTPHLVELGTGSF-TVEHRAEAYQRLIHAFRKCKSLKSLSGFWDVAPRCLQSIYSI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA +I    L  +I HC KLQ LWVLD + D+GL  VA+TC++
Sbjct  283  CPNLTVLNLSYAPAIQGADLVKLIRHCFKLQKLWVLDCIRDKGLAVVASTCQE  335



>ref|XP_006444233.1| hypothetical protein CICLE_v10019437mg [Citrus clementina]
 gb|ESR57473.1| hypothetical protein CICLE_v10019437mg [Citrus clementina]
Length=585

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 161/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L ++A+S  NFK LVL+ CE F T GLA +A +C+ L+ LDL + DV
Sbjct  110  ELKLKRMVVTDESLELIAKSLKNFKVLVLSSCEGFSTHGLAAIAADCKNLKELDLWESDV  169

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   +W+S FP+T T L SL   C+  +V+F ALE+LV+R P+L+ L+LNR V + +L 
Sbjct  170  EDPSGNWLSKFPDTCTSLVSLNIACLGSEVSFSALERLVVRCPNLRTLRLNRAVPLEKLA  229

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ +APQL +LGTG++ A +   ++  +   AF+ CK L  LSGF +++  YLPA+Y V
Sbjct  230  HLLRQAPQLVELGTGTYSA-DLRPDIFSNLAGAFSGCKELKSLSGFWDVVPAYLPAVYSV  288

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA+I +  L  ++  C KLQ LWVLD + D GL+A+AATCKD
Sbjct  289  CSGLTTLNLSYATIQSPDLIKLVSQCPKLQCLWVLDYIEDSGLEALAATCKD  340



>ref|XP_008231044.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Prunus mume]
Length=572

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA +A  CR L+ LDL + D+
Sbjct  104  ELRLKRMVVSDESLELLSRSFLNFKSLVLVSCEGFTTDGLAAIAANCRFLKELDLQENDI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE  T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V    L 
Sbjct  164  DDHRGQWLSCFPENCTSLVSLNFACLKGEINLAALERLVARSPNLKVLRLNRAVPPDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++ APQL DLGTGS+   + ++E      +    CKS+  LSGF E+    LPAIYP+
Sbjct  224  KVLMLAPQLVDLGTGSY-VLDPDSETYNKLKATILKCKSIKSLSGFLEVAPRCLPAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL  +A+TCK+
Sbjct  283  CSNLTSLNLSYAPGIHGSELIKLIRHCGKLQRLWILDCIGDKGLGVIASTCKE  335



>ref|XP_010245369.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nelumbo 
nucifera]
Length=582

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 153/232 (66%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +++RSF NF  LVL+ CE F T GLA +A  CR L+ LDL +CDV
Sbjct  105  ELRLKRMVVTDEALELISRSFKNFSALVLSSCEGFTTDGLAAIAANCRNLKELDLRECDV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   +W+S FPE+ T L SL F C+E +V+F ALE+LV R  +L+ L+LN  V + +L 
Sbjct  165  DDRSGNWLSHFPESCTSLVSLSFSCLEGEVSFSALERLVSRCTNLRALRLNHSVPLDKLP  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL DLG G++ A E   EL     +AFA CK L  LSGF +++  YLPA Y V
Sbjct  225  NLLRRAPQLVDLGMGAYTA-ELRPELYSRLGNAFAGCKGLKSLSGFWDVVPSYLPATYSV  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  +T LN SYA+I +  L  +I  C  LQ LWVLD + D GL A+AA+CKD
Sbjct  284  CAGITFLNLSYATIQSPDLIKLIRQCRNLQRLWVLDYIEDSGLNALAASCKD  335



>gb|KJB11711.1| hypothetical protein B456_001G273700 [Gossypium raimondii]
Length=401

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L+RSFPNFK LVL  CE F T G+A +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDDSLELLSRSFPNFKSLVLVSCEGFTTDGVAAIAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFPE+ T L SL F C++ ++N  +LE+LV RSP+LK L+LNR V +  L 
Sbjct  164  EDHRGHWLSCFPESCTSLVSLNFACLKGEINLASLERLVARSPNLKSLRLNRVVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GS+   +  +E+     +    C S+  LSGF E+    + AIYP+
Sbjct  224  KLLMRAPQLVDLGIGSY-VDDPSSEVFSKLKAVIQLCNSIRSLSGFLEVAPCCMSAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA  +    L  ++ HC KLQ LW+LD + D+GL  VA+TCK+
Sbjct  283  CENLTFLNLSYAPGLQGNDLTKLVQHCRKLQRLWILDCIGDKGLGVVASTCKE  335



>ref|XP_010528142.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Tarenaya hassleriana]
Length=577

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 154/236 (65%), Gaps = 8/236 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLSRSFANFKSLVLISCEGFTTDGLAAIAANCRHLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP++ T L SL F C++ D+N  ALE+LV RSP LK LKLNR + +  L 
Sbjct  164  DDHRGQWLSCFPDSFTSLVSLNFACLKGDINLAALERLVARSPDLKTLKLNRAIPLDALA  223

Query  361  RLMLRAPQLTDLGTGSF---GASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            R+M+ APQL DLG GS+    ASE  A L+    +A   C SL  LSGF E     LPA 
Sbjct  224  RIMMSAPQLVDLGVGSYVNDPASESYANLK----AAIRKCVSLRSLSGFLESAPLCLPAF  279

Query  532  YPVCTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            +P+C NL +LN SYA+ I    L  +I HC KL+ LW+LDS+ D+GL  VA+TCK+
Sbjct  280  HPICHNLISLNLSYAAEIHGSYLIKLIQHCKKLRRLWILDSIGDKGLAVVASTCKE  335



>gb|EAZ18296.1| hypothetical protein OsJ_33834 [Oryza sativa Japonica Group]
Length=1184

 Score =   223 bits (567),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 160/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVK  183
            ++LKR+ VS+ DL ++A+SFP  +EL L  C++F  +GLA +A +CR L VLDLI+  V+
Sbjct  711  IFLKRMTVSDNDLRLIAQSFPQLRELSLMSCDKFSATGLAIIAEQCRHLHVLDLINDKVE  770

Query  184  D---DEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQ  354
            D    +VDWIS FP+  T LESL+F CV+   NF++LE LV RSP L +L +NRHV++ Q
Sbjct  771  DTVDKQVDWISMFPKPSTSLESLLFSCVDTPCNFESLEALVARSPGLCQLGVNRHVTVEQ  830

Query  355  LYRLMLRAPQLTDLGTGSF----GASEEEAELEL-DYTSAFAACKSLVYLSGFREILADY  519
            L  LM  AP LT LGTG F    G    EA   + +  + FAAC+SL  LSG ++   DY
Sbjct  831  LCCLMAIAPNLTHLGTGVFRSKTGYPAGEAPPSVSELATYFAACRSLHSLSGLQDANPDY  890

Query  520  LPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            LPAIYPVC NLT+LN S A+++ +QL P+I  C  L+   V DS+ D+GL A+A TC D
Sbjct  891  LPAIYPVCANLTSLNISSATLTGQQLAPIIRSCGNLRTFCVRDSIGDDGLSAIAETCLD  949



>ref|XP_010514346.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Camelina sativa]
Length=575

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP+T T L +L F C+E + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+  ++ ++E  L   +A   C SL  LSGF E     L A +P+
Sbjct  224  RLMSCAPQMVDLGVGSY-ENDPDSESYLKLQAAIKKCTSLRSLSGFLEAAPHCLSAFHPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_007161649.1| hypothetical protein PHAVU_001G087000g [Phaseolus vulgaris]
 gb|ESW33643.1| hypothetical protein PHAVU_001G087000g [Phaseolus vulgaris]
Length=573

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 153/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA VA  CR LR LDL + +V
Sbjct  105  ELRLKRMVVSDESLELLSRSFTNFKSLVLVSCEGFTTDGLAAVAANCRYLRELDLQENEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D +  W+SCFP++ T L SL F C++ +V+  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  165  EDHKGQWLSCFPDSCTSLVSLNFACLKGEVSLGALERLVARSPNLKSLKLNRSVPLDALQ  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R++ RAPQL DLG GS    + E+E  +   +    CKS+  LSG  E+    L AIYP+
Sbjct  225  RILTRAPQLADLGIGSL-VHDPESEAYIKLKNTILKCKSITSLSGLLEVAPHCLAAIYPI  283

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW++D + D+GL  VA TC D
Sbjct  284  CPNLTSLNLSYAAGIQGSDLIKLIRHCVKLQRLWIMDCIGDKGLGVVAQTCTD  336



>gb|EYU46730.1| hypothetical protein MIMGU_mgv1a003374mg [Erythranthe guttata]
Length=589

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 160/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V+++ L ++++SF NFK LVL+ CE F T GLA++A  CR LR LDL + +V
Sbjct  105  EIKLKRMVVTDDTLELISKSFKNFKVLVLSSCEGFTTDGLASIAANCRNLRDLDLRESEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP+  T L SL   C+  +V+F ALE+LV RSP+LK L+LNR V + +L 
Sbjct  165  EDLSGHWLSHFPDNCTSLVSLNMSCLGSEVSFSALERLVARSPNLKTLRLNRAVPLEKLS  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+LRAPQL +LGTG++ A E  ++   + T AF+ACK L  LSGF +++  YLPA+  V
Sbjct  225  NLLLRAPQLVELGTGAYSA-EVRSDTFSNLTEAFSACKHLKGLSGFWDVVPAYLPAMSSV  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT LN SYA+I +  L  ++  C  LQ LWVLD + D GL+AVAA+CKD
Sbjct  284  CSGLTWLNLSYATIQSSDLIKLVTQCRNLQRLWVLDYIEDSGLEAVAASCKD  335



>gb|ACX31301.2| transport inhibitor response 1 [Dimocarpus longan]
Length=586

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 159/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++A+SF +FK LVL+ CE F T GL  +A  CR LR LDL + +V
Sbjct  110  EIRLKRMVVTDETLELIAKSFKSFKVLVLSSCEGFSTHGLGAIASNCRNLRELDLRESEV  169

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             +   +W++ FP+T T L SL   C+  +VNF ALE+LV RSP+L+ L+LNR V + +L 
Sbjct  170  DEVSGNWLNDFPDTCTSLVSLNISCLVSEVNFSALERLVGRSPNLRTLRLNRAVPLDKLA  229

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG++ A +   E+  +   AF+ CK L  LSGF ++ + YLPAIYPV
Sbjct  230  NLLCRAPQLVELGTGAYSA-DLRPEVFSNLVGAFSGCKQLKGLSGFWDVASAYLPAIYPV  288

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYAS+ +  L  ++  C  LQ LWVLD + D GL+A+AA+CKD
Sbjct  289  CSGLTSLNLSYASVQSPDLIKLVSQCPNLQRLWVLDYIEDSGLEALAASCKD  340



>ref|XP_002875343.1| auxin signaling F-box 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51602.1| auxin signaling F-box 2 [Arabidopsis lyrata subsp. lyrata]
Length=575

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP+T T L +L F C+E + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+  ++ ++E  +   +A   C SL  LSGF E     L A +P+
Sbjct  224  RLMACAPQIVDLGVGSY-ENDPDSESYMKLKAAIKKCTSLRSLSGFLEAAPHCLSAFHPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_007159244.1| hypothetical protein PHAVU_002G221400g [Phaseolus vulgaris]
 gb|ESW31238.1| hypothetical protein PHAVU_002G221400g [Phaseolus vulgaris]
Length=578

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 154/230 (67%), Gaps = 1/230 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L  LA SFPNFK L L  C+ F T G+A++A  C+ L  LD+ +  +
Sbjct  116  ELRLKRMTVTDESLEFLALSFPNFKALSLLSCDGFSTDGMASIATNCKNLTELDIQENGI  175

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   +W+SCFPE+ T LE L F  +  DVNF ALE+LV R  SLK LK+N+ V++ QL 
Sbjct  176  EDKNGNWLSCFPESFTSLEVLNFANLHNDVNFDALEKLVSRCKSLKTLKVNKSVTLEQLQ  235

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++ APQL +LGTGSF + E  A+   +  SAF  C +L  LSG     A YLP +Y  
Sbjct  236  RLLVHAPQLGELGTGSF-SQELTAQQSSELGSAFKNCTNLHTLSGLWVATAQYLPVLYSA  294

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            CTNLT LNFSYA ++++ L  ++ HC KLQ LWV+D+V D+GL+AV + C
Sbjct  295  CTNLTFLNFSYAPLNSDDLAKLLVHCPKLQRLWVVDTVEDKGLEAVGSHC  344



>ref|NP_001067865.1| Os11g0462900 [Oryza sativa Japonica Group]
 gb|ABA93466.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28228.1| Os11g0462900 [Oryza sativa Japonica Group]
Length=1261

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 160/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  4     LYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVK  183
             ++LKR+ VS+ DL ++A+SFP  +EL L  C++F  +GLA +A +CR L VLDLI+  V+
Sbjct  788   IFLKRMTVSDNDLRLIAQSFPQLRELSLMSCDKFSATGLAIIAEQCRHLHVLDLINDKVE  847

