BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048J21

Length=712
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357074.1|  PREDICTED: conserved oligomeric Golgi comple...    303   5e-94   Solanum tuberosum [potatoes]
ref|XP_004244508.1|  PREDICTED: conserved oligomeric Golgi comple...    303   5e-94   Solanum lycopersicum
ref|XP_009769044.1|  PREDICTED: conserved oligomeric Golgi comple...    303   8e-94   Nicotiana sylvestris
ref|XP_009602477.1|  PREDICTED: conserved oligomeric Golgi comple...    300   6e-93   Nicotiana tomentosiformis
ref|XP_011083848.1|  PREDICTED: conserved oligomeric Golgi comple...    296   4e-91   Sesamum indicum [beniseed]
gb|EYU23123.1|  hypothetical protein MIMGU_mgv1a001829mg                290   5e-89   Erythranthe guttata [common monkey flower]
emb|CDP04651.1|  unnamed protein product                                283   3e-86   Coffea canephora [robusta coffee]
ref|XP_008374256.1|  PREDICTED: conserved oligomeric Golgi comple...    283   3e-86   Malus domestica [apple tree]
ref|XP_010105239.1|  Conserved oligomeric Golgi complex subunit 2       280   9e-86   
ref|XP_007210583.1|  hypothetical protein PRUPE_ppa015080mg             280   2e-85   
ref|XP_004164803.1|  PREDICTED: conserved oligomeric Golgi comple...    275   2e-85   
ref|XP_009375225.1|  PREDICTED: conserved oligomeric Golgi comple...    280   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_009359449.1|  PREDICTED: conserved oligomeric Golgi comple...    280   5e-85   Pyrus x bretschneideri [bai li]
ref|XP_008239451.1|  PREDICTED: conserved oligomeric Golgi comple...    280   5e-85   Prunus mume [ume]
ref|XP_007155537.1|  hypothetical protein PHAVU_003G210200g             279   8e-85   Phaseolus vulgaris [French bean]
ref|XP_008463108.1|  PREDICTED: conserved oligomeric Golgi comple...    277   3e-84   
ref|XP_008392829.1|  PREDICTED: conserved oligomeric Golgi comple...    275   2e-83   
ref|XP_008351743.1|  PREDICTED: conserved oligomeric Golgi comple...    275   2e-83   
ref|XP_004138387.1|  PREDICTED: conserved oligomeric Golgi comple...    275   3e-83   Cucumis sativus [cucumbers]
ref|XP_002511204.1|  Conserved oligomeric Golgi complex component...    273   8e-83   Ricinus communis
ref|XP_003549849.1|  PREDICTED: conserved oligomeric Golgi comple...    273   9e-83   Glycine max [soybeans]
gb|KDP30933.1|  hypothetical protein JCGZ_11309                         273   1e-82   Jatropha curcas
ref|XP_003525701.1|  PREDICTED: conserved oligomeric Golgi comple...    273   2e-82   Glycine max [soybeans]
ref|XP_004515820.1|  PREDICTED: conserved oligomeric Golgi comple...    270   2e-81   Cicer arietinum [garbanzo]
gb|KDO52635.1|  hypothetical protein CISIN_1g004390mg                   265   2e-81   Citrus sinensis [apfelsine]
ref|XP_007023398.1|  Golgi organization, COG2 isoform 3                 263   4e-81   
ref|XP_010677897.1|  PREDICTED: conserved oligomeric Golgi comple...    268   7e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007023399.1|  Golgi organization, COG2 isoform 4                 263   8e-81   
ref|XP_004297537.1|  PREDICTED: conserved oligomeric Golgi comple...    268   1e-80   Fragaria vesca subsp. vesca
ref|XP_010250762.1|  PREDICTED: conserved oligomeric Golgi comple...    267   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010026579.1|  PREDICTED: conserved oligomeric Golgi comple...    266   8e-80   Eucalyptus grandis [rose gum]
ref|XP_006477014.1|  PREDICTED: conserved oligomeric Golgi comple...    266   9e-80   Citrus sinensis [apfelsine]
ref|XP_007023397.1|  Golgi organization, COG2 isoform 2                 264   1e-79   
ref|XP_010026586.1|  PREDICTED: conserved oligomeric Golgi comple...    265   1e-79   Eucalyptus grandis [rose gum]
gb|KDO52629.1|  hypothetical protein CISIN_1g004390mg                   265   1e-79   Citrus sinensis [apfelsine]
ref|XP_006440092.1|  hypothetical protein CICLE_v10018979mg             265   1e-79   Citrus clementina [clementine]
gb|KDO52630.1|  hypothetical protein CISIN_1g004390mg                   265   1e-79   Citrus sinensis [apfelsine]
ref|XP_003608845.1|  Conserved oligomeric Golgi complex subunit         261   4e-79   
ref|XP_007023396.1|  Golgi organization, COG2 isoform 1                 264   4e-79   
gb|EPS73270.1|  hypothetical protein M569_01480                         263   6e-79   Genlisea aurea
ref|XP_003608844.1|  Conserved oligomeric Golgi complex subunit         261   3e-78   Medicago truncatula
ref|XP_002318717.1|  hypothetical protein POPTR_0012s09800g             261   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_002279916.1|  PREDICTED: conserved oligomeric Golgi comple...    261   4e-78   Vitis vinifera
emb|CAN71854.1|  hypothetical protein VITISV_007347                     261   5e-78   Vitis vinifera
ref|XP_011044173.1|  PREDICTED: conserved oligomeric Golgi comple...    259   2e-77   Populus euphratica
ref|XP_006283181.1|  hypothetical protein CARUB_v10004211mg             256   3e-76   Capsella rubella
gb|KJB43167.1|  hypothetical protein B456_007G187600                    254   2e-75   Gossypium raimondii
gb|KJB43171.1|  hypothetical protein B456_007G187600                    254   2e-75   Gossypium raimondii
gb|KHG07418.1|  Conserved oligomeric Golgi complex subunit 2            254   2e-75   Gossypium arboreum [tree cotton]
ref|XP_011024042.1|  PREDICTED: conserved oligomeric Golgi comple...    253   3e-75   Populus euphratica
ref|XP_008794572.1|  PREDICTED: conserved oligomeric Golgi comple...    252   9e-75   Phoenix dactylifera
ref|XP_002322242.1|  hypothetical protein POPTR_0015s10610g             251   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010926721.1|  PREDICTED: conserved oligomeric Golgi comple...    249   2e-74   
ref|XP_010927713.1|  PREDICTED: conserved oligomeric Golgi comple...    250   4e-74   Elaeis guineensis
ref|XP_010926719.1|  PREDICTED: conserved oligomeric Golgi comple...    249   1e-73   Elaeis guineensis
ref|XP_010536632.1|  PREDICTED: conserved oligomeric Golgi comple...    246   2e-72   Tarenaya hassleriana [spider flower]
emb|CAB41124.1|  brefeldin A-sensitive Golgi protein-like               245   3e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29022.1|  hypothetical protein AALP_AA7G078500                    245   4e-72   Arabis alpina [alpine rockcress]
ref|NP_567710.1|  uncharacterized protein                               245   5e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAK32887.1|AF367300_1  AT4g24840/F6I7_50                             245   5e-72   Arabidopsis thaliana [mouse-ear cress]
gb|EYU23122.1|  hypothetical protein MIMGU_mgv1a024704mg                244   6e-72   Erythranthe guttata [common monkey flower]
ref|XP_010433717.1|  PREDICTED: conserved oligomeric Golgi comple...    243   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002867640.1|  hypothetical protein ARALYDRAFT_492352             243   3e-71   
ref|XP_009385490.1|  PREDICTED: conserved oligomeric Golgi comple...    242   4e-71   
ref|XP_009385489.1|  PREDICTED: conserved oligomeric Golgi comple...    241   8e-71   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX92658.1|  BnaC07g39160D                                          241   1e-70   
ref|XP_006413377.1|  hypothetical protein EUTSA_v10024490mg             240   3e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009137478.1|  PREDICTED: conserved oligomeric Golgi comple...    239   4e-70   Brassica rapa
ref|XP_010448510.1|  PREDICTED: conserved oligomeric Golgi comple...    239   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010438959.1|  PREDICTED: conserved oligomeric Golgi comple...    239   5e-70   Camelina sativa [gold-of-pleasure]
emb|CDY11039.1|  BnaA03g46980D                                          238   2e-69   Brassica napus [oilseed rape]
ref|XP_010485902.1|  PREDICTED: conserved oligomeric Golgi comple...    237   5e-69   Camelina sativa [gold-of-pleasure]