Query  184   D---DEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQ  354
             D    +VDWIS FP+  T LESL+F CV+   NF++LE LV RSP L +L +NRHV++ Q
Sbjct  848   DTVDKQVDWISMFPKPSTSLESLLFSCVDTPCNFESLEALVARSPGLCQLGVNRHVTVEQ  907

Query  355   LYRLMLRAPQLTDLGTGSF----GASEEEAELEL-DYTSAFAACKSLVYLSGFREILADY  519
             L  LM  AP LT LGTG F    G    EA   + +  + FAAC+SL  LSG ++   DY
Sbjct  908   LCCLMAIAPNLTHLGTGVFRSKTGYPAGEAPPSVSELATYFAACRSLHSLSGLQDANPDY  967

Query  520   LPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             LPAIYPVC NLT+LN S A+++ +QL P+I  C  L+   V DS+ D+GL A+A TC D
Sbjct  968   LPAIYPVCANLTSLNISSATLTGQQLAPIIRSCGNLRTFCVRDSIGDDGLSAIAETCLD  1026



>gb|ACL51018.1| transport inhibitor response protein [Citrus trifoliata]
Length=569

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L+RSF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDDCLELLSRSFVNFKSLVLVSCEGFTTDGLAAIAANCRYLRELDLQEIEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D+   WISCFP++ T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V +  L 
Sbjct  164  DDNRGQWISCFPDSCTSLVSLNFSCLKGEINLTALERLVARSPNLKNLRLNRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GSF   +  +E  +   +    CKS+  LSGF E++   L AI+PV
Sbjct  224  KLLMRAPQLVDLGIGSF-VYDPSSEAYIKLKATLVKCKSIRSLSGFLEVVPCCLSAIHPV  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA  I   +L  +I  C KL+ LWVLDS+ D GL  VA TCK+
Sbjct  283  CQNLTSLNLSYAPGIHGNELIKLIRFCRKLERLWVLDSIGDRGLGVVAFTCKE  335



>emb|CDY34211.1| BnaA02g28290D [Brassica napus]
Length=575

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR L+ LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFSTDGLASIASNCRHLQDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPET T L +L F C+E + N  ALE+LV RSP+L+ LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPETYTSLVTLNFACLEGETNLVALERLVARSPNLRSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+   E+++E  L   +A   C SL  LSGF E     L A +PV
Sbjct  224  RLMACAPQIVDLGVGSY-EDEQDSESCLKLQAAIRKCTSLRSLSGFLEAAPHCLSAFHPV  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL +LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLASLNLSYAAEIHGSHLIKLIEHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_006446967.1| hypothetical protein CICLE_v10014749mg [Citrus clementina]
 ref|XP_006468869.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Citrus sinensis]
 gb|ESR60207.1| hypothetical protein CICLE_v10014749mg [Citrus clementina]
Length=570

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L+RSF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  105  ELRLKRMVVSDDCLELLSRSFVNFKSLVLVSCEGFTTDGLAAIAANCRYLRELDLQEIEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D+   WISCFP++ T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V +  L 
Sbjct  165  DDNRGQWISCFPDSCTSLVSLNFSCLKGEINLTALERLVARSPNLKSLRLNRAVPLDTLQ  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GSF   +  +E  +   +    CKS+  LSGF E++   L AI+PV
Sbjct  225  KLLMRAPQLVDLGIGSF-VYDPSSEAYIKLKATLVKCKSIRSLSGFLEVVPCCLSAIHPV  283

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA  I   +L  +I  C KL+ LW+LDS+ D GL  VA TCK+
Sbjct  284  CQNLTSLNLSYAPGIHGNELIKLIRFCRKLERLWILDSIGDRGLGVVAFTCKE  336



>gb|KDO47371.1| hypothetical protein CISIN_1g008325mg [Citrus sinensis]
Length=570

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L+RSF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  105  ELRLKRMVVSDDCLELLSRSFVNFKSLVLVSCEGFTTDGLAAIAANCRYLRELDLQEIEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D+   WISCFP++ T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V +  L 
Sbjct  165  DDNRGQWISCFPDSCTSLVSLNFSCLKGEINLTALERLVARSPNLKSLRLNRAVPLDTLQ  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GSF   +  +E  +   +    CKS+  LSGF E++   L AI+PV
Sbjct  225  KLLMRAPQLVDLGIGSF-VYDPSSEAYIKLKATLVKCKSIRSLSGFLEVVPCCLSAIHPV  283

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA  I   +L  +I  C KL+ LW+LDS+ D GL  VA TCK+
Sbjct  284  CQNLTSLNLSYAPGIHGNELIKLIRFCRKLERLWILDSIGDRGLGVVAFTCKE  336



>gb|AEQ94093.1| putative transport inhibitor response 1 [Elaeis guineensis]
Length=442

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 153/230 (67%), Gaps = 2/230 (1%)
 Frame = +1

Query  10   LKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDD  189
            LKR+ VS+E L +LARSFP+FK LVL  CE F T GLA +A  CR LR LDL + +V+D 
Sbjct  39   LKRMVVSDESLELLARSFPSFKVLVLISCEGFSTDGLAAIATHCRVLRELDLQENEVEDC  98

Query  190  EVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLM  369
               W+SCFP++ T L SL F C++ +VN  ALE+LV R P+++ L+LNR VS+  L +++
Sbjct  99   GPRWLSCFPDSCTSLVSLNFACLKGEVNAAALERLVARCPNIRTLRLNRAVSVDSLSKIL  158

Query  370  LRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVCTN  549
             RAP L DLGTGSF A +  AE      + F  CKSL  LSGF +     LPA+YP+C N
Sbjct  159  ARAPHLVDLGTGSF-AIDHHAEAYHRLINNFTKCKSLKSLSGFWDASPRCLPAVYPICGN  217

Query  550  LTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            LT LN SYA +I    L  +I  C KLQ LWVLD + D+GL  VA+TCK+
Sbjct  218  LTGLNLSYAPAIQGADLIKLIRLCLKLQRLWVLDCIGDKGLAVVASTCKE  267



>ref|XP_011098945.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Sesamum indicum]
Length=579

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 160/233 (69%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +LA+SFPNFK LVL  C+ F T GLA +A  CR LR LDL + +V
Sbjct  111  ELRLKRMVVSDESLELLAKSFPNFKSLVLVSCDGFSTDGLAAIASNCRFLRELDLQENEV  170

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D +  W+SCFP+T T L SL F C++ + +  ALE+LV R  +L+ L+LN  V +  L 
Sbjct  171  DDRKGQWLSCFPDTCTSLVSLNFACLKGEASVAALERLVARCRNLRSLRLNHAVPLDTLQ  230

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++++APQL DLGTG+F   + +++      +A   CKS+  LSGF ++    LPA+YP+
Sbjct  231  KILVQAPQLNDLGTGTF-VHDPDSDAYCKLKNAIKKCKSIRSLSGFLDVNTRCLPAVYPI  289

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            CTNLT+LN SYA  I + +L  +ICHC KL+ LW+LD++ D+GL  VA+TCK+
Sbjct  290  CTNLTSLNLSYAPGIYSSELIKLICHCKKLERLWILDTIGDKGLDVVASTCKE  342



>ref|NP_566800.1| auxin signaling F-box 2 [Arabidopsis thaliana]
 sp|Q9LW29.1|AFB2_ARATH RecName: Full=Protein AUXIN SIGNALING F-BOX 2 [Arabidopsis thaliana]
 dbj|BAB01228.1| transport inhibitor response-like protein [Arabidopsis thaliana]
 gb|AAL32646.1| transport inhibitor response-like protein [Arabidopsis thaliana]
 gb|AAQ56839.1| At3g26830 [Arabidopsis thaliana]
 gb|AEE77218.1| auxin signaling F-box 2 [Arabidopsis thaliana]
Length=575

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP+T T L +L F C+E + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+  ++ ++E  L   +    C SL  LSGF E     L A +P+
Sbjct  224  RLMACAPQIVDLGVGSY-ENDPDSESYLKLMAVIKKCTSLRSLSGFLEAAPHCLSAFHPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>gb|EPS70592.1| transport inhibitor response protein [Genlisea aurea]
Length=576

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 159/232 (69%), Gaps = 2/232 (1%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVK  183
            L LKR+ +S++ L +LA+SFPNFK LVL  CE F T GL+++A  CR LR LDL + +V 
Sbjct  106  LRLKRMVISDDSLELLAKSFPNFKSLVLVSCEGFTTDGLSSIASNCRHLRELDLQENEVD  165

Query  184  DDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYR  363
            D +  W+SCFP++ T L SL F C++ +VN  ALE LV R  +LK L+LN  V +  L R
Sbjct  166  DRKGQWLSCFPDSFTSLVSLNFACLKGEVNIPALESLVSRCRNLKNLRLNHTVPLDSLQR  225

Query  364  LMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVC  543
            +++ APQL+DLGTGSF A + +++      +A   C S+  LSGF E+    LP +YPVC
Sbjct  226  ILVLAPQLSDLGTGSFIA-DPQSDTYRKLKAALKKCSSIRSLSGFLEVNPRCLPVVYPVC  284

Query  544  TNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             NLT+LN SYA +I + ++  +IC+C +LQ LW+LD++ D+GL  VA+TCK+
Sbjct  285  WNLTSLNLSYAPAIHSNEIIKLICNCSRLQRLWILDNIGDKGLGVVASTCKE  336



>ref|XP_010052385.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Eucalyptus 
grandis]
 gb|KCW76347.1| hypothetical protein EUGRSUZ_D00718 [Eucalyptus grandis]
Length=580

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 151/230 (66%), Gaps = 1/230 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L  LAR F NF+ L L  C+ F T GL  +A +CR L  LD+ +  +
Sbjct  118  ELRLKRMTVTDESLKFLARKFHNFRVLSLLSCDGFSTDGLEAIATDCRHLTELDIQENGI  177

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   +W+SCFPE  T +E L F  +  DVNF ALE+LV +  SLK LK+N+ +++ QL 
Sbjct  178  DDISGNWLSCFPENFTSMEVLNFASLSSDVNFDALERLVSQCKSLKILKVNKSITLEQLQ  237

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++RAPQLT+LGTGSF   E  A    +   AF  CK L  LSG  E    YLP +YP 
Sbjct  238  RLLVRAPQLTELGTGSF-LQELTAHQNEELERAFIGCKYLHALSGLWEATTLYLPVLYPA  296

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            CTNLT LN SYA++ +E+L  ++ HC +LQ LWVLD+V D GL+AVA++C
Sbjct  297  CTNLTFLNLSYAALQSEELAKLVAHCPRLQRLWVLDTVEDVGLEAVASSC  346



>ref|XP_009344196.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Pyrus x bretschneideri]
Length=572

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSFPNFK LVL  CE F T GLA +A  CR L+ LDL + D+
Sbjct  104  ELRLKRMIVSDESLELLSRSFPNFKSLVLVSCEGFTTDGLAAIAANCRLLKELDLQENDI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V    L 
Sbjct  164  DDHRGHWLSCFPESSTSLVSLNFACLKGEINLPALERLVGRSPNLKVLRLNRAVPPDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ +APQL DLGTGS+   + +++      +    CKS+  LSGF E+    LP+IYP+
Sbjct  224  KVLAQAPQLVDLGTGSY-ILDPDSDTYNKLQATVVKCKSIKSLSGFLEVGPRCLPSIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
              NLT+LN SYA  +   +L  +I  C KLQ LW+LDS+ D+GL  VA+TCK+
Sbjct  283  LENLTSLNLSYAPGVHGSELIELIRQCVKLQRLWILDSIGDKGLGVVASTCKE  335



>ref|XP_011082496.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
 ref|XP_011082497.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
 ref|XP_011082499.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
Length=581

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 159/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++ARSF NFK LVL+ CE F T GLA++A  CR LR LDL + +V
Sbjct  105  EIKLKRMVVTDESLELIARSFKNFKVLVLSSCEGFTTDGLASIAANCRNLRELDLRESEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP+  T L SL   C+  +V+F ALE+LV R P+L+ L+LNR V I +L 
Sbjct  165  EDLSGHWLSHFPDNCTSLVSLNMSCLGSEVSFSALERLVARCPNLRTLRLNRAVPIEKLP  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG++ A E  +++  +   AF+ CK L  LSGF +++  +LPA+Y V
Sbjct  225  NLLHRAPQLVELGTGAYSA-EIRSDIFSNLAEAFSVCKQLKGLSGFWDVVPAFLPAMYSV  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ +T+LN SYA+I +  L  ++  C  LQ LWVLD + D GL+A+AA+CKD
Sbjct  284  CSGITSLNLSYATIQSPDLVKLVSQCRNLQRLWVLDYIEDTGLEALAASCKD  335



>ref|XP_004493010.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Cicer arietinum]
Length=571

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 160/236 (68%), Gaps = 8/236 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L+RSF +FK LVL  CE F T GLA VA  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDDSLELLSRSFMDFKSLVLVSCEGFTTDGLAAVAANCRSLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D +  W+SCFPE+ T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V +  L 
Sbjct  164  EDHKGQWLSCFPESCTSLVSLNFACLKGEINLGALERLVARSPNLKSLRLNRSVPVDALQ  223