emb|CDY34317.1|  BnaA01g14200D                                          236   1e-68   Brassica napus [oilseed rape]
ref|XP_006848427.1|  hypothetical protein AMTR_s00013p00234340          236   2e-68   
emb|CDY03412.1|  BnaC01g16700D                                          235   2e-68   
gb|KHN34411.1|  Conserved oligomeric Golgi complex subunit 2            234   4e-68   Glycine soja [wild soybean]
ref|XP_006296685.1|  hypothetical protein CARUB_v10013037mg             234   5e-68   Capsella rubella
ref|XP_009138596.1|  PREDICTED: conserved oligomeric Golgi comple...    231   6e-67   Brassica rapa
ref|XP_010464008.1|  PREDICTED: conserved oligomeric Golgi comple...    228   7e-66   Camelina sativa [gold-of-pleasure]
ref|NP_001051898.1|  Os03g0849600                                       205   2e-57   
gb|EEC76534.1|  hypothetical protein OsI_14326                          199   4e-55   Oryza sativa Indica Group [Indian rice]
dbj|BAK01513.1|  predicted protein                                      198   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY51233.1|  BnaA03g07050D                                          197   7e-55   Brassica napus [oilseed rape]
emb|CDX70811.1|  BnaC03g08950D                                          191   1e-52   
ref|XP_009131654.1|  PREDICTED: conserved oligomeric Golgi comple...    191   2e-52   Brassica rapa
ref|XP_004981048.1|  PREDICTED: conserved oligomeric Golgi comple...    184   3e-50   Setaria italica
ref|NP_001169749.1|  uncharacterized protein LOC100383630               177   2e-48   
ref|XP_002463519.1|  hypothetical protein SORBIDRAFT_01g001270          180   2e-48   Sorghum bicolor [broomcorn]
ref|XP_001761415.1|  predicted protein                                  179   3e-48   
tpg|DAA52497.1|  TPA: hypothetical protein ZEAMMB73_788308              179   3e-48   
ref|XP_008645319.1|  PREDICTED: uncharacterized protein LOC100383...    178   6e-48   
ref|XP_001764075.1|  predicted protein                                  175   1e-46   
ref|XP_003562360.1|  PREDICTED: conserved oligomeric Golgi comple...    174   3e-46   Brachypodium distachyon [annual false brome]
ref|XP_002966110.1|  hypothetical protein SELMODRAFT_86129              172   8e-46   Selaginella moellendorffii
ref|XP_002982190.1|  hypothetical protein SELMODRAFT_115746             171   1e-45   Selaginella moellendorffii
ref|XP_008644331.1|  PREDICTED: conserved oligomeric Golgi comple...    169   8e-45   
gb|KHN14099.1|  Conserved oligomeric Golgi complex subunit 2            158   5e-41   Glycine soja [wild soybean]
gb|KEH35882.1|  oligomeric component, putative                          127   2e-32   Medicago truncatula
ref|XP_002947088.1|  component of oligomeric golgi complex 2            136   2e-32   Volvox carteri f. nagariensis
ref|XP_005644140.1|  hypothetical protein COCSUDRAFT_48790              133   1e-31   Coccomyxa subellipsoidea C-169
ref|XP_003603203.1|  Conserved oligomeric Golgi complex subunit         126   2e-29   
ref|XP_001695227.1|  component of oligomeric golgi complex 2            122   3e-28   Chlamydomonas reinhardtii
ref|XP_005848758.1|  hypothetical protein CHLNCDRAFT_57543              122   5e-28   Chlorella variabilis
ref|XP_011431284.1|  PREDICTED: conserved oligomeric Golgi comple...  94.7    2e-18   Crassostrea gigas
ref|XP_007510910.1|  predicted protein                                93.6    7e-18   Bathycoccus prasinos
ref|XP_002613283.1|  hypothetical protein BRAFLDRAFT_113783           92.0    1e-17   Branchiostoma floridae
ref|XP_002158309.2|  PREDICTED: conserved oligomeric Golgi comple...  91.3    2e-17   
ref|XP_002969327.1|  hypothetical protein SELMODRAFT_7944             84.3    4e-17   
ref|XP_002970804.1|  hypothetical protein SELMODRAFT_7940             84.0    5e-17   
ref|XP_009346519.1|  PREDICTED: conserved oligomeric Golgi comple...  89.4    9e-17   Pyrus x bretschneideri [bai li]
ref|XP_011401872.1|  Conserved oligomeric Golgi complex subunit 2     89.0    1e-16   Auxenochlorella protothecoides
gb|KFO34216.1|  Conserved oligomeric Golgi complex subunit 2          88.6    2e-16   Fukomys damarensis [Damara mole rat]
ref|XP_010620223.1|  PREDICTED: conserved oligomeric Golgi comple...  88.2    2e-16   Fukomys damarensis [Damara mole rat]
ref|XP_006652018.1|  PREDICTED: conserved oligomeric Golgi comple...  87.8    3e-16   Oryza brachyantha
ref|XP_005106374.1|  PREDICTED: conserved oligomeric Golgi comple...  87.4    5e-16   
ref|XP_002113217.1|  hypothetical protein TRIADDRAFT_26404            86.7    1e-15   Trichoplax adhaerens
ref|XP_002931527.2|  PREDICTED: conserved oligomeric Golgi comple...  86.3    1e-15   Xenopus tropicalis [western clawed frog]
ref|XP_004914700.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    1e-15   Xenopus tropicalis [western clawed frog]
ref|XP_010996258.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    1e-15   Camelus dromedarius [camel]
ref|XP_007936688.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    2e-15   Orycteropus afer afer
ref|XP_005405048.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    2e-15   Chinchilla lanigera
ref|XP_005405049.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    2e-15   
ref|XP_006212446.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  85.5    2e-15   
ref|XP_009055731.1|  hypothetical protein LOTGIDRAFT_232605           85.5    2e-15   Lottia gigantea
ref|XP_003410940.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   Loxodonta africana [African bush elephant]
ref|XP_004342492.2|  hypothetical protein CAOG_08237                  85.5    3e-15   Capsaspora owczarzaki ATCC 30864
ref|XP_005226618.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   Bos taurus [bovine]
ref|NP_001070307.2|  conserved oligomeric Golgi complex subunit 2     85.1    3e-15   Bos taurus [bovine]
ref|XP_002717435.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   Oryctolagus cuniculus [domestic rabbit]
ref|XP_010852805.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   Bison bison bison
ref|XP_010852806.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   Bison bison bison
ref|XP_004028611.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   
ref|XP_001148147.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   Pan troglodytes
ref|XP_002809356.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   
ref|XP_004898237.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    3e-15   
ref|XP_009439912.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    3e-15   Pan troglodytes
ref|XP_008984063.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    3e-15   Callithrix jacchus [common marmoset]
ref|XP_010372341.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Rhinopithecus roxellana
ref|NP_031383.1|  conserved oligomeric Golgi complex subunit 2 is...  84.7    4e-15   Homo sapiens [man]
ref|NP_001138508.1|  conserved oligomeric Golgi complex subunit 2...  84.7    4e-15   Homo sapiens [man]
ref|XP_002760957.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Callithrix jacchus [common marmoset]
ref|XP_010372342.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Rhinopithecus roxellana
ref|XP_005320438.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Ictidomys tridecemlineatus
ref|XP_004372879.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Trichechus manatus latirostris
ref|XP_005005280.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   
ref|XP_006817460.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Saccoglossus kowalevskii
ref|XP_003473537.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   
ref|XP_006937851.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Felis catus [cat]
ref|XP_003993981.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    4e-15   Felis catus [cat]
ref|XP_006888781.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    5e-15   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005539861.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    5e-15   
ref|XP_003893831.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    5e-15   Papio anubis [baboon]
ref|XP_002808309.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  84.3    5e-15   Macaca mulatta [rhesus macaque]
ref|XP_004426945.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    5e-15   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007450662.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    6e-15   Lipotes vexillifer [baiji]
ref|XP_007450661.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    6e-15   Lipotes vexillifer [baiji]
ref|XP_006065100.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    6e-15   Bubalus bubalis [domestic water buffalo]
ref|XP_006065101.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    6e-15   Bubalus bubalis [domestic water buffalo]
ref|XP_004310291.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    6e-15   
ref|XP_010196213.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    7e-15   Colius striatus
ref|XP_005958561.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    7e-15   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006531536.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    7e-15   
ref|XP_010196214.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    7e-15   Colius striatus
ref|XP_005958562.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    7e-15   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008687758.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    8e-15   Ursus maritimus [white bear]
ref|XP_008687757.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    8e-15   Ursus maritimus [white bear]
ref|XP_002927656.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    8e-15   Ailuropoda melanoleuca
dbj|BAE34057.1|  unnamed protein product                              83.2    8e-15   Mus musculus [mouse]
ref|XP_004640874.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    8e-15   Octodon degus
ref|XP_004281614.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    8e-15   Orcinus orca [Orca]
ref|XP_011233523.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    8e-15   Ailuropoda melanoleuca
ref|XP_005602674.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    8e-15   
ref|XP_001497419.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    8e-15   Equus caballus [domestic horse]
dbj|BAE42634.1|  unnamed protein product                              83.6    8e-15   Mus musculus [mouse]
ref|XP_004640875.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    9e-15   Octodon degus
ref|XP_005602673.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    9e-15   Equus caballus [domestic horse]
ref|XP_004404911.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    9e-15   Odobenus rosmarus divergens
ref|NP_084022.2|  conserved oligomeric Golgi complex subunit 2        83.6    9e-15   Mus musculus [mouse]
gb|AAH11435.1|  Component of oligomeric golgi complex 2               83.6    9e-15   Mus musculus [mouse]
gb|EDL11770.1|  component of oligomeric golgi complex 2               83.6    9e-15   Mus musculus [mouse]
dbj|BAC40996.1|  unnamed protein product                              83.6    9e-15   Mus musculus [mouse]
ref|XP_005291293.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    1e-14   Chrysemys picta bellii
ref|XP_010705329.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    1e-14   Meleagris gallopavo [common turkey]
ref|XP_004935546.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    1e-14   
ref|XP_004659682.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    1e-14   Jaculus jaculus
ref|XP_419583.2|  PREDICTED: conserved oligomeric Golgi complex s...  83.2    1e-14   Gallus gallus [bantam]
ref|XP_004690717.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    1e-14   
gb|ELR48452.1|  Conserved oligomeric Golgi complex subunit 2          83.2    1e-14   Bos mutus
ref|XP_006146049.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    1e-14   Tupaia chinensis
ref|XP_005906657.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    1e-14   Bos mutus
ref|XP_003940815.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    1e-14   Saimiri boliviensis boliviensis
ref|XP_004458735.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    1e-14   
ref|XP_008844006.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    1e-14   Nannospalax galili
ref|XP_004021628.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  82.8    2e-14   
ref|XP_007987957.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    2e-14   Chlorocebus sabaeus
ref|XP_005699448.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  82.8    2e-14   
ref|XP_008156867.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    2e-14   
ref|XP_006255878.1|  PREDICTED: conserved oligomeric Golgi comple...  82.4    2e-14   Rattus norvegicus [brown rat]
ref|NP_001103964.1|  conserved oligomeric Golgi complex subunit 2     82.4    3e-14   Rattus norvegicus [brown rat]
gb|ERE80256.1|  conserved oligomeric Golgi complex subunit 2          82.0    3e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_003496865.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    3e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_007086077.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    3e-14   Panthera tigris altaica
ref|XP_005064728.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    3e-14   Mesocricetus auratus [Syrian golden hamster]
ref|XP_794127.3|  PREDICTED: conserved oligomeric Golgi complex s...  82.0    3e-14   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006106578.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    3e-14   Myotis lucifugus
ref|XP_007256131.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    3e-14   
ref|XP_005539862.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    4e-14   Macaca fascicularis [crab eating macaque]
gb|ELU10240.1|  hypothetical protein CAPTEDRAFT_184924                80.5    4e-14   Capitella teleta
ref|XP_004619081.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    4e-14   Sorex araneus [Eurasian shrew]
ref|XP_006992872.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    4e-14   Peromyscus maniculatus bairdii
ref|XP_007127671.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    4e-14   
ref|XP_003791030.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    5e-14   Otolemur garnettii
ref|XP_007173849.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    5e-14   Balaenoptera acutorostrata scammoni
ref|XP_005539859.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    5e-14   Macaca fascicularis [crab eating macaque]
ref|XP_004077119.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  81.3    5e-14   
ref|NP_998519.1|  conserved oligomeric Golgi complex subunit 2        81.3    6e-14   Danio rerio [leopard danio]
ref|XP_546096.2|  PREDICTED: conserved oligomeric Golgi complex s...  80.9    6e-14   
gb|ELT94120.1|  hypothetical protein CAPTEDRAFT_214095                80.9    7e-14   Capitella teleta
ref|XP_007903669.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    8e-14   Callorhinchus milii [Australian ghost shark]
ref|XP_010887016.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    8e-14   Esox lucius
ref|XP_005518612.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    8e-14   
ref|XP_005518611.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    8e-14   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_010219183.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    8e-14   Tinamus guttatus
ref|XP_006267974.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    9e-14   Alligator mississippiensis
ref|XP_004819666.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  80.5    1e-13   