Query  361  RLMLRAPQLTDLGTGSFGA---SEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            ++++RAPQL DLG GSF     S+  A+L+    +    CKS+  LSGF E+    L AI
Sbjct  224  KILMRAPQLVDLGIGSFFHDLNSDTYAKLK----ATILKCKSITSLSGFLEVAPFSLAAI  279

Query  532  YPVCTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            YP+  NLT+LN SYA+ I + +L  +I HC KLQ LW++D + D+GL  VA++CKD
Sbjct  280  YPISQNLTSLNLSYAAGIQSSELIKLIRHCGKLQRLWIMDCIGDKGLGVVASSCKD  335



>ref|XP_011079740.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
Length=581

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 159/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++++SF NFK LVL+ CE F T GLA++A  CR LR LDL + +V
Sbjct  105  EIKLKRMVVTDESLELISKSFKNFKVLVLSSCEGFTTDGLASIAANCRNLRELDLRESEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP+  T L SL   C+  +V+F ALE+LV RSP+L+ L+LNR V + +L 
Sbjct  165  EDLSGHWLSHFPDNYTSLVSLNISCLGSEVSFSALERLVARSPNLRTLRLNRAVPLEKLP  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG++ A E  ++   +   AF+ACK L  LSGF +++  YLPA+  V
Sbjct  225  NLLRRAPQLVELGTGAYSA-EIRSDTYSNLAEAFSACKQLKGLSGFWDVVPSYLPAMLHV  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ +T+LN SYA+I +  L  ++  C  LQ LWVLD + D GL+A+AA+CKD
Sbjct  284  CSGITSLNLSYATIQSPDLVQLVTQCRNLQRLWVLDYIEDSGLEALAASCKD  335



>ref|XP_010458719.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Camelina sativa]
Length=578

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSFPNFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFPNFKSLVLVSCEGFTTDGLASIASNCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFP++ T L SL F C++ + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLNCFPDSCTTLTSLNFACLKGETNVAALERLVARSPNLKTLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E      +A   C SL  LSGF E     LPA YP+
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDPESFRKLMAAIQKCSSLRSLSGFLEAAPLCLPAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL +LN SYA+ I    L  +I  C +LQ LW+LDS+ D+GL  VAATCK+
Sbjct  283  CQNLISLNLSYAAEIRGNHLIKLIQLCKRLQRLWILDSIGDKGLVVVAATCKE  335



>ref|XP_008651820.1| PREDICTED: F-box protein FBX14-like [Zea mays]
 tpg|DAA43782.1| TPA: hypothetical protein ZEAMMB73_619648 [Zea mays]
Length=598

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 163/238 (68%), Gaps = 8/238 (3%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFP-NFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            LYLKRI V++ DL +L+RS P +F++L L  C+ F + GLA++A  CR LRVLD+++CD+
Sbjct  126  LYLKRIPVTDADLDLLSRSLPASFRDLTLHLCDGFTSRGLASIASHCRGLRVLDVVECDM  185

Query  181  KDDE--VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQ  354
             +++  VDW++ FP+  + LESL F+C E  V F ALE LV RSP L++L +N HVS+ Q
Sbjct  186  AEEQEVVDWVAAFPQEPSNLESLSFECYEPPVAFAALEALVERSPRLRRLGVNLHVSLGQ  245

Query  355  LYRLMLRAPQLTDLGTGSFGASE--EEAELELDYTSAFAA---CKSLVYLSGFREILADY  519
            L RLM  AP+L+ LGTGSF  ++  EE     +  SAF A    ++LV LSGFR++  +Y
Sbjct  246  LCRLMAHAPRLSHLGTGSFRPADGGEEGTGFGEVVSAFVAAGRARTLVSLSGFRDLAQEY  305

Query  520  LPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            LP I  VC +L +L+ SY++++  Q+   I  C+ L+ LWVLDSV DEGL AV  +CK
Sbjct  306  LPTIAVVCAHLKSLDLSYSAVTPNQILMFIGQCYNLETLWVLDSVRDEGLDAVGISCK  363



>ref|XP_009415862.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415863.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415864.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 152/232 (66%), Gaps = 2/232 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +LARSFP+FK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLARSFPDFKALVLISCEGFSTDGLAAIATHCRSLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ +VN  ALE+LV R PSL+ LKLNR VS+  L 
Sbjct  164  EDYGRQWLSCFPDSCTSLVSLNFSCLKGEVNAGALERLVARCPSLRGLKLNRAVSVESLT  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R++ RAP L +LGTGS    +   E      +AF  CKSL  LSGF ++    L ++YP+
Sbjct  224  RILDRAPHLVELGTGSL-TVDRHTEAYRRMINAFRKCKSLRNLSGFWDVDPLCLQSVYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            C NLT LN SYA SI       +I HC KLQ LWVLD + D+GL  VA+TCK
Sbjct  283  CPNLTVLNLSYAPSIQGADQVKLIRHCFKLQKLWVLDCIGDKGLAVVASTCK  334



>ref|XP_009378024.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Pyrus x bretschneideri]
Length=572

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSFPNFK LVL  CE F T GLA +A  CR L+ LDL + D+
Sbjct  104  ELRLKRMIVSDESLELLSRSFPNFKSLVLVSCEGFTTDGLAAIAANCRLLKELDLQENDI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V    L 
Sbjct  164  DDHRGHWLSCFPESSTSLVSLNFACLKGEINLPALERLVGRSPNLKVLRLNRAVPPDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAPQL DLGTGS+   + +++      +    CKS+  LSGF E+    LP+IYP+
Sbjct  224  KVLARAPQLVDLGTGSY-VLDPDSDTYNKLQATVVKCKSIKSLSGFLEVGPRCLPSIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
              NLT+LN SYA  +   +L  +I  C KLQ LW+LD + D+GL  VA+TCK+
Sbjct  283  LENLTSLNLSYAPGVHGSELIELIRQCVKLQRLWILDCIGDKGLGVVASTCKE  335



>ref|XP_010476261.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3 [Camelina sativa]
Length=578

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSFPNFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLDLLSRSFPNFKSLVLVSCEGFTTDGLASIASNCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFP++ T L SL F C++ + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLNCFPDSCTTLTSLNFACLKGETNVAALERLVARSPNLKTLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E      +A   C SL  LSGF E     LPA YPV
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDPESFRKLMAAIQKCSSLRSLSGFLEAAPLCLPAFYPV  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL +LN SYA+ I    L  +I  C +LQ LW+LDS+ D+GL  VAATCK+
Sbjct  283  CQNLISLNLSYAAEIRGNHLIKLIQLCKRLQRLWILDSIGDKGLVVVAATCKE  335



>gb|KJB40643.1| hypothetical protein B456_007G072400 [Gossypium raimondii]
Length=572

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L++SF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLSKSFVNFKSLVLVSCEGFTTDGLAAIAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C+  +VN  ALE+LV RSP+LK L+LNR V +  L 
Sbjct  164  DDHRGHWLSCFPESCTSLISLNFACLRGEVNLGALERLVSRSPNLKSLRLNRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GS+   +  +E+      A   CKS+  LSGF E+    + AIYP+
Sbjct  224  KLLMRAPQLVDLGIGSY-VHDPFSEVYNKLKIAIQRCKSIRSLSGFLEVAPHCMSAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA  +   +L  +I HC KLQ LW+LD + D+GL  VA TCK+
Sbjct  283  CGNLTFLNLSYAPGLHGNKLMKLIQHCRKLQRLWILDCIGDKGLGVVALTCKE  335



>ref|XP_010425404.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Camelina sativa]
Length=575

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP+T T L +L F C+E + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQ+ DLG GS+  ++ ++E  L   +A   C  L  LSGF E     L A +P+
Sbjct  224  RLMSCAPQMVDLGVGSY-ENDPDSESYLKLQAAIKKCTLLRSLSGFLEAAPHCLSAFHPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_002892715.1| auxin signaling F-box 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68974.1| auxin signaling F-box 3 [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR+LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFANFKSLVLVSCEGFTTDGLASIAANCRQLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFP++ T L SL F C++ + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLNCFPDSCTTLISLNFACLKGETNVAALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E  +   +A   C SL  LSGF E+    LPA YP+
Sbjct  224  RLMTCAPQLVDLGVGSY-ENEPDPESFVKLMTAIEKCISLRSLSGFLEVAPLCLPAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL +LN SYA+ I    L  +I  C +LQ LW+LDS+ D+GL  VAATCK+
Sbjct  283  CQNLISLNLSYAAEIQGNHLIKLIQLCKRLQRLWILDSIGDKGLAVVAATCKE  335



>ref|XP_009587773.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Nicotiana 
tomentosiformis]
Length=585

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+E L +++ SF +FK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  107  EIRLKRMVVSDESLELISTSFEHFKVLVLLSCEGFTTDGLAAIAANCRNLRELDLGESEV  166

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   DW+S FP++ T L SL   C+  +V+F  LE+L+ RSP+L+ L+LN  V + +L 
Sbjct  167  EDLSSDWLSYFPDSCTSLVSLNISCLGSEVSFSDLERLIARSPNLRTLRLNHSVPLEKLP  226

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+L A QL + GTG+F +SE ++++  +   AF+ CK L  LSGF +++  YLPAIYPV
Sbjct  227  NLLLGASQLAEFGTGAF-SSEVQSDIFSNLEEAFSGCKRLKGLSGFWDVVPAYLPAIYPV  285

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I    L  +I  CH LQ LWVLD + D GL+ +AA+CKD
Sbjct  286  CSGLTSLNLSYATIQNPDLSKLISQCHNLQRLWVLDYIEDTGLQMLAASCKD  337



>gb|KJB23185.1| hypothetical protein B456_004G085900 [Gossypium raimondii]
Length=415

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 156/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++A+SF NFK LVL+ CE F T GLA +A  C+ L+ LDL DC+V
Sbjct  109  EIRLKRMVVTDESLELIAKSFKNFKVLVLSSCEGFSTDGLAVIAASCKNLKELDLRDCEV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECD-VNFQALEQLVMRSPSLKKLKLNRHVSIVQL  357
             D    W+S FPET T L SL   C+  D V+F ALE+LV R  +LK L+LNR V + ++
Sbjct  169  DDLSAHWLSHFPETYTSLVSLNISCLGSDEVSFSALERLVGRCTNLKTLRLNRAVPLDKI  228

Query  358  YRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
              ++  APQL + GTG++ A +   ++  D    F++CK L  LSGF +++ DYLPAIYP
Sbjct  229  ANILRHAPQLVEFGTGTYTA-DVRPDVYSDLAGVFSSCKELKSLSGFWDVVPDYLPAIYP  287

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC+ LT+LN SYA+I +  L  ++ HC  LQ L VLD + D GL+ +A++CKD
Sbjct  288  VCSKLTSLNLSYATIQSPDLIKLVSHCPNLQRLLVLDYIEDSGLEVLASSCKD  340



>gb|KDP28084.1| hypothetical protein JCGZ_13855 [Jatropha curcas]
Length=581

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++A+SF NFK LVL+ CE F T GLA +A  CR LR LDL + +V
Sbjct  105  EIRLKRMVVTDETLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAANCRNLRELDLRESEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP++ T L SL   C+  +V+F ALE+LV R P+L+ L+LNR V + +L 
Sbjct  165  DDPSGHWLSHFPDSFTSLVSLNISCLVSEVSFSALERLVGRCPNLRTLRLNRTVPLDRLA  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             ++ RAPQL +LGTG++ +SE   ++    + AF+ CK L  LSGF +++  YLPAIYP+
Sbjct  225  NILSRAPQLVELGTGTY-SSELRPDVFSSLSGAFSGCKELKSLSGFWDVVPGYLPAIYPI  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I +  +  ++  C  LQ LWVLD + D GL+A+A  CKD
Sbjct  284  CSGLTSLNLSYATIQSPDVIKLVSQCQSLQRLWVLDYIEDIGLEALATFCKD  335



>ref|XP_002520681.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
 gb|EEF41643.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
Length=585

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 156/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+E L ++++SF NFK LVL+ CE F T GLA +A  CR LR LDL + +V
Sbjct  109  EIRLKRMVVSDEALELISKSFKNFKVLVLSSCEGFSTGGLAAIAANCRNLRELDLRESEV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP++ T L SL   C+  +V+F AL++LV R P+L+ L+LNR V + +L 
Sbjct  169  DDPSGHWLSHFPDSFTSLVSLNISCLGSEVSFSALKRLVGRCPNLRTLRLNRAVPLDRLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             ++ RAPQL +LGTG++ A E   ++    + AF+ CK L  LSGF +++  YLPAIYP+
Sbjct  229  NILRRAPQLVELGTGAYSA-ELRPDVFSTLSGAFSGCKELKSLSGFWDVVPGYLPAIYPI  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I +  L  ++  C  LQ LWVLD + D GL+A+A  CKD
Sbjct  288  CSGLTSLNLSYATIQSPDLVKLVSQCQSLQRLWVLDYIEDVGLEALATFCKD  339