ref|XP_010560974.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    1e-13   Haliaeetus leucocephalus
ref|XP_010192959.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    1e-13   Mesitornis unicolor
ref|XP_007535190.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    1e-13   Erinaceus europaeus [common hedgehog]
ref|XP_007535191.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Erinaceus europaeus [common hedgehog]
gb|EFB20161.1|  hypothetical protein PANDA_017452                     80.1    1e-13   Ailuropoda melanoleuca
ref|XP_005440305.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   
ref|XP_007535189.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Erinaceus europaeus [common hedgehog]
ref|XP_005440304.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Falco cherrug
ref|XP_010192960.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Mesitornis unicolor
ref|XP_001176329.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-13   
gb|ETE65446.1|  Conserved oligomeric Golgi complex subunit 2          80.1    1e-13   Ophiophagus hannah
ref|XP_010787277.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006017038.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   
ref|XP_006017037.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Alligator sinensis
ref|XP_010741537.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   
ref|XP_003767876.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Sarcophilus harrisii
ref|XP_007903668.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Callorhinchus milii [Australian ghost shark]
gb|ELK34853.1|  Conserved oligomeric Golgi complex subunit 2          80.1    1e-13   Myotis davidii
ref|XP_009565361.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   Cuculus canorus
ref|XP_001369328.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    2e-13   Monodelphis domestica
ref|XP_009565362.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    2e-13   Cuculus canorus
ref|XP_005345929.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    2e-13   Microtus ochrogaster [prairie voles]
gb|EDL96730.1|  rCG50865, isoform CRA_a                               75.9    2e-13   Rattus norvegicus [brown rat]
ref|XP_009091144.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    2e-13   
ref|XP_002190632.2|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   
ref|XP_004712259.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_006757736.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   
ref|XP_008319780.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    2e-13   
ref|XP_007423722.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Python bivittatus
ref|XP_005148647.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Melopsittacus undulatus
ref|XP_005148648.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Melopsittacus undulatus
ref|XP_002501700.1|  predicted protein                                79.3    3e-13   Micromonas commoda
ref|XP_010389860.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    3e-13   
gb|EOB00851.1|  Conserved oligomeric Golgi complex subunit 2          79.0    3e-13   Anas platyrhynchos [duck]
ref|XP_005020290.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    3e-13   
ref|XP_001640558.1|  predicted protein                                79.0    3e-13   Nematostella vectensis
ref|XP_010120051.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-13   Chlamydotis macqueenii
gb|KFW80703.1|  Conserved oligomeric Golgi complex subunit 2          79.0    3e-13   Manacus vitellinus
ref|XP_008921822.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    3e-13   
gb|EMP25136.1|  Conserved oligomeric Golgi complex subunit 2          79.0    3e-13   Chelonia mydas [green seaturtle]
ref|XP_008921823.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    3e-13   
emb|CDQ63736.1|  unnamed protein product                              78.6    3e-13   Oncorhynchus mykiss
ref|XP_006920806.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    4e-13   
ref|NP_001133098.1|  conserved oligomeric Golgi complex subunit 2     78.6    4e-13   Salmo salar
ref|XP_009583051.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    4e-13   Fulmarus glacialis
ref|XP_009921343.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    4e-13   Haliaeetus albicilla
ref|XP_009904610.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    4e-13   Picoides pubescens
ref|XP_005508688.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   
ref|XP_005508687.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   Columba livia [carrier pigeon]
ref|XP_009642480.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   Egretta garzetta
ref|XP_008944103.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   Merops nubicus
ref|XP_009697273.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   Cariama cristata
gb|KFQ34940.1|  Conserved oligomeric Golgi complex subunit 2          78.2    5e-13   Merops nubicus
gb|KFP64444.1|  Conserved oligomeric Golgi complex subunit 2          78.2    5e-13   Cariama cristata
ref|XP_005491190.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   
ref|XP_011379200.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    6e-13   
ref|XP_009490364.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    6e-13   
gb|KIK99406.1|  hypothetical protein PAXRUDRAFT_822754                78.2    6e-13   
gb|KFW03254.1|  Conserved oligomeric Golgi complex subunit 2          78.2    6e-13   
gb|KFQ57781.1|  Conserved oligomeric Golgi complex subunit 2          78.2    6e-13   
gb|KGL81598.1|  Conserved oligomeric Golgi complex subunit 2          78.2    6e-13   
gb|KFP90068.1|  Conserved oligomeric Golgi complex subunit 2          77.8    6e-13   
ref|XP_009870043.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    6e-13   
ref|XP_009889458.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    7e-13   
ref|XP_009952277.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    8e-13   
gb|KFV53940.1|  Conserved oligomeric Golgi complex subunit 2          77.4    8e-13   
ref|XP_006122076.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    8e-13   
gb|KFO92943.1|  Conserved oligomeric Golgi complex subunit 2          77.4    8e-13   
ref|XP_010139618.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    8e-13   
gb|KFP99616.1|  Conserved oligomeric Golgi complex subunit 2          77.0    8e-13   
ref|XP_005043524.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    8e-13   
gb|KFQ83089.1|  Conserved oligomeric Golgi complex subunit 2          77.4    8e-13   
ref|XP_010285455.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    8e-13   
ref|XP_003963810.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    8e-13   
ref|XP_009967210.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    8e-13   
gb|KFZ60054.1|  Conserved oligomeric Golgi complex subunit 2          77.4    8e-13   
ref|XP_005239169.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    8e-13   
gb|KFP94737.1|  Conserved oligomeric Golgi complex subunit 2          77.4    8e-13   
gb|KFO15367.1|  Conserved oligomeric Golgi complex subunit 2          77.4    9e-13   
ref|XP_009327513.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    9e-13   
ref|XP_009469603.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    9e-13   
gb|KFR13493.1|  Conserved oligomeric Golgi complex subunit 2          77.4    9e-13   
gb|KFW70739.1|  Conserved oligomeric Golgi complex subunit 2          77.4    1e-12   
gb|KFQ91617.1|  Conserved oligomeric Golgi complex subunit 2          77.4    1e-12   
gb|KFP20406.1|  Conserved oligomeric Golgi complex subunit 2          77.4    1e-12   
ref|XP_010147792.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    1e-12   
ref|XP_009280091.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    1e-12   
ref|XP_005423302.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    1e-12   
ref|XP_010309769.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    1e-12   
ref|XP_009499491.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
ref|XP_009936334.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    1e-12   
ref|XP_010961140.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
gb|KFW89140.1|  Conserved oligomeric Golgi complex subunit 2          77.0    1e-12   
ref|XP_005856448.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
ref|XP_007545451.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
ref|XP_005994005.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
gb|KFM09209.1|  Conserved oligomeric Golgi complex subunit 2          77.0    1e-12   
ref|XP_005994007.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
ref|XP_005812226.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
ref|XP_008427499.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   
gb|KFU94611.1|  Conserved oligomeric Golgi complex subunit 2          76.3    2e-12   
gb|KFV73661.1|  Conserved oligomeric Golgi complex subunit 2          76.3    2e-12   
ref|XP_010002540.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   
ref|XP_003062630.1|  predicted protein                                76.3    2e-12   
gb|KFV07773.1|  Conserved oligomeric Golgi complex subunit 2          76.3    2e-12   
ref|XP_009076851.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    2e-12   
gb|KFO53927.1|  Conserved oligomeric Golgi complex subunit 2          76.3    2e-12   
ref|XP_010072831.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   
ref|XP_008641602.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   
ref|XP_007662934.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12   
gb|KGL98152.1|  Conserved oligomeric Golgi complex subunit 2          75.9    3e-12   
ref|XP_009679359.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    3e-12   
gb|KFQ55583.1|  Conserved oligomeric Golgi complex subunit 2          75.9    3e-12   
emb|CDH54966.1|  conserved oligomeric golgi complex subunit 2         74.7    3e-12   
ref|XP_010019366.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-12   
ref|XP_003438334.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-12   
dbj|GAN06528.1|  conserved oligomeric Golgi complex subunit 2         75.9    3e-12   
ref|XP_008289216.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-12   
emb|CDH54965.1|  conserved oligomeric golgi complex subunit 2         75.5    3e-12   
gb|KFV39876.1|  Conserved oligomeric Golgi complex subunit 2          75.5    3e-12   
ref|XP_009811854.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   
emb|CDH54964.1|  conserved oligomeric golgi complex subunit 2         75.5    4e-12   
gb|EMT13194.1|  Putative oligomeric Golgi complex subunit 2           74.7    7e-12   
emb|CDS10439.1|  hypothetical protein LRAMOSA03115                    74.7    7e-12   
gb|EMS58136.1|  Oligomeric Golgi complex subunit 2                    74.3    8e-12   
ref|XP_003230176.2|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_010168389.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11   
gb|KFZ60236.1|  Conserved oligomeric Golgi complex subunit 2          73.6    2e-11   
ref|XP_001746771.1|  hypothetical protein                             73.2    2e-11   
ref|XP_005658376.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    3e-11   
ref|XP_006783764.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    3e-11   
ref|XP_001416921.1|  predicted protein                                72.8    3e-11   
gb|KFH70203.1|  hypothetical protein MVEG_05005                       72.8    3e-11   
ref|XP_005914260.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    3e-11   
dbj|BAB28112.1|  unnamed protein product                              68.2    4e-11   
ref|XP_005727467.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    6e-11   
gb|EXX78374.1|  hypothetical protein RirG_015560                      72.0    6e-11   
emb|CAG10093.1|  unnamed protein product                              72.0    6e-11   
ref|XP_004551557.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    6e-11   
ref|XP_005833841.1|  component of oligomeric golgi complex 2          71.6    7e-11   
ref|XP_005833842.1|  hypothetical protein GUITHDRAFT_137858           71.6    8e-11   
ref|XP_002994388.1|  hypothetical protein SELMODRAFT_138550           65.5    1e-10   
ref|XP_002991260.1|  hypothetical protein SELMODRAFT_133213           65.5    1e-10   
ref|XP_006183788.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10   
emb|CEI90864.1|  hypothetical protein RMCBS344292_05174               70.1    2e-10   
emb|CDS32998.1|  oligomeric Golgi complex subunit 2                   70.1    2e-10   
ref|XP_004028612.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    2e-10   
dbj|BAH12018.1|  unnamed protein product                              70.1    2e-10   
emb|CBY15298.1|  unnamed protein product                              69.7    2e-10   
ref|XP_003267296.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    2e-10   
ref|XP_005226619.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10   
ref|XP_008072546.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10   
ref|XP_006065102.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10   
gb|KDR75857.1|  hypothetical protein GALMADRAFT_248589                68.6    6e-10   
ref|XP_007071120.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    7e-10   
ref|XP_005727466.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09   
ref|XP_002402131.1|  conserved oligomeric golgi complex subunit, ...  67.8    1e-09   
gb|EPB84205.1|  hypothetical protein HMPREF1544_08997                 67.8    1e-09   
ref|XP_007006688.1|  hypothetical protein TREMEDRAFT_33755            67.4    2e-09   
gb|KIY73086.1|  COG complex component                                 67.4    2e-09   
emb|CEI93171.1|  hypothetical protein RMCBS344292_07411               67.0    2e-09   
gb|KDD72303.1|  hypothetical protein H632_c3541p0                     62.8    3e-09   
emb|CCO27036.1|  Conserved oligomeric Golgi complex subunit 2 Sho...  66.6    3e-09   
ref|XP_005005281.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09   
emb|CEL61003.1|  Conserved oligomeric Golgi complex subunit 2 OS=...  66.6    3e-09   
ref|XP_011065546.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09   
ref|XP_008589656.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09   
emb|CBN77515.1|  weakly similar to brefeldin A-sensitive Golgi pr...  65.5    7e-09   
ref|XP_002132051.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    9e-09   
ref|XP_011343716.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    9e-09   
ref|XP_011404805.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    9e-09   
gb|KDN46181.1|  hypothetical protein RSAG8_04408                      65.1    1e-08   
ref|XP_002055957.1|  GJ10669                                          65.1    1e-08   
gb|KIO31284.1|  hypothetical protein M407DRAFT_68051                  65.1    1e-08   
gb|EFX66827.1|  hypothetical protein DAPPUDRAFT_331703                64.7    1e-08   
gb|EZA51235.1|  Conserved oligomeric Golgi complex subunit            64.7    1e-08   
gb|EKD00667.1|  hypothetical protein A1Q2_05027                       64.7    1e-08   
gb|ELU42478.1|  COG2 domain-containing protein                        64.7    1e-08   
ref|XP_001830600.2|  hypothetical protein CC1G_06866                  64.7    1e-08   
gb|KIJ67824.1|  hypothetical protein HYDPIDRAFT_37422                 64.3    2e-08   
ref|XP_009025253.1|  hypothetical protein HELRODRAFT_95171            64.3    2e-08   
ref|XP_002999266.1|  conserved oligomeric Golgi complex subunit, ...  64.3    2e-08   
gb|EJT49997.1|  hypothetical protein A1Q1_00838                       64.3    2e-08   