>emb|CDX71968.1| BnaC08g29060D [Brassica napus]
Length=578

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 153/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF +FK LVL  CE F T GLA+VA  CR LR LDL + ++
Sbjct  104  ELRLKRMVVSDESLELLSRSFASFKSLVLVSCEGFTTDGLASVAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W++CFPE+ T L SL F C++ + N  ALE+LV RSP+L+ LK+NR V +  L 
Sbjct  164  EDHRGQWLNCFPESSTALTSLNFSCLKGETNLAALERLVARSPNLESLKVNRAVPLDALT  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E  +   +A   C  L  LSGF E+    L A YP+
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDQESFMKLMAAIKKCTELRSLSGFSEVAPLCLSAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L   I  C +LQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CQNLTSLNLSYAAEIQGNHLIRFIQFCKRLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_010241246.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nelumbo 
nucifera]
Length=581

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 152/232 (66%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +++RSF NF  LVL+ CE F T GLA +A  CR LRVL+L +C+V
Sbjct  105  ELRLKRMVVTDEALELISRSFKNFSVLVLSSCEGFTTDGLAAIAANCRNLRVLELWECEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   +W+S FPE+ T L SL F C++ +V+F ALE+LV R  +L+ L+LN  V + +L 
Sbjct  165  DDRSGNWLSHFPESCTSLVSLSFPCLDGEVSFSALERLVSRCTNLRTLRLNNSVPLDKLP  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL DLGTG++ A E   EL      AFA CK L  LSGF E +  YLPA Y +
Sbjct  225  NLLRRAPQLVDLGTGAYTA-ELRPELYSKLGDAFAGCKGLKSLSGFWEAVPSYLPATYSI  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  + +LN SYA+I +  L  +I  C  LQ LWVLD + D GL A+A TCKD
Sbjct  284  CAGIRSLNLSYATIQSPDLVKLIRQCPNLQRLWVLDYIEDCGLNALATTCKD  335



>ref|XP_003518127.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Glycine max]
 gb|KHN00616.1| Protein AUXIN SIGNALING F-BOX 3 [Glycine soja]
Length=573

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++ L +L+RSF NFK LVL  CE F T GLA +A  CR L+ LDL + +V
Sbjct  104  ELRLKRMVVTDKSLELLSRSFMNFKSLVLVSCEGFTTDGLAAIAANCRFLKELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFP+  T L SL F C++  +N  ALE+LV RSP+LK L+LN  V +  L 
Sbjct  164  DDHRGQWLSCFPDCCTSLVSLNFACLKGQINLGALERLVARSPNLKSLRLNHTVPLNALQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R++ RAPQ+ DLG GSF   +  + + +   +    CKS+  LSGF E+    LPAIYPV
Sbjct  224  RILRRAPQIVDLGIGSF-IPDPNSNVFIKLMNTIIECKSITSLSGFFEVTPRCLPAIYPV  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT +N SYA+ I + +L  +IC C KLQ LW++D + D GL  VA+TCKD
Sbjct  283  CMNLTAMNLSYAAGIQSRELIKLICRCGKLQRLWIMDCIGDFGLHVVASTCKD  335



>gb|KJB11712.1| hypothetical protein B456_001G273700 [Gossypium raimondii]
Length=572

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L+RSFPNFK LVL  CE F T G+A +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDDSLELLSRSFPNFKSLVLVSCEGFTTDGVAAIAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFPE+ T L SL F C++ ++N  +LE+LV RSP+LK L+LNR V +  L 
Sbjct  164  EDHRGHWLSCFPESCTSLVSLNFACLKGEINLASLERLVARSPNLKSLRLNRVVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GS+   +  +E+     +    C S+  LSGF E+    + AIYP+
Sbjct  224  KLLMRAPQLVDLGIGSY-VDDPSSEVFSKLKAVIQLCNSIRSLSGFLEVAPCCMSAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA  +    L  ++ HC KLQ LW+LD + D+GL  VA+TCK+
Sbjct  283  CENLTFLNLSYAPGLQGNDLTKLVQHCRKLQRLWILDCIGDKGLGVVASTCKE  335



>gb|KDP20879.1| hypothetical protein JCGZ_21350 [Jatropha curcas]
Length=603

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 155/230 (67%), Gaps = 1/230 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ +++E L  LA +FPNFK L L  C+ F T GLA +A  C+ L  LD+ +  +
Sbjct  124  ELRLKRMSITDESLEFLAFNFPNFKALSLLSCDGFSTDGLAAIATHCKNLTELDIQENGI  183

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE  + LE L F  +  +VNF ALE+LV R  SLK LK+N+++S+ QL 
Sbjct  184  DDKSGSWLSCFPENFSSLEILNFANLNSEVNFDALERLVTRCKSLKVLKVNKNISLDQLQ  243

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++ APQLT+LGTGSF + E   +   D  +AF+ CK+L  LSG  E +A YLP +YP 
Sbjct  244  RLLVGAPQLTELGTGSF-SQELSTQQYTDLENAFSHCKNLDTLSGLWEAMALYLPVLYPA  302

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            CTNLT LN SYA++ + +L  ++ HC +L+ LWVLD+V D+GL+AV + C
Sbjct  303  CTNLTFLNLSYAALQSLELDNLLRHCPQLRRLWVLDTVEDKGLEAVGSHC  352



>gb|KHG11169.1| auxin signaling f-box 2 -like protein [Gossypium arboreum]
Length=572

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 151/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L++SF NFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLSKSFVNFKSLVLVSCEGFTTDGLAAIAANCRFLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C+  +VN  ALE+LV RSP+LK L+LNR V +  L 
Sbjct  164  DDHRGHWLSCFPESCTSLISLNFACLRGEVNLGALERLVSRSPNLKSLRLNRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GS+   +  +E       A   CKS+  LSGF E+    + AIYP+
Sbjct  224  KLLMRAPQLVDLGIGSY-VHDPFSEAYNKLKIAIQRCKSIRSLSGFLEVAPHCMSAIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA  +   +L  +I HC KLQ LW+LD + D+GL  VA TCK+
Sbjct  283  CGNLTFLNLSYAPGLHGNKLMKLIQHCRKLQRLWILDCIGDKGLGVVALTCKE  335



>gb|KJB69424.1| hypothetical protein B456_011G023100 [Gossypium raimondii]
Length=586

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 154/233 (66%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ +S+E L  LA SFPNFK L L  C+ F T+GLA +A  C+ L  LD+ +  +
Sbjct  124  ELRLKRMAISDESLEFLAVSFPNFKALSLLSCDGFSTNGLAAIATHCKNLTELDIQENGI  183

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T LE L F  +  D+NF ALE+LV R  S++ LKLNR VS+ QL 
Sbjct  184  DDKGGSWLSCFPESFTSLEVLNFANLSSDINFDALERLVGRCKSMRVLKLNRSVSLEQLQ  243

Query  361  RLMLRAPQLTDLGTGSFGAS---EEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RL++ APQL +LGTGSF       +  ELE    SA + CK++  LSG  +    YLPA+
Sbjct  244  RLLVNAPQLAELGTGSFSEELTFRQYVELE----SALSNCKNMHTLSGLWDAKGIYLPAL  299

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            YPVCT+LT LN SYA++ +++L  ++ HC +L+ LWVLD+V D+GL+AV   C
Sbjct  300  YPVCTHLTFLNLSYAALRSDELAKLLAHCPRLKRLWVLDTVEDKGLEAVGLNC  352



>ref|XP_010430752.1| PREDICTED: GRR1-like protein 1 [Camelina sativa]
Length=585

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V+++ L  +A SF NFK LVL  CE F T G+A +A  CR LRVL+L +C V
Sbjct  105  EIRLKRMVVTDDCLERIAASFKNFKVLVLTSCEGFSTDGIAAIASTCRNLRVLELRECIV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   DW+S FPET T L SL F C++ +V    LE+LV RSP+LK LKLN  V++  L 
Sbjct  165  EDLGGDWLSYFPETSTSLVSLDFSCLDSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLV  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             ++ RAPQLT+LGTGSF A+E + E     + AF+ CK L  LSG  ++L +YLPA+Y V
Sbjct  225  SILRRAPQLTELGTGSF-AAELKPEAFTKLSKAFSNCKQLQSLSGLWDVLPEYLPALYSV  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  LT+LN SYA++    L  ++  C KLQ LWV+D + D+GL+AVA+ CK+
Sbjct  284  CPGLTSLNLSYATVRMPDLVELLRRCSKLQKLWVMDLIEDKGLEAVASYCKE  335



>ref|XP_009118055.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Brassica rapa]
Length=578

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF +FK LVL  CE F T GLA+VA  CR LR LDL + ++
Sbjct  104  ELRLKRMVVSDESLELLSRSFSSFKSLVLVSCEGFTTDGLASVAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFPE+ T L SL F C++ + N  ALE+LV RSP+L+ LK+NR V +  L 
Sbjct  164  DDHRGQWLNCFPESSTALTSLNFSCLKGETNLAALERLVARSPNLESLKVNRAVPLDALT  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E  +   +A   C  L  LSGF E+    L A YP+
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDQESFMKLMAAIKKCTELRSLSGFSEVAPLCLTAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L   I  C +LQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CQNLTSLNLSYAAEIQGNHLIRFIQFCKRLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_010929637.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
Length=575

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 153/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +LARSFPNFK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLARSFPNFKVLVLISCEGFSTDGLAAIATYCRVLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ +VN  +LE+LV R P+L+ L+L+R VSI  L 
Sbjct  164  EDRGPQWLSCFPDSCTSLVSLNFACLKGEVNAGSLERLVARCPNLRTLRLSRAVSIDTLS  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAP L DLGTGSF   +  AE      + F  CKSL  LSGF +     LPA+YP+
Sbjct  224  KILARAPHLVDLGTGSF-TIDHRAEAYHKVMNNFIKCKSLRSLSGFWDAAPRCLPAVYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA +I    L  +I  C KLQ LW+LD + D+GL  VA TCK+
Sbjct  283  CGNLTGLNLSYAPAIQCADLIKLIHRCSKLQRLWILDCIGDKGLAVVANTCKE  335



>gb|KDP41834.1| hypothetical protein JCGZ_26852 [Jatropha curcas]
Length=571

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L+RSF NFK LVL  CE F T GLA VA  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDDSLDLLSRSFVNFKSLVLVSCEGFTTDGLAAVAANCRNLRELDLQEDEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ D+N   LE+LV RSP+L+ L+LNR V +  L 
Sbjct  164  EDHRGHWLSCFPDSCTSLVSLNFACLKGDINLGVLERLVARSPNLRSLRLNRAVPLDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++++PQL DLG GS+   + ++E      +A   CKS+  LSGF E+    LPA + +
Sbjct  224  KILMQSPQLVDLGVGSY-VHDPDSETYNKLVTAIQKCKSVRSLSGFLEVAPHCLPAFHLI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  LT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL+ VA+TCKD
Sbjct  283  CPTLTSLNLSYAPGIQGSELTKLIRHCRKLQRLWILDCIGDKGLEVVASTCKD  335



>emb|CDY26594.1| BnaA09g46830D [Brassica napus]
Length=578

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF +FK LVL  CE F T GLA+VA  CR LR LDL + ++
Sbjct  104  ELRLKRMVVSDESLELLSRSFSSFKSLVLVSCEGFTTDGLASVAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFPE+ T L SL F C++ + N  ALE+LV RSP+L+ LK+NR V +  L 
Sbjct  164  DDHRGQWLNCFPESSTALTSLNFSCLKGETNLAALERLVARSPNLESLKVNRAVPLDALT  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E  +   +A   C  L  LSGF E+    L A YP+
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDQESFMKLMAAIKKCTELRSLSGFSEVAPLCLTAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L   I  C +LQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CQNLTSLNLSYAAEIQGNHLIRFIQFCKRLQRLWILDSIGDKGLEVVASTCKE  335



>emb|CDY16034.1| BnaC08g40890D [Brassica napus]
Length=579

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF +FK LVL  CE F T GLA+VA  CR LR LDL + ++
Sbjct  104  ELRLKRMVVSDESLELLSRSFASFKSLVLVSCEGFTTDGLASVAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFPE+ T L SL F C++ + N  ALE+LV RSP+L+ LK+NR V +  L 
Sbjct  164  DDHRGQWLNCFPESSTALTSLNFSCLKGETNLAALERLVARSPNLESLKVNRAVPLDALT  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E  +   +A   C  L  LSGF E+    L A YP+
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDQESFMKLMAAIKKCTELRSLSGFSEVAPLCLTAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L   I  C +LQ LW+LDS+ D+GL+ VA+TCK+
Sbjct  283  CQNLTSLNLSYAAEIQGNHLIRFIQFCKRLQRLWILDSIGDKGLEVVASTCKE  335



>ref|XP_010455977.1| PREDICTED: GRR1-like protein 1 [Camelina sativa]
Length=585

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L  +A SF +FK LVL  CE F T G+A +A  CR LRVL+L +C V
Sbjct  105  EIRLKRMVVTDECLERIAASFKDFKVLVLTSCEGFSTDGIAAIASTCRNLRVLELRECIV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   DW+S FPET T L SL F C++ +V    LE+LV RSP+LK LKLN  V++  L 
Sbjct  165  EDLGGDWLSYFPETSTSLVSLDFSCLDSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLV  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             ++ RAPQLT+LGTGSF A+E + E     + AF+ CK L  LSG  ++L +YLPA+Y V
Sbjct  225  SILRRAPQLTELGTGSF-AAELKPEAFTKLSKAFSNCKQLQSLSGLWDVLPEYLPALYSV  283

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C  LT+LN SYA++    L  ++  C KLQ LWV+D + D+GL+AVA+ CK+
Sbjct  284  CPGLTSLNLSYATVRMPDLVELLRRCSKLQKLWVMDLIEDKGLEAVASYCKE  335



>ref|XP_010096050.1| Protein AUXIN SIGNALING F-BOX 2 [Morus notabilis]
 gb|EXB62856.1| Protein AUXIN SIGNALING F-BOX 2 [Morus notabilis]
Length=573

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 157/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA +A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVSDESLELLSRSFANFKSLVLVSCEGFTTDGLAAIAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D+   W+SCF +  T L SL F C++ ++N  ALE+LV RSP L+ L++NR V +  L 
Sbjct  164  EDNRGQWLSCFADNCTSLVSLNFACLKGEINLAALERLVARSPDLRVLRVNRAVPLDALQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++++APQL DLGTGS+  ++  ++      S    C+S+  LSGF E++   LPA YPV
Sbjct  224  KILMKAPQLVDLGTGSY-VTDSRSDAYNKLKSTLLKCQSIRSLSGFLEVVPWCLPAFYPV  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL  VA+TCK+
Sbjct  283  CSNLTSLNLSYAPGIYGFELIKLIRHCVKLQRLWILDCIGDKGLSVVASTCKE  335



>ref|XP_008791063.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
Length=575

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V +E L +LARSFPNFK LVL  CE F T GLA +A  CR LR LDL + ++
Sbjct  104  ELRLKRMIVFDESLELLARSFPNFKVLVLISCEGFSTDGLAAIATYCRVLRELDLQENEM  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ +VN  +LE+LV R P+L+ L+LNR VS+  L 
Sbjct  164  EDRGPQWLSCFPDSCTSLVSLNFACLKGEVNAVSLERLVARCPNLRTLRLNRAVSVDTLS  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAP L DLGTGSF   +  AE      + F  CKSL  LSGF +     LPA+YP+
Sbjct  224  KILARAPHLVDLGTGSF-TIDHRAEAYHKLINNFIKCKSLRSLSGFWDATPRCLPAVYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA +I    L  +I  C KLQ LWVLD + D+GL  VA TCK+
Sbjct  283  CGNLTGLNLSYAPAIQGADLIKLIRQCSKLQRLWVLDCIGDKGLAVVANTCKE  335



>ref|XP_008341250.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Malus domestica]
Length=572

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSFPNFK LVL  CE F T GLA +A  CR L+ LDL + D+
Sbjct  104  ELRLKRMIVSDESLELLSRSFPNFKSLVLVSCEGFTTDGLAAIAANCRLLKELDLQENDI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C++ ++N  ALE+LV RSP+LK L+LNR V    L 
Sbjct  164  DDHRGHWLSCFPESSTSLVSLNFACLKGEINLPALERLVGRSPNLKVLRLNRAVPPDTLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ +APQL DLGTGS+   + +++      +    CKS+  LSGF E+    LP+IYP+
Sbjct  224  KVLAQAPQLVDLGTGSY-XLDPDSDTYNXLKATVVKCKSIKSLSGFLEVGPRCLPSIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
              NLT+LN SYA  +   +L  +I  C KLQ LW+LD + D+GL  VA+TCK+
Sbjct  283  LENLTSLNLSYAPGVHGSELIELIRQCVKLQRLWILDCIGDKGLGVVASTCKE  335



>ref|XP_004985419.1| PREDICTED: transport inhibitor response 1-like protein-like [Setaria 
italica]
Length=597

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 158/238 (66%), Gaps = 8/238 (3%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFP-NFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            LYLKRI V++ DL +L+RS P +F++L L  C+ F + GLA++A  CR LRVLD+++CD+
Sbjct  126  LYLKRIPVTDADLDLLSRSLPASFRDLSLHLCDGFSSRGLASIASHCRALRVLDVVECDM  185

Query  181  KDDE--VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQ  354
             +++  VDW++ F    T LESL F+C E  V+F ALE LV RSP L +L +N+H+S+ Q
Sbjct  186  AEEQEVVDWVAAFRPEPTNLESLSFECYEQPVSFAALEALVARSPRLTRLGVNQHISLGQ  245

Query  355  LYRLMLRAPQLTDLGTGSFGASEEEAELELDYT--SAF---AACKSLVYLSGFREILADY  519
            L RLM  AP+L+ LGTGSF  ++   E        +AF      ++LV LSGFRE+  +Y
Sbjct  246  LRRLMAHAPRLSHLGTGSFRPADGGEEGVGFGEVLAAFDSAGRARTLVSLSGFRELAQEY  305

Query  520  LPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            LP I  VC+NL +L+ SY  ++  Q+   I  C+ L+ LWVLDSV DEGL  VA +CK
Sbjct  306  LPTITVVCSNLKSLDLSYTPVTPNQILMFIGQCYNLETLWVLDSVRDEGLGNVAISCK  363



>ref|XP_002321035.1| TRANSPORT INHIBITOR RESPONSE 1 family protein [Populus trichocarpa]
 gb|EEE99350.1| TRANSPORT INHIBITOR RESPONSE 1 family protein [Populus trichocarpa]
Length=584

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 151/232 (65%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+E L ++A+SF NFK LVL+ CE F T GLA VA  CR LR LDL + +V
Sbjct  108  EIRLKRMVVSDESLKVIAKSFKNFKVLVLSSCEGFSTDGLAAVAANCRNLRGLDLRESEV  167

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP++ T L SL   C+  +V+F ALE+LV R P LK L+LN  V + +L 
Sbjct  168  DDPSGQWLSRFPDSFTSLASLNISCLGAEVSFSALERLVGRCPDLKTLRLNHAVPLDKLA  227

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+  APQL +LGTG++ A E + ++  +   AF+ CK L  LSGF  +   YLPA+YPV
Sbjct  228  NLLRGAPQLVELGTGAYSA-ELQPDVFSNLAGAFSGCKELRSLSGFWNVFPGYLPAVYPV  286

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN  YA+I    L  ++  C  LQ LWVLD + D GL+A+AA CKD
Sbjct  287  CSGLTSLNLRYANIQGADLIKLVSQCPSLQRLWVLDYIEDIGLEALAACCKD  338



>ref|XP_009784635.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009784636.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X2 [Nicotiana sylvestris]
Length=585

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+E L +++ SF +FK LVL  CE F T GLA +A  CRKLR LDL + +V
Sbjct  107  EIRLKRMVVSDESLELISTSFEHFKVLVLLSCEGFTTDGLAAIAANCRKLRELDLGESEV  166

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   DW+S F ++ T L SL   C+  +V+F  LE+L+ RSP+L+ L+LN  V + +L 
Sbjct  167  EDLSSDWLSYFSDSCTSLVSLNISCLGSEVSFSDLERLIARSPNLRTLRLNHSVPLEKLP  226

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+L A QL + GTG+F +SE ++++  +   AF+ CK L  LSGF +++  YLPAIYPV
Sbjct  227  NLLLGASQLVEFGTGAF-SSEVQSDIFSNLEEAFSGCKRLKGLSGFWDVVPAYLPAIYPV  285

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I    L  +I  CH LQ LWVLD + D GL+ +AA+CKD
Sbjct  286  CSGLTSLNLSYATIQNPDLSKLISQCHNLQRLWVLDYIEDTGLQMLAASCKD  337



>gb|ACJ85606.1| unknown [Medicago truncatula]
Length=292

 Score =   204 bits (520),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 145/225 (64%), Gaps = 7/225 (3%)
 Frame = +1

Query  25   VSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVKDDEVDWI  204
            VS+E L  LA SFPNFK L L  C+ F T GLA VA  C+ L  LD+ +  V D   +W+
Sbjct  3    VSDESLEFLAFSFPNFKALSLLSCDGFSTDGLAAVATNCKNLTELDIQENGVDDKSGNWL  62

Query  205  SCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYRLMLRAPQ  384
            SCFPE+ T LE L F  +  DVNF ALE+LV R  SLK LK+N+ V++ QL RL++RAPQ
Sbjct  63   SCFPESFTSLEILNFANLSNDVNFDALEKLVARCNSLKTLKVNKSVTLEQLQRLLVRAPQ  122

Query  385  LTDLGTGSFG---ASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVCTNLT  555
            L +LGTGSF      ++ +ELE     AF  C+SL  LSG     A Y   +YPVCTNLT
Sbjct  123  LCELGTGSFSQELTGQQYSELE----RAFNNCRSLHTLSGLWVASAQYHQVLYPVCTNLT  178

Query  556  TLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
             LNFSYA + +E L  ++  C  L+ LWVLD+V D+GL+AV + C
Sbjct  179  FLNFSYAPLDSEGLSKLLVRCPNLRRLWVLDTVEDKGLEAVGSYC  223



>ref|XP_010909072.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
 ref|XP_010909073.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
 ref|XP_010909074.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
 ref|XP_010909075.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
Length=575

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +LARSFP+FK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  104  ELRLKRMVVSDESLELLARSFPSFKVLVLISCEGFSTDGLAAIATHCRVLRELDLQENEV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP++ T L SL F C++ +VN  ALE+LV R P+++ L+LNR VS+  L 
Sbjct  164  EDCGPRWLSCFPDSCTSLVSLNFACLKGEVNAAALERLVARCPNIRTLRLNRAVSVDSLS  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +++ RAP L DLGTGSF   +  AE      + F  CKSL  LSGF +     LPA+YP+
Sbjct  224  KILARAPHLVDLGTGSF-TIDHHAEAYHRLINNFTKCKSLKSLSGFWDASPRCLPAVYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA +I    L  +I  C KLQ LWVLD + D+GL  VA+TCK+
Sbjct  283  CGNLTGLNLSYAPAIQGADLIKLIRLCLKLQRLWVLDCIGDKGLAVVASTCKE  335



>ref|XP_009604230.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Nicotiana tomentosiformis]
Length=579

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 156/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSFPNFK L+L  CE F T GLA +A  CR LR LDL + +V
Sbjct  111  ELRLKRMVVSDESLELLSRSFPNFKSLILVSCEGFSTDGLAAIASNCRFLRELDLQENEV  170

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCF E+ T L SL F C++ +VN  ALE+LV R P+L+ L+LN  V +  L 
Sbjct  171  EDRRGQWLSCFSESCTTLVSLNFACLKGEVNLAALERLVARCPNLRSLRLNHTVPLDALQ  230

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R++++AP L DLGTG+F  S+  +E      +A   C S+  LSGF E+    LPAIYP+
Sbjct  231  RILVKAPHLVDLGTGTF-VSDPVSETYNKLKNALQRCTSIRSLSGFLEVAPRCLPAIYPI  289

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL++LN SYA  I + +L  +I  C KL+ LW+LD++ D+GL  VA+TCK+
Sbjct  290  CLNLSSLNLSYAPGIYSAELIKLIRFCGKLERLWILDTIGDKGLGVVASTCKE  342



>ref|NP_001267557.1| protein AUXIN SIGNALING F-BOX 2-like [Cucumis sativus]
 ref|XP_004159143.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Cucumis sativus]
 gb|AGA63734.1| transport inhibitor response 1 [Cucumis sativus]
 gb|AGI15226.1| auxin siganling F box protein [Cucumis sativus]
 gb|KGN58236.1| hypothetical protein Csa_3G597350 [Cucumis sativus]
Length=587

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 157/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++ L +L+RSFPNFK L+L  CE F T+GLA +A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDDSLELLSRSFPNFKSLLLFSCEGFTTNGLAAIAANCRFLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C+  +VN  ALE+LV RSP+LK L+LNR V I  L 
Sbjct  164  DDHSNYWLSCFPESCTSLVSLNFACLRGEVNLGALERLVARSPNLKSLRLNRAVPIETLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             ++  APQL DLGTGS+   + ++E+  +  +    CKS+  LSGF ++    L +IYP+
Sbjct  224  NILAHAPQLVDLGTGSYD-HDRDSEIYENIKNTLLKCKSIRSLSGFLDVSPCCLASIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  +   +L  VI +C +LQ LW+LD + D+GL+ VA+TC +
Sbjct  283  CSNLTSLNLSYAPGLHGNELIKVIQYCERLQRLWILDGIGDKGLEVVASTCNE  335



>gb|KHG11704.1| auxin signaling f-box 2 -like protein [Gossypium arboreum]
Length=579

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS++ L +L++SFPNFK LVL  CE F T G+A +A  CR LR LDL + +V
Sbjct  106  ELRLKRMVVSDDSLELLSKSFPNFKSLVLVSCEGFTTDGVAAIAANCRFLRELDLQENEV  165

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFPE+ T L SL F C++ ++N  +LE+LV RSP+LK L+LNR V +  L 
Sbjct  166  EDHRGHWLSCFPESCTSLVSLNFACLKGEINLASLERLVARSPNLKSLRLNRVVPLDTLQ  225

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            +L++RAPQL DLG GS+   +  +E+     +    C S+  LSGF E+    + AIYP+
Sbjct  226  KLLMRAPQLVDLGIGSY-VDDPSSEVFSKLKAVIQLCNSIRSLSGFLEVAPCCMSAIYPI  284