ref|XP_011310005.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08   
ref|XP_011169059.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08   
ref|XP_001604062.2|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08   
emb|CEG65576.1|  hypothetical protein RMATCC62417_02333               63.5    2e-08   
gb|KIM40094.1|  hypothetical protein M413DRAFT_28624                  63.9    2e-08   
ref|XP_006461130.1|  hypothetical protein AGABI2DRAFT_68876           63.5    3e-08   
gb|ETO78126.1|  hypothetical protein F444_06786                       63.5    3e-08   
gb|ETK89268.1|  hypothetical protein L915_06592                       63.5    3e-08   
gb|ETI49393.1|  hypothetical protein F443_06719                       63.5    3e-08   
gb|ETP47094.1|  hypothetical protein F442_06755                       63.5    3e-08   
gb|ETP19166.1|  hypothetical protein F441_06722                       63.5    3e-08   
ref|XP_007327986.1|  hypothetical protein AGABI1DRAFT_36770           63.5    3e-08   
gb|EUB58416.1|  Conserved oligomeric Golgi complex subunit 2          63.2    4e-08   
ref|XP_008892343.1|  hypothetical protein PPTG_02808                  63.2    4e-08   
gb|ETL95872.1|  hypothetical protein L917_06400                       63.2    4e-08   
ref|XP_006678760.1|  hypothetical protein BATDEDRAFT_88024            63.2    4e-08   
ref|XP_007843565.1|  conserved oligomeric golgi complex subunit 2...  63.2    4e-08   
dbj|GAA29452.2|  conserved oligomeric Golgi complex subunit 2         63.2    4e-08   
emb|CCL98683.1|  predicted protein                                    62.8    5e-08   
gb|KIJ18679.1|  hypothetical protein PAXINDRAFT_71226                 62.8    5e-08   
ref|XP_011505049.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    6e-08   
gb|KJA19881.1|  hypothetical protein HYPSUDRAFT_56318                 62.4    6e-08   
ref|XP_011265596.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    7e-08   
emb|CDR01100.1|  unnamed protein product                              58.2    1e-07   
ref|XP_010852807.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07   
ref|XP_010819003.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07   
gb|KDQ28122.1|  hypothetical protein PLEOSDRAFT_44979                 61.6    1e-07   
gb|AAX27255.2|  SJCHGC05960 protein                                   60.5    2e-07   
ref|XP_001877745.1|  predicted protein                                60.8    2e-07   
gb|EUC64334.1|  COG (oligomeric) complex component, COG2 protein      60.8    2e-07   
ref|XP_002020009.1|  GL13754                                          60.5    3e-07   
ref|XP_001357922.2|  GA19413                                          60.5    3e-07   
ref|XP_007308237.1|  COG complex component                            60.1    4e-07   
ref|XP_007266642.1|  COG complex component                            60.1    4e-07   
ref|XP_007864372.1|  hypothetical protein GLOTRDRAFT_137615           60.1    4e-07   
gb|KIW45904.1|  hypothetical protein PV06_01610                       58.9    6e-07   
gb|EPY81957.1|  hypothetical protein CB1_000692029                    58.9    8e-07   
gb|KEP55438.1|  hypothetical protein V565_005200                      59.3    9e-07   
ref|XP_002475542.1|  predicted protein                                58.9    9e-07   
ref|XP_003078128.1|  Low density lipoprotein receptor (ISS)           58.9    1e-06   
ref|XP_002001325.1|  GI10726                                          58.9    1e-06   
gb|KDR16768.1|  Conserved oligomeric Golgi complex subunit 2          58.5    1e-06   
gb|KIP06987.1|  hypothetical protein PHLGIDRAFT_24293                 58.5    1e-06   
ref|XP_009176275.1|  hypothetical protein T265_11373                  58.5    2e-06   
ref|XP_003700579.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    2e-06   
ref|XP_773511.1|  hypothetical protein CNBI1250                       58.2    2e-06   
ref|XP_568093.1|  hypothetical protein                                58.2    2e-06   
gb|AFR94326.1|  hypothetical protein CNAG_05062                       58.2    2e-06   
gb|KIM75524.1|  hypothetical protein PILCRDRAFT_827237                58.2    2e-06   
gb|KIK01394.1|  hypothetical protein K443DRAFT_98669                  58.2    2e-06   
ref|XP_011146882.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    2e-06   
ref|XP_002031072.1|  GM25778                                          57.8    2e-06   
ref|XP_011146883.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    2e-06   
ref|XP_003487887.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    3e-06   
gb|AAD31443.1|  ldlCp-related protein                                 57.4    3e-06   
ref|XP_008551454.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    4e-06   
ref|XP_003399042.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    4e-06   
ref|XP_009829212.1|  hypothetical protein H257_05897                  57.0    4e-06   
ref|XP_007767120.1|  COG complex component                            57.0    4e-06   
ref|XP_009155418.1|  hypothetical protein HMPREF1120_03116            56.2    5e-06   
ref|XP_007381453.1|  COG complex component                            57.0    5e-06   
gb|EGN99740.1|  hypothetical protein SERLA73DRAFT_72536               57.0    5e-06   
emb|CDJ03842.1|  oligomeric Golgi complex subunit 2                   56.6    5e-06   
ref|XP_002069920.1|  GK11309                                          56.6    6e-06   
ref|XP_010560975.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    6e-06   
ref|XP_310386.6|  AGAP003824-PA                                       56.6    6e-06   
ref|XP_001980050.1|  GG20618                                          56.6    6e-06   
ref|XP_002097746.1|  GE26383                                          56.6    6e-06   
ref|NP_524366.1|  ldlCp-related protein                               56.6    6e-06   
gb|KIY46789.1|  COG complex component                                 56.6    7e-06   
gb|AAL48584.1|  RE06205p                                              56.6    7e-06   
ref|XP_007369627.1|  COG complex component                            55.8    1e-05   
gb|KGB40811.1|  Conserved oligomeric Golgi complex subunit 2          55.8    1e-05   
ref|XP_003889734.1|  hypothetical protein PGTG_21581                  55.5    1e-05   
emb|CEP12983.1|  hypothetical protein                                 55.5    1e-05   
dbj|GAA88227.1|  similar to An09g05990                                55.1    1e-05   
gb|KDE09412.1|  hypothetical protein MVLG_00317                       55.5    1e-05   
ref|XP_007423723.1|  PREDICTED: conserved oligomeric Golgi comple...  55.5    1e-05   
gb|EMD37937.1|  hypothetical protein CERSUDRAFT_50066                 55.5    2e-05   
emb|CEG65577.1|  hypothetical protein RMATCC62417_02333               55.1    2e-05   
emb|CEG65575.1|  hypothetical protein RMATCC62417_02333               55.1    2e-05   
ref|XP_747986.1|  conserved hypothetical protein                      54.7    2e-05   
ref|XP_004350660.1|  oligomeric Golgi complex component               55.1    2e-05   
gb|KIN96230.1|  hypothetical protein M404DRAFT_1006980                55.1    2e-05   
gb|EDP51206.1|  conserved hypothetical protein                        54.7    2e-05   
emb|CDS16325.1|  oligomeric Golgi complex subunit 2                   54.7    3e-05   
ref|XP_003029812.1|  hypothetical protein SCHCODRAFT_69641            54.7    3e-05   
gb|EHA28546.1|  hypothetical protein ASPNIDRAFT_125515                53.9    3e-05   
ref|XP_001994381.1|  GH16862                                          54.3    4e-05   
gb|EPT04594.1|  hypothetical protein FOMPIDRAFT_1140249               53.9    5e-05   
ref|XP_008726234.1|  hypothetical protein G647_03667                  53.1    5e-05   
gb|EHJ70342.1|  putative brefeldin A-sensitive peripheral Golgi p...  53.5    5e-05   