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT LN SYA  +    L  ++ HC KLQ LW+LD + D+GL  VA+TCK+
Sbjct  285  CENLTFLNLSYAPGLQGNDLTKLVQHCRKLQRLWILDCIGDKGLGVVASTCKE  337



>gb|AES90448.2| transport inhibitor response 1 protein [Medicago truncatula]
Length=588

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 151/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L  LA SFPNFK L L  C+ F T GLA VA  C+ L  LD+ +  V
Sbjct  126  ELRLKRMAVSDESLEFLAFSFPNFKALSLLSCDGFSTDGLAAVATNCKNLTELDIQENGV  185

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   +W+SCFPE+ T LE L F  +  DVNF ALE+LV R  SLK LK+N+ V++ QL 
Sbjct  186  DDKSGNWLSCFPESFTSLEILNFANLSNDVNFDALEKLVARCNSLKTLKVNKSVTLEQLQ  245

Query  361  RLMLRAPQLTDLGTGSFG---ASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RL++RAPQL +LGTGSF      ++ +ELE     AF  C+SL  LSG     A Y   +
Sbjct  246  RLLVRAPQLCELGTGSFSQELTGQQYSELE----RAFNNCRSLHTLSGLWVASAQYHQVL  301

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            YPVCTNLT LNFSYA + +E L  ++  C  L+ LWVLD+V D+GL+AV + C
Sbjct  302  YPVCTNLTFLNFSYAPLDSEGLSKLLVRCPNLRRLWVLDTVEDKGLEAVGSYC  354



>ref|XP_009771789.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Nicotiana sylvestris]
Length=579

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 155/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSFPNFK L+L  CE F T GLA +A  CR LR LDL + +V
Sbjct  111  ELRLKRMVVSDESLELLSRSFPNFKSLILVSCEGFSTDGLAAIASNCRFLRELDLQENEV  170

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCF +  T L SL F C++ +VN  ALE+LV R P+L+ L+LN  V +  L 
Sbjct  171  EDRRGQWLSCFSDNCTTLVSLNFACLKGEVNLAALERLVARCPNLRSLRLNHTVPLDALQ  230

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R++++AP L DLGTGSF  S+  +E      +A   C S+  LSGF EI    LPAIYP+
Sbjct  231  RILIKAPHLVDLGTGSF-ISDPVSETYNKLKNALKRCTSIRSLSGFLEIAPRCLPAIYPI  289

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL++LN SYA  I + +L  +I  C KL+ LW+LD++ D+GL  VA+TCK+
Sbjct  290  CLNLSSLNLSYAPGIYSAELIKLIRFCGKLERLWILDTIGDKGLGVVASTCKE  342



>emb|CDY11468.1| BnaA09g40340D [Brassica napus]
Length=595

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+E L ++A+SF NFK LVL+ C+ F T GLA +A  CR L+ LDL + DV
Sbjct  109  EIRLKRMVVSDECLELIAKSFKNFKVLVLSSCDGFSTDGLAAIASSCRNLKELDLRESDV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP+T T L SL   C+  +V+F ALE+LV RSP+LK LKLNR V + +L 
Sbjct  169  DDVSGHWLSHFPDTYTSLVSLNISCLVSEVSFSALERLVCRSPNLKSLKLNRAVPLEKLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL + GTG + A E   ++    + A + CK L +LSGF + L  YLPA+Y V
Sbjct  229  ALLQRAPQLEEFGTGVYSA-EVRPDVLSGLSVAISGCKKLKWLSGFWDALPAYLPAVYSV  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA++ +  L  ++  C KLQ LWVLD + D+GL+ +A TCKD
Sbjct  288  CSGLTTLNLSYATVQSYDLVKLLSQCPKLQRLWVLDYIEDDGLEMLALTCKD  339



>ref|NP_567135.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana]
 sp|Q570C0.2|TIR1_ARATH RecName: Full=Protein TRANSPORT INHIBITOR RESPONSE 1; AltName: 
Full=Weak ethylene-insensitive protein 1 [Arabidopsis thaliana]
 pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure
 pdb|2P1N|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|E Chain E, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1P|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1Q|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|3C6N|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3C6O|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate 
Interactions In Auxin Perception And Signaling
 pdb|3C6P|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 gb|AAB69175.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|AAB69176.1| transport inhibitor response 1 [Arabidopsis thaliana]
 emb|CAB87743.1| transport inhibitor response 1 (TIR1) [Arabidopsis thaliana]
 gb|AAN71945.1| putative transport inhibitor response TIR1, AtFBL1 protein [Arabidopsis 
thaliana]
 gb|AEE80419.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana]
Length=594

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V+++ L ++A+SF NFK LVL+ CE F T GLA +A  CR L+ LDL + DV
Sbjct  109  EIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP+T T L SL   C+  +V+F ALE+LV R P+LK LKLNR V + +L 
Sbjct  169  DDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG + A E   ++    + A + CK L  LSGF + +  YLPA+Y V
Sbjct  229  TLLQRAPQLEELGTGGYTA-EVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSV  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA++ +  L  ++C C KLQ LWVLD + D GL+ +A+TCKD
Sbjct  288  CSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKD  339



>ref|XP_006449206.1| hypothetical protein CICLE_v10014739mg [Citrus clementina]
 gb|ESR62446.1| hypothetical protein CICLE_v10014739mg [Citrus clementina]
Length=579

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 155/233 (67%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L  LA SFPNFK L L+ C+ F T GLA +A  C+ L  LD+ +  +
Sbjct  117  ELRLKRMSVSDESLEFLAVSFPNFKVLSLSSCDGFSTDGLAAIATNCKNLTELDIQENGI  176

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFPE+ T LE L F  V  +V+F ALE+LV R  SLK LK+N+ +S+ QL 
Sbjct  177  EDISGSWLSCFPESFTSLEVLNFANVNSEVDFDALEKLVSRCKSLKDLKVNKSISLEQLQ  236

Query  361  RLMLRAPQLTDLGTGSFG---ASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            +L++ APQL DLGTGSF      ++ AELE    SAF  CK++  LSG  +  A Y PA+
Sbjct  237  KLLVLAPQLVDLGTGSFSQELTDDQRAELE----SAFNKCKNIHKLSGLWQATALYFPAL  292

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
             PVC NLT LN SYA++ + +L  ++ HC  L+ LWVLD+V D+GL+AV ++C
Sbjct  293  SPVCANLTFLNLSYATLGSSELVKLLMHCPLLKRLWVLDTVEDKGLEAVGSSC  345



>ref|XP_003608251.1| Protein AUXIN SIGNALING F-BOX [Medicago truncatula]
Length=586

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 151/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L  LA SFPNFK L L  C+ F T GLA VA  C+ L  LD+ +  V
Sbjct  124  ELRLKRMAVSDESLEFLAFSFPNFKALSLLSCDGFSTDGLAAVATNCKNLTELDIQENGV  183

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   +W+SCFPE+ T LE L F  +  DVNF ALE+LV R  SLK LK+N+ V++ QL 
Sbjct  184  DDKSGNWLSCFPESFTSLEILNFANLSNDVNFDALEKLVARCNSLKTLKVNKSVTLEQLQ  243

Query  361  RLMLRAPQLTDLGTGSFG---ASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            RL++RAPQL +LGTGSF      ++ +ELE     AF  C+SL  LSG     A Y   +
Sbjct  244  RLLVRAPQLCELGTGSFSQELTGQQYSELE----RAFNNCRSLHTLSGLWVASAQYHQVL  299

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            YPVCTNLT LNFSYA + +E L  ++  C  L+ LWVLD+V D+GL+AV + C
Sbjct  300  YPVCTNLTFLNFSYAPLDSEGLSKLLVRCPNLRRLWVLDTVEDKGLEAVGSYC  352



>ref|XP_008450007.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Cucumis melo]
Length=587

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 157/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++ L +L+RSFPNFK L+L  CE F T+GLA +A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDDSLELLSRSFPNFKSLLLFSCEGFTTNGLAAIAANCRFLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+ T L SL F C+  +VN  ALE+LV RSP+LK L+LNR V I  L 
Sbjct  164  DDHSNYWVSCFPESCTSLVSLNFACLRGEVNLGALERLVARSPNLKSLRLNRAVPIETLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             ++  APQL DLGTGS+   + ++E+  +  +    CKS+  LSGF ++    L +IYP+
Sbjct  224  NILANAPQLVDLGTGSY-VHDRDSEIYDNLKNTLLKCKSIRSLSGFLDVSPCCLASIYPI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA  +   +L  VI +C +LQ LW+LD + D+GL+ VA++C +
Sbjct  283  CSNLTSLNLSYAPGLHGNELIKVIQYCERLQRLWILDGIGDKGLEVVASSCNE  335



>ref|XP_003548933.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Glycine max]
Length=572

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 153/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF +FK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  105  ELRLKRMVVSDESLELLSRSFTHFKSLVLVSCEGFSTDGLAALAANCRFLRELDLQENEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D +  W+SCFP+  T L SL F C++ +V+  ALE+LV RSP LK LKLNR V    L 
Sbjct  165  EDHKGQWLSCFPDNCTSLVSLNFACLKGEVSLGALERLVARSPYLKSLKLNRSVPFDALQ  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R+M+RAPQL+DLG GSF   + E+E  +   +     KS+  LSGF E+    L AIYP+
Sbjct  225  RIMMRAPQLSDLGIGSF-VHDPESEAYIKLKNTILKRKSITSLSGFLEVAPHCLAAIYPI  283

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ L ++D + D+GL  VA +CKD
Sbjct  284  CPNLTSLNLSYAAGIQGSDLIKLIRHCVKLQRLLIMDCIGDKGLDVVATSCKD  336



>ref|XP_003536281.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X1 [Glycine max]
 gb|KHN03749.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Glycine soja]
Length=585

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ +S+E L ++A+SF NF+ LVL  CE F T GLA +A  CR LR L+L + +V
Sbjct  109  EIRLKRMVISDECLELIAKSFKNFQVLVLTSCEGFTTDGLAAIAANCRNLRELELRESEV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP++ T L SL   C+  +VN  ALE+LV R P+L+ L+LNR V + +L 
Sbjct  169  DDICGHWLSHFPDSYTSLVSLNISCLGNEVNLSALERLVSRCPNLQTLRLNRAVPLDRLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+  APQL +LGTG++  +E   E+  +   AF+ CK L  LSGF ++L  YLPA+YP+
Sbjct  229  NLLRGAPQLVELGTGTY-TTEMRPEVFTNLAEAFSGCKQLKGLSGFWDVLPSYLPAVYPI  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT+LN SYA+I +  L  ++  C  LQ LWVLD + D GL+ +AA+CKD
Sbjct  288  CSNLTSLNLSYATIQSPDLIKLVGQCESLQRLWVLDYIEDAGLEVIAASCKD  339



>gb|KHM99229.1| Protein AUXIN SIGNALING F-BOX 3 [Glycine soja]
Length=572

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 153/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF +FK LVL  CE F T GLA +A  CR LR LDL + +V
Sbjct  105  ELRLKRMVVSDESLELLSRSFTHFKSLVLVSCEGFSTDGLAALAANCRFLRELDLQENEV  164

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D +  W+SCFP+  T L SL F C++ +V+  ALE+LV RSP LK LKLNR V    L 
Sbjct  165  EDHKGQWLSCFPDNCTSLVSLNFACLKGEVSLGALERLVARSPYLKSLKLNRSVPFDALQ  224

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            R+M+RAPQL+DLG GSF   + E+E  +   +     KS+  LSGF E+    L AIYP+
Sbjct  225  RIMMRAPQLSDLGIGSF-VHDPESEAYIKLKNTILKRKSITSLSGFLEVAPHCLAAIYPI  283

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA+ I    L  +I HC KLQ L ++D + D+GL  VA +CKD
Sbjct  284  CPNLTSLNLSYAAGIQGSDLIKLIRHCVKLQRLLIMDCIGDKGLDVVATSCKD  336



>ref|XP_006467904.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Citrus 
sinensis]
 gb|KDO75706.1| hypothetical protein CISIN_1g008051mg [Citrus sinensis]
Length=579

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 154/233 (66%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L  LA SFPNFK L L+ C+ F T GLA +A  C+ L  LD+ +  +
Sbjct  117  ELRLKRMSVSDESLEFLAVSFPNFKVLSLSSCDGFSTDGLAAIATNCKNLTELDIQENGI  176

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFPE+ T LE L F  V  +V+F ALE+LV R  SLK LK+N+ +S+ QL 
Sbjct  177  EDISGSWLSCFPESFTSLEVLNFANVNSEVDFDALEKLVSRCKSLKDLKVNKSISLEQLQ  236

Query  361  RLMLRAPQLTDLGTGSFG---ASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAI  531
            +L++ APQL DLGTGSF      ++ AELE    SAF  CK++  LSG  +  A Y PA+
Sbjct  237  KLLVLAPQLVDLGTGSFSQELTDDQRAELE----SAFNKCKNIHKLSGLWQATALYFPAL  292

Query  532  YPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
             PVC NLT LN SYA++ + +L  ++ HC  L+ LWVLD+V D GL+AV ++C
Sbjct  293  SPVCANLTFLNLSYATLGSSELVKLLMHCPLLKRLWVLDTVEDRGLEAVGSSC  345