>ref|XP_006357074.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Solanum tuberosum]
Length=742

 Score =   303 bits (775),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 178/215 (83%), Gaps = 21/215 (10%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APPRSATDLFGDPTD NPPQWLNP LF S+DFD E+YISDLRTFVPL+TLRSELRSH +S
Sbjct  17   APPRSATDLFGDPTDPNPPQWLNPTLFQSQDFDPESYISDLRTFVPLETLRSELRSHFTS  76

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            LQRDLVDLINRDYADFVSLSTKLTDVDA+VVRMRAPL EIR KI  FR AVE SL+AL +
Sbjct  77   LQRDLVDLINRDYADFVSLSTKLTDVDASVVRMRAPLFEIREKIDGFRNAVEGSLAALQN  136

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
            RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSG T+                   
Sbjct  137  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGQTD-------------------  177

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
              + E GSNLRETQSM LERIASEMNRLKFYI+HA
Sbjct  178  --YVESGSNLRETQSMLLERIASEMNRLKFYISHA  210



>ref|XP_004244508.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Solanum 
lycopersicum]
Length=742

 Score =   303 bits (775),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 183/231 (79%), Gaps = 23/231 (10%)
 Frame = +2

Query  26   MTDLHS--PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTF  199
            M DL S  P    +  APPRSATDLFGDPTD NPPQWLNP LF S+DFD E+YISDLRTF
Sbjct  1    MQDLQSLPPPSPQSTHAPPRSATDLFGDPTDPNPPQWLNPTLFQSQDFDPESYISDLRTF  60

Query  200  VPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKI  379
            VPL+TLRSELRSH +SLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPL EIR KI
Sbjct  61   VPLETLRSELRSHFTSLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLFEIREKI  120

Query  380  STFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLAN  559
              FR AVE SL+AL +RLKQRADA EAREVLELLLDTFHVVSKVEKLIKELPSG T+   
Sbjct  121  DGFRNAVEGSLAALQNRLKQRADAVEAREVLELLLDTFHVVSKVEKLIKELPSGQTD---  177

Query  560  GIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                              + E GSNLRETQSM LERIASEMNRLKFYI+HA
Sbjct  178  ------------------YVESGSNLRETQSMLLERIASEMNRLKFYISHA  210



>ref|XP_009769044.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
sylvestris]
Length=751

 Score =   303 bits (775),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 189/232 (81%), Gaps = 16/232 (7%)
 Frame = +2

Query  26   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  205
            M DL SP   S   AP RSA DLFGDP+D NPPQWLNP LF S+DFD E+YISDLRTFVP
Sbjct  1    MQDLQSPPPQSAHAAP-RSAADLFGDPSDPNPPQWLNPTLFQSQDFDPESYISDLRTFVP  59

Query  206  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  385
            L+TLRSELRSH +SLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPL+EIR KI  
Sbjct  60   LETLRSELRSHFTSLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLVEIRDKIDA  119

Query  386  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANG-  562
            FR AVE SL+AL +RLKQRADA EAR+VLELLLDTFHVVSKVEKLIKELP  A +L+NG 
Sbjct  120  FRNAVEGSLAALQNRLKQRADAAEARQVLELLLDTFHVVSKVEKLIKELP--AADLSNGH  177

Query  563  IANYADNGYLSNGVSFQHTEKGSN--LRETQSMHLERIASEMNRLKFYIAHA  712
              NYA+NG           E GSN  LRETQSM LERIASEMNRLKFYIAHA
Sbjct  178  DVNYAENG----------IETGSNLSLRETQSMLLERIASEMNRLKFYIAHA  219



>ref|XP_009602477.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
tomentosiformis]
Length=751

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 189/232 (81%), Gaps = 16/232 (7%)
 Frame = +2

Query  26   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  205
            M DL SP   S   AP RSA DLFGDP+D NPPQWLNP LF S+DFD E+YISDLRTFVP
Sbjct  1    MQDLQSPPPQSAHAAP-RSAADLFGDPSDPNPPQWLNPTLFQSQDFDPESYISDLRTFVP  59

Query  206  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  385
            L+TLRSELRSH +SLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPL+EIR KI  
Sbjct  60   LETLRSELRSHFTSLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLVEIRDKIDA  119

Query  386  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANG-  562
            FR AVE SL+AL +RLKQRADA EAR+VLELLLDTFHVVSKVEKLIKELP  A +L+NG 
Sbjct  120  FRHAVEGSLAALQNRLKQRADAAEARQVLELLLDTFHVVSKVEKLIKELP--AADLSNGH  177

Query  563  IANYADNGYLSNGVSFQHTEKGSNL--RETQSMHLERIASEMNRLKFYIAHA  712
              NYA+NG           E GS+L  RETQSM LERIASEMNRLKFYIAHA
Sbjct  178  DVNYAENG----------IETGSSLSMRETQSMLLERIASEMNRLKFYIAHA  219



>ref|XP_011083848.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sesamum 
indicum]
Length=757

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 181/228 (79%), Gaps = 8/228 (4%)
 Frame = +2

Query  29   TDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPL  208
            TDLHSP         P+SATDLFGDP +   P WLNP  F   +FD E+YISDLRTFVP 
Sbjct  3    TDLHSPL--------PKSATDLFGDPIEDTHPLWLNPSKFSDPEFDPESYISDLRTFVPF  54

Query  209  DTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTF  388
            DTLRSELRSHL +L+ +LV+LINRDY DFVSLSTKL DVDAAVVRMRAPLLE++ KI  F
Sbjct  55   DTLRSELRSHLGALKHELVELINRDYVDFVSLSTKLVDVDAAVVRMRAPLLEVKEKILAF  114

Query  389  REAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIA  568
            R +VE SL+AL SRLKQRA A EAREVLELLLDTFHVVSKVEKLIKELP+   + ++G  
Sbjct  115  RGSVEGSLTALQSRLKQRAQANEAREVLELLLDTFHVVSKVEKLIKELPTVPADWSSGTL  174

Query  569  NYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            N  + G LSNG+SFQH E G+NLRETQSM LERIASEMNRLKFYIA A
Sbjct  175  NSTEKGQLSNGISFQHAENGANLRETQSMLLERIASEMNRLKFYIAQA  222



>gb|EYU23123.1| hypothetical protein MIMGU_mgv1a001829mg [Erythranthe guttata]
Length=753

 Score =   290 bits (742),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 183/228 (80%), Gaps = 8/228 (4%)
 Frame = +2

Query  29   TDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPL  208
            TDLHSP         P+SATDLFGDP + + P WLNP  F   +FD E+YISDLRTFVP 
Sbjct  3    TDLHSPL--------PKSATDLFGDPIEDSHPLWLNPSKFTDAEFDPESYISDLRTFVPF  54

Query  209  DTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTF  388
            DTLRSELRSHL +L+ +LV+LINRDY DFVSLSTKL DV+AAVVRMRAPLLEI+ KI  F
Sbjct  55   DTLRSELRSHLGALKHELVELINRDYVDFVSLSTKLVDVEAAVVRMRAPLLEIKEKILDF  114

Query  389  REAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIA  568
            R +V+ SL+AL SRLKQR+ A EAREVLELLLDTFHVVSKVEKLIKELPS   + ++G  
Sbjct  115  RGSVDISLAALQSRLKQRSQANEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSSGAM  174

Query  569  NYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            +  + G LSNG+SFQH+E G++LRETQSM LERIASEMNRLKFYI HA
Sbjct  175  SSTEKGQLSNGISFQHSENGTSLRETQSMLLERIASEMNRLKFYITHA  222



>emb|CDP04651.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            DLFGDP D+ PP WLNP  F+ ++FD E+YISDLRTFVP +TLRSEL+SHLSSLQR+LVD
Sbjct  24   DLFGDPVDSYPP-WLNPTAFVDQEFDPESYISDLRTFVPFETLRSELQSHLSSLQRELVD  82

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDY+DFVSLSTKL D+DA+VVRMRAPLL+I+ KI  FR AV++SLSAL SRLKQRAD
Sbjct  83   LINRDYSDFVSLSTKLIDIDASVVRMRAPLLDIKEKILAFRGAVDASLSALKSRLKQRAD  142

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKG  628
            A + REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A   +LSNG+S QH E  
Sbjct  143  ANQTREVLELLLDTFHVVSKVEKLIKELPSIPVDWSNGYVNSASKDHLSNGISLQHIENS  202

Query  629  SNLRETQSMHLERIASEMNRLKFYIAHA  712
            ++LRETQSM LERIASEMNRLKFYI HA
Sbjct  203  TSLRETQSMLLERIASEMNRLKFYITHA  230



>ref|XP_008374256.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             AP RSA DLF DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+ +L+
Sbjct  6    AAPHRSAADLFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQCYLA  64

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALT  124

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  604
            + LKQR++A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLKQRSEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSISNGA  184

Query  605  SFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            S QHTE G+NLR+TQSM LERIASEMNRLKFY AHA
Sbjct  185  SLQHTENGTNLRDTQSMLLERIASEMNRLKFYFAHA  220



>ref|XP_010105239.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
 gb|EXC04126.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
Length=708

 Score =   280 bits (717),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 176/215 (82%), Gaps = 1/215 (0%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            A PRSATDLF DP D +P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSEL+S+LSS
Sbjct  7    ALPRSATDLFADPLDGHP-LWFKPELFLSPNFDSESYISELRTFVPFDTLRSELQSYLSS  65

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L  +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +VE +L AL +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVEGALVALKN  125

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
             LKQR+DA  AREVLELLLDTFHVVSKVEKLIKELP+  ++ +NG  N A+   LSNG S
Sbjct  126  GLKQRSDAASAREVLELLLDTFHVVSKVEKLIKELPTVPSDWSNGDDNLAEKNSLSNGTS  185

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             QH E G+NLRETQSM LERIASEMNRLKFYIA A
Sbjct  186  LQHAESGTNLRETQSMLLERIASEMNRLKFYIAPA  220



>ref|XP_007210583.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
 gb|EMJ11782.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
Length=718

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 178/215 (83%), Gaps = 1/215 (0%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            AP R+ATD F DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+S+L+S
Sbjct  7    APHRTATDFFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQSYLAS  65

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALTN  125

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
             LKQR++A EAREVLELLLDTFHVVSKVEKLI+ELPS   +  NG  N A+  +++NG S
Sbjct  126  GLKQRSEANEAREVLELLLDTFHVVSKVEKLIQELPSVPADWLNGDVNLAEKNFITNGTS  185

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             QH E G+NLR+TQSM LERIASEMNRLKFYIAHA
Sbjct  186  LQHVENGTNLRDTQSMLLERIASEMNRLKFYIAHA  220



>ref|XP_004164803.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Cucumis sativus]
Length=513

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            P RSA DLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRS+L SHLS+L
Sbjct  8    PHRSANDLFSDPLDSHP-LWFKPDLFLSPNFDSESYISELRTFVPFDTLRSQLHSHLSAL  66

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
             R+L+DLINRDY DFV+LSTKL DV+AAVVRMRAPL+E+R KI  FR +VE SLSAL + 
Sbjct  67   NRELIDLINRDYTDFVNLSTKLVDVEAAVVRMRAPLVELREKIEQFRGSVEFSLSALQNG  126

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  D   LSNG S 
Sbjct  127  LRQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSAPADGSNGTMNLTDKSGLSNGASL  186

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             H E G+NLRETQSM LERI+SEMNRLKFYIAHA
Sbjct  187  PHIENGTNLRETQSMLLERISSEMNRLKFYIAHA  220



>ref|XP_009375225.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
 ref|XP_009375233.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             AP RSA DLF DP D++P  W  P LFL  +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAADLFSDPLDSHP-LWFKPALFLWPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALT  124

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  604
            + LKQR++A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLKQRSEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSISNGA  184

Query  605  SFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            S QHTE G+NLR+TQSM LERIASEMNRLKFY AHA
Sbjct  185  SLQHTENGTNLRDTQSMLLERIASEMNRLKFYFAHA  220



>ref|XP_009359449.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             AP RSA +LF DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAANLFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALT  124

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  604
            + LKQR +A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLKQRLEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSVSNGT  184

Query  605  SFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            S QH E G+NLR+TQSM LERIASEMNRLKFYIAHA
Sbjct  185  SLQHAENGTNLRDTQSMLLERIASEMNRLKFYIAHA  220



>ref|XP_008239451.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Prunus 
mume]
Length=755

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 178/215 (83%), Gaps = 1/215 (0%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            AP R+ATD F DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+S+L+S
Sbjct  7    APHRTATDFFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQSYLAS  65

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEHFRGSVQNSLVALTN  125

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
             LKQR++A EAREVLELLLDTFHVVSKVEKLI+ELPS   +  NG  N A+  +++NG