>ref|XP_006417190.1| hypothetical protein EUTSA_v10007195mg [Eutrema salsugineum]
 gb|ESQ35543.1| hypothetical protein EUTSA_v10007195mg [Eutrema salsugineum]
Length=577

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 151/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ VS+E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVSDESLELLSRSFANFKSLVLVSCEGFTTDGLASIAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFP++   L SL F C++ + N  ALE+LV RSP+LK LK+NR V +  L 
Sbjct  164  DDHRGQWLNCFPDSCITLTSLNFACLKGETNLAALERLVARSPNLKSLKVNRAVPLDALT  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E     ++A   C SL  LSGF E+    LPA YP+
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDPESFAKLSAAINKCTSLRCLSGFSEVAPRCLPAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL +LN SYA+ I    L   I  C +LQ LW+LDS+ D+GL+ VA+ CK+
Sbjct  283  CQNLISLNLSYAAEIQGNHLIKFIQFCKRLQRLWILDSIGDKGLEVVASACKE  335



>ref|XP_010545044.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X1 [Tarenaya hassleriana]
Length=590

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L  +A+SF NFK LVL+ CE F T GLA +A  CR LR LDL + DV
Sbjct  109  EIRLKRMVVTDECLEHIAKSFKNFKVLVLSSCEGFSTDGLAAIASNCRNLRELDLRESDV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP++ T L SL   C+  +V+F ALE+LV R P+L  L+LNR V + +L 
Sbjct  169  EDVSGHWLSHFPDSYTSLVSLNISCLSSEVSFSALERLVSRCPNLMSLRLNRSVPLERLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL +LGTG++ A E   ++    + AFA CK L  LSGF ++   YLPA+Y  
Sbjct  229  TLLQRAPQLIELGTGAYTA-EVRPDVFSSLSGAFAGCKGLKSLSGFWDVDPAYLPAMYSA  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA++ +  L  ++  C KLQ LWVLD + D GL+A+A++CKD
Sbjct  288  CSRLTTLNLSYATVQSSDLVKLLSQCPKLQRLWVLDYIEDAGLEALASSCKD  339



>ref|XP_009116967.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Brassica 
rapa]
Length=595

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ +KR+ VS+E L ++A+SF NFK LVL+ C+ F T GLA +A  CR L+ LDL + DV
Sbjct  109  EIRVKRMVVSDECLELIAKSFKNFKVLVLSSCDGFSTDGLAAIASSCRNLKELDLRESDV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP+T T L SL   C+  +V+F ALE+LV RSP+LK LKLNR V + +L 
Sbjct  169  DDVSGHWLSHFPDTYTSLVSLNISCLVSEVSFSALERLVCRSPNLKSLKLNRAVPLEKLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL + GTG + A E   ++    + A + CK L +LSGF + L  YLPA+Y V
Sbjct  229  ALLQRAPQLEEFGTGVYSA-EVRPDVLSGLSVAISGCKKLKWLSGFWDALPAYLPAVYSV  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA++ +  L  ++  C KLQ LWVLD + D+GL+ +A TCKD
Sbjct  288  CSGLTTLNLSYATVQSYDLVKLLSQCPKLQRLWVLDYIEDDGLEMLALTCKD  339



>emb|CDX76680.1| BnaC08g32660D [Brassica napus]
Length=595

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ VS+E L ++A+SF NFK LVL+ C+ F T GLA +A  CR L+ LDL + DV
Sbjct  109  EIRLKRMVVSDECLELIAKSFKNFKVLVLSSCDGFSTDGLAAIASTCRNLKELDLRESDV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+S FP++ T L SL   C+  +V+F ALE+LV RSP+LK LKLNR V + +L 
Sbjct  169  DDVSGHWLSHFPDSYTSLVSLNISCLVSEVSFSALERLVCRSPNLKSLKLNRAVPLEKLA  228

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL + GTG + A E   ++    + A + CK L +LSGF + L  YLPA+Y V
Sbjct  229  TLLQRAPQLEEFGTGVYSA-EVRPDVLSGLSVAISGCKKLKWLSGFWDALPAYLPAVYSV  287

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LTTLN SYA++ +  L  ++  C KLQ LWVLD + D+GL+ +A TCKD
Sbjct  288  CSGLTTLNLSYATVQSYDLVKLLSQCPKLQRLWVLDYIEDDGLEMLALTCKD  339



>gb|ACV87282.1| TIR1/AFB auxin receptor protein PintaAFB6 [Pinus taeda]
Length=575

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 155/233 (67%), Gaps = 1/233 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L ++ARSF +F+ L L  CE F T GLA +A  CR L+ LDL + +V
Sbjct  112  ELRLKRMIVTDESLELIARSFSDFRALSLTTCEGFSTDGLAVIATHCRNLQELDLQESEV  171

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W+SCFPE+   L SL F C++ +VNF AL++LV R  SL+ LKLN+ +S+ QL 
Sbjct  172  DDRGGYWLSCFPESCVSLVSLNFACLQSEVNFDALQRLVARCISLRSLKLNKTLSLEQLK  231

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++ APQL +LGTGSF       +   D  +AF  C  L  LSG  E+   YLPA+Y V
Sbjct  232  RLLVIAPQLMELGTGSFFQELSGPQFTTDLENAFKNCNKLRTLSGMWEVAPLYLPALYSV  291

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+NLT LN SYA+ I + +L  ++ HC +L+ LWVLD+V D+GL+ V++ CK+
Sbjct  292  CSNLTFLNLSYAANIRSMELGRLVSHCPQLRRLWVLDTVGDKGLETVSSNCKN  344



>gb|KHN00102.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Glycine soja]
Length=552

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 151/230 (66%), Gaps = 1/230 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L  LA  FPNFK L L  C+ F T GLA++A  C+ L  LD+ +  +
Sbjct  90   ELRLKRMTVTDESLEFLALQFPNFKALSLLSCDGFSTDGLASIATNCKNLTELDIQENGI  149

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D   +W+ CFP++ T LE L F  +  DVNF ALE+LV R  SLK LK+N+ V++ QL 
Sbjct  150  EDKSGNWLGCFPDSFTSLEVLNFANLHNDVNFDALEKLVSRCKSLKTLKVNKSVTLEQLQ  209

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++  PQL +LGTGSF + E  A+   D  SAF  C++L  LSG     A YLP +Y  
Sbjct  210  RLLVHVPQLGELGTGSF-SQELTAQQCSDLESAFKNCRNLHTLSGLWVATAQYLPVLYSA  268

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            CTNLT LNFSYA + ++ L  ++ HC KLQ +WV+D+V D+GL+AV + C
Sbjct  269  CTNLTFLNFSYAPLDSDGLAKLLVHCPKLQRIWVVDTVEDKGLEAVGSHC  318



>ref|XP_006306355.1| hypothetical protein CARUB_v10012250mg [Capsella rubella]
 gb|EOA39253.1| hypothetical protein CARUB_v10012250mg [Capsella rubella]
Length=577

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 151/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLELLSRSFANFKSLVLVSCEGFTTDGLASIAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFP++ T L SL F C++ + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLNCFPDSCTTLTSLNFACLKGETNVAALERLVARSPNLKSLKLNRAVPLEALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E      +A   C SL  LSGF E+    LPA YP+
Sbjct  224  RLMSCAPQLLDLGVGSY-ENEPDPESFTKLMAAIKKCTSLRSLSGFLEVAPLCLPAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL +LN SYA+ I    L  +I  C +LQ LW+LDS+ D+GL  VA TCK+
Sbjct  283  CQNLISLNLSYAAEIQGNHLIKLIQLCKRLQRLWILDSIGDKGLVVVADTCKE  335



>ref|XP_002465737.1| hypothetical protein SORBIDRAFT_01g044720 [Sorghum bicolor]
 gb|EER92735.1| hypothetical protein SORBIDRAFT_01g044720 [Sorghum bicolor]
Length=602

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 159/239 (67%), Gaps = 9/239 (4%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFP-NFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            LYLKRI V++ DL +L+RS P +F++L L  C+ F + GLA++A  C  LRVLD+++CD+
Sbjct  129  LYLKRIPVTDADLDLLSRSLPASFRDLTLHLCDGFTSRGLASIASHCSGLRVLDVVECDM  188

Query  181  KDDE---VDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIV  351
             +++   VDW++ FP   T LESL F+C E  V+F ALE LV RSP L +L +N HVS+ 
Sbjct  189  AEEQEGVVDWVAAFPPEPTNLESLSFECYEPPVDFDALEALVARSPLLNRLGVNMHVSLG  248

Query  352  QLYRLMLRAPQLTDLGTGSFGASEEEAELELDYT--SAFAA---CKSLVYLSGFREILAD  516
            QL RLM  AP+L+ LGTGSF  ++   E        SAF +    ++LV LSGFR++  +
Sbjct  249  QLRRLMALAPRLSHLGTGSFRPADGGEEGAGFGEVFSAFVSAGRARTLVSLSGFRDLAQE  308

Query  517  YLPAIYPVCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            YLP I  VC +L +L+ SY +++  Q+   I  C+ L+ LWVLDSV DEGL++V  +CK
Sbjct  309  YLPTIAVVCAHLKSLDLSYTAVTPNQILMFIGQCYNLETLWVLDSVRDEGLESVGMSCK  367



>ref|XP_002981422.1| hypothetical protein SELMODRAFT_178850 [Selaginella moellendorffii]
 gb|EFJ17610.1| hypothetical protein SELMODRAFT_178850 [Selaginella moellendorffii]
Length=595

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 153/231 (66%), Gaps = 1/231 (0%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVK  183
            L LKR+ VS+E L M+++  PNF+ L L  C+ F T G+A +   CR L+ LDL +C V 
Sbjct  120  LRLKRMTVSDESLFMISQLLPNFRALNLVNCDGFSTEGIAAITSHCRYLQELDLQECLVD  179

Query  184  DDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYR  363
            D   +W+S FPE+   L +L F C+E DVNF+ LE+LV R  SLKKL LN+ V++ QL R
Sbjct  180  DRGGEWLSYFPESCNTLVTLNFSCLESDVNFECLEKLVSRCRSLKKLNLNKGVTLEQLLR  239

Query  364  LMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVC  543
            L+++APQLTDLGTG++   +  ++  ++  +A + CK L +LSGF  +   ++P IYP+ 
Sbjct  240  LLVKAPQLTDLGTGTYSQMQNWSQY-VELRTALSNCKDLRHLSGFWMVEPIFIPLIYPLA  298

Query  544  TNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             NL +LN SYA+I A +   +I  C KL+ LWVLDSV D GL+ V  TCK+
Sbjct  299  QNLLSLNLSYATIRATEFAKLIQRCPKLETLWVLDSVEDRGLQTVGETCKN  349



>ref|XP_002969952.1| hypothetical protein SELMODRAFT_170974 [Selaginella moellendorffii]
 gb|EFJ29076.1| hypothetical protein SELMODRAFT_170974 [Selaginella moellendorffii]
Length=600

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 153/231 (66%), Gaps = 1/231 (0%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVK  183
            L LKR+ VS+E L M+++  PNF+ L L  C+ F T G+A +   CR L+ LDL +C V 
Sbjct  125  LRLKRMTVSDESLFMISQLLPNFRALNLVNCDGFSTEGIAAITSHCRYLQELDLQECLVD  184

Query  184  DDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYR  363
            D   +W+S FPE+   L +L F C+E DVNF+ LE+LV R  SLKKL LN+ V++ QL R
Sbjct  185  DRGGEWLSYFPESCNTLVTLNFSCLESDVNFECLEKLVSRCRSLKKLNLNKGVTLEQLLR  244

Query  364  LMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVC  543
            L+++APQLTDLGTG++   +  ++  ++  +A + CK L +LSGF  +   ++P IYP+ 
Sbjct  245  LLVKAPQLTDLGTGTYSQMQNWSQY-VELRTALSNCKDLRHLSGFWMVEPIFIPLIYPLA  303

Query  544  TNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
             NL +LN SYA+I A +   +I  C KL+ LWVLDSV D GL+ V  TCK+
Sbjct  304  QNLLSLNLSYATIRATEFAKLIQRCPKLETLWVLDSVEDRGLQTVGETCKN  354



>ref|XP_010905566.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Elaeis 
guineensis]
 ref|XP_010905567.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Elaeis 
guineensis]
 ref|XP_010905568.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Elaeis 
guineensis]
Length=589

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 157/230 (68%), Gaps = 2/230 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L  LARSFP FK L L  C+ F T GLA++   CR L  LD+ +  +
Sbjct  123  ELRLKRMTVTDESLDFLARSFPEFKALSLVSCDGFSTDGLASITTYCRNLTELDIQESGI  182

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W++ FPE+ T LE+L F  +  +VNF ALE+LV R  SLK LK+N+HV + QL 
Sbjct  183  EDLGGSWLN-FPESFTSLEALNFANLHSEVNFDALERLVARCKSLKVLKVNKHVMLEQLR  241

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++RAPQLT+LGTG F + + +    +D  SAF+ CK+L  LSG  E+ + YLPA++P 
Sbjct  242  RLLVRAPQLTELGTGPF-SQDHKLRSHIDLESAFSNCKNLNTLSGLWEVSSMYLPALFPA  300

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            CTNLT LN SY ++ + +L  ++  C  L+ LWVLD+V D+GL+AVA++C
Sbjct  301  CTNLTFLNLSYTALQSAELAKLLQKCPLLRRLWVLDTVEDKGLEAVASSC  350



>ref|XP_004134961.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Cucumis sativus]
 ref|XP_004171065.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Cucumis sativus]
 gb|KGN49186.1| hypothetical protein Csa_6G516940 [Cucumis sativus]
Length=584

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 150/230 (65%), Gaps = 1/230 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V +E L  L+RSFPNFK L +  C+ F T GLA +A  C+ L  LD+++ D+
Sbjct  122  ELRLKRMTVMDESLEFLSRSFPNFKALSMMSCDGFSTDGLAAIATNCKNLTELDILENDI  181

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D   +W+SCFP+T   LE L F  +  DV+F+ALE+LV RS SLK LK+NR++++ QL 
Sbjct  182  NDKSGNWLSCFPDTLKSLEVLNFASLNSDVSFEALEKLVRRSKSLKVLKVNRNINLEQLQ  241

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RL++  PQLT+LGTGSF + E       D   AF +CK+L  LSG  E    YL  ++P 
Sbjct  242  RLLVHTPQLTELGTGSF-SQEITLRQYCDLEEAFKSCKNLHTLSGLLESTVLYLQVLFPA  300

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATC  690
            C N+T LN SYA +   +L  ++ HC  L+ LWVLD+V D+GLKAV  +C
Sbjct  301  CANITFLNLSYAILHGGELAGLLSHCPVLRRLWVLDTVEDKGLKAVGLSC  350



>ref|NP_001267546.1| protein TRANSPORT INHIBITOR RESPONSE 1-like [Cucumis sativus]
 ref|XP_004160531.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Cucumis 
sativus]
 gb|AGA63733.1| transport inhibitor response 1 [Cucumis sativus]
 gb|AGI15227.1| transport inhibitor response protein [Cucumis sativus]
 gb|KGN44877.1| hypothetical protein Csa_7G393970 [Cucumis sativus]
Length=584

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 153/232 (66%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++++SF NFK LVL  CE F T GLA +A  CR L+VLDL + DV
Sbjct  108  EIRLKRMVVTDESLELISKSFKNFKVLVLMTCEGFSTDGLAAIAANCRHLKVLDLRESDV  167

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP+T T L SL   C+  +V+  ALE+LV R P+L+ L+LNR V + +  
Sbjct  168  EDLNGHWLSHFPDTYTSLVSLNIACLVSEVSVSALERLVDRCPNLRTLRLNRPVPLDRHA  227

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL + G G + A +  +E+    T AF +C  L  LSGF +++  YLP++YP 
Sbjct  228  NLLRRAPQLVEFGAGCYTA-DLRSEVFSSLTGAFTSCTELKSLSGFWDVVPAYLPSVYPT  286

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I  + L  ++  CH LQ LWVLD + D GL+AVA TCKD
Sbjct  287  CSQLTSLNLSYATIQCDDLTKLVSQCHNLQKLWVLDFIEDSGLEAVAVTCKD  338



>ref|XP_008451438.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Cucumis melo]
Length=584

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 153/232 (66%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++++SF NFK LVL  CE F T GLA +A  CR L+VLDL + DV
Sbjct  108  EIRLKRMVVTDESLELISKSFKNFKVLVLMTCEGFSTDGLAAIAANCRNLKVLDLRESDV  167

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP+T T L SL   C+  +V+  ALE+LV R P+L+ L+LNR V + +  
Sbjct  168  EDLNGHWLSHFPDTYTSLVSLNIACLGSEVSVSALERLVDRCPNLRTLRLNRPVPLDRHA  227

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL + G G + A +  +E+    T AF +C  L  LSGF +++  YLP++YP 
Sbjct  228  NLLRRAPQLVEFGAGCYMA-DLRSEVFSSLTGAFTSCTELKSLSGFWDVVPAYLPSVYPT  286

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I  + L  +I  CH LQ LWVLD + D GL+AVA TCKD
Sbjct  287  CSRLTSLNLSYATIQCDDLTKLISQCHNLQKLWVLDFIEDSGLEAVADTCKD  338



>ref|XP_011009720.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Populus euphratica]
Length=571

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ +S+E L +++RSF NFK LVL  CE F T GLA +A  CR LR LDL + DV
Sbjct  104  ELKLKRMIISDECLELISRSFANFKSLVLVSCEGFSTDGLAAIASNCRFLRELDLQENDV  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+SCFP+T T L SL F C++ +VN  ALE+L+ RSP+L+ L+LN  V +  L 
Sbjct  164  EDHRGHWLSCFPDTCTSLVSLNFACLKGEVNVAALERLIARSPNLRSLRLNHAVPLDVLQ  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            ++++RAP L DLG GS+  ++ ++E       A   C S+  LSGF E+    LPA + +
Sbjct  224  KILIRAPHLVDLGVGSY-VNDPDSETYNKLVMAIQKCMSVKSLSGFLEVAPHCLPAFHLI  282

Query  541  CTNLTTLNFSYA-SISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NLT+LN SYA  I   +L  +I HC KLQ LW+LD + D+GL+ VA+TCKD
Sbjct  283  CPNLTSLNLSYAPGIHGAELIKLIRHCMKLQRLWILDCIGDQGLEVVASTCKD  335



>gb|KJB23183.1| hypothetical protein B456_004G085900 [Gossypium raimondii]
Length=586

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 156/233 (67%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ V++E L ++A+SF NFK LVL+ CE F T GLA +A  C+ L+ LDL DC+V
Sbjct  109  EIRLKRMVVTDESLELIAKSFKNFKVLVLSSCEGFSTDGLAVIAASCKNLKELDLRDCEV  168

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECD-VNFQALEQLVMRSPSLKKLKLNRHVSIVQL  357
             D    W+S FPET T L SL   C+  D V+F ALE+LV R  +LK L+LNR V + ++
Sbjct  169  DDLSAHWLSHFPETYTSLVSLNISCLGSDEVSFSALERLVGRCTNLKTLRLNRAVPLDKI  228

Query  358  YRLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYP  537
              ++  APQL + GTG++ A +   ++  D    F++CK L  LSGF +++ DYLPAIYP
Sbjct  229  ANILRHAPQLVEFGTGTYTA-DVRPDVYSDLAGVFSSCKELKSLSGFWDVVPDYLPAIYP  287

Query  538  VCTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            VC+ LT+LN SYA+I +  L  ++ HC  LQ L VLD + D GL+ +A++CKD
Sbjct  288  VCSKLTSLNLSYATIQSPDLIKLVSHCPNLQRLLVLDYIEDSGLEVLASSCKD  340



>ref|XP_010522662.1| PREDICTED: GRR1-like protein 1 [Tarenaya hassleriana]
Length=578

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 154/231 (67%), Gaps = 1/231 (0%)
 Frame = +1

Query  4    LYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDVK  183
            + +KR+ V++E L M+A SF +FK LVL+ CE F T GLA +A  C  L  LD+ + +V+
Sbjct  108  IRMKRMVVTDECLEMIAESFRDFKVLVLSSCEGFTTDGLAAIAASCSNLTELDVSESEVE  167

Query  184  DDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLYR  363
            D   DW+S FP+T T L SL F C+E +V+   L +LV RSP+LK L LNR VS+  L  
Sbjct  168  DLGGDWLSYFPDTCTSLVSLNFSCLESEVSSSDLRRLVARSPNLKSLVLNRAVSLDHLNE  227

Query  364  LMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPVC  543
            L+ RAPQLT+LGTGSF A  +   L  D + AF+ CK L  LSG  +++ DYLPA+Y V 
Sbjct  228  LLRRAPQLTELGTGSFSAELQPHALS-DLSEAFSGCKDLKCLSGLWDVIPDYLPALYTVS  286

Query  544  TNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            + LT+LN SYA+I +  L  ++  C KLQ LWVLD + D GL+AVA+ CKD
Sbjct  287  SGLTSLNLSYATIRSHDLVKLLSQCPKLQKLWVLDFIEDSGLEAVASCCKD  337



>ref|NP_563915.1| auxin signaling F-box 3 protein [Arabidopsis thaliana]
 sp|Q9LPW7.1|AFB3_ARATH RecName: Full=Protein AUXIN SIGNALING F-BOX 3 [Arabidopsis thaliana]
 gb|AAF78487.1|AC012187_7 Strong similarity to transport inhibitor response 1 (TIR1) from 
Arabidopsis thaliana gb|AF005047 [Arabidopsis thaliana]
 gb|AAM20393.1| transport inhibitor response 1, putative [Arabidopsis thaliana]
 gb|AAN72129.1| transport inhibitor response 1, putative [Arabidopsis thaliana]
 dbj|BAE99304.1| putative transport inhibitor response 1 [Arabidopsis thaliana]
 gb|AEE28934.1| auxin signaling F-box 3 protein [Arabidopsis thaliana]
Length=577

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 151/233 (65%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V++E L +L+RSF NFK LVL  CE F T GLA++A  CR LR LDL + ++
Sbjct  104  ELRLKRMVVTDESLDLLSRSFANFKSLVLVSCEGFTTDGLASIAANCRHLRELDLQENEI  163

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
             D    W++CFP++ T L SL F C++ + N  ALE+LV RSP+LK LKLNR V +  L 
Sbjct  164  DDHRGQWLNCFPDSCTTLMSLNFACLKGETNVAALERLVARSPNLKSLKLNRAVPLDALA  223

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
            RLM  APQL DLG GS+  +E + E      +A     SL  LSGF E+    LPA YP+
Sbjct  224  RLMSCAPQLVDLGVGSY-ENEPDPESFAKLMTAIKKYTSLRSLSGFLEVAPLCLPAFYPI  282

Query  541  CTNLTTLNFSYAS-ISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C NL +LN SYA+ I    L  +I  C +LQ LW+LDS+ D+GL  VAATCK+
Sbjct  283  CQNLISLNLSYAAEIQGNHLIKLIQLCKRLQRLWILDSIGDKGLAVVAATCKE  335



>ref|XP_010941793.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500 
[Elaeis guineensis]
Length=580

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 153/231 (66%), Gaps = 1/231 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            +L LKR+ V+++   ++ARSF NF+ L L+ CE F T+GLA +A  CR LR +DL + +V
Sbjct  111  ELRLKRMVVTDDCFELIARSFKNFRVLALSSCEGFSTAGLAAIAANCRNLREIDLHENEV  170

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D+ V W+S FPE+ T L +L   C+E +VN   LE+LV R  +LK LKLN  V + +L 
Sbjct  171  EDNSVHWLSHFPESFTSLVNLNIACLEGEVNVCVLERLVSRCTNLKTLKLNHAVPLDRLV  230

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+ RAPQL DLGTG F A E  AEL     SAFA+CKS+  +SG  E +  Y+PAIY V
Sbjct  231  NLLHRAPQLADLGTGRFSA-EYRAELFSKLESAFASCKSMKSISGIFEAVPAYIPAIYSV  289

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCK  693
            C  LT+LN SYA+I +  L  ++  C  LQ LWV+D + D GL AVA++CK
Sbjct  290  CNGLTSLNLSYATIQSPDLIKLVSRCKNLQRLWVMDLIEDNGLAAVASSCK  340



>gb|KEH43259.1| transport inhibitor response-like protein [Medicago truncatula]
Length=589

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    KLYLKRIDVSNEDLMMLARSFPNFKELVLACCEEFGTSGLATVACECRKLRVLDLIDCDV  180
            ++ LKR+ +S++ L ++A+SF NFK LVL  CE F T GLA++A  CR LR LDL + +V
Sbjct  114  EIKLKRMVISDDCLDLIAKSFKNFKVLVLISCEGFTTDGLASIAANCRNLRELDLRESEV  173

Query  181  KDDEVDWISCFPETKTCLESLIFDCVECDVNFQALEQLVMRSPSLKKLKLNRHVSIVQLY  360
            +D    W+S FP++ T L SL   C+  +VNF ALE+LV R P++  L+LNR   + +L 
Sbjct  174  EDICGHWLSHFPDSYTSLVSLNISCLANEVNFPALERLVSRCPNMHTLRLNRAAPLDKLA  233

Query  361  RLMLRAPQLTDLGTGSFGASEEEAELELDYTSAFAACKSLVYLSGFREILADYLPAIYPV  540
             L+  APQL +LGTG++  SE   E+  +  +AF+ CK +  LSGF ++L  YLPA+YPV
Sbjct  234  NLLRGAPQLVELGTGAY-TSEMRPEVFTNLAAAFSGCKQMKGLSGFWDVLPSYLPAVYPV  292

Query  541  CTNLTTLNFSYASISAEQLKPVICHCHKLQILWVLDSVCDEGLKAVAATCKD  696
            C+ LT+LN SYA+I +  L  ++  C  LQ LWVLD + D GL  +AA+CKD
Sbjct  293  CSRLTSLNLSYATIQSPDLIKLVGQCQSLQRLWVLDYIEDAGLDMLAASCKD  344



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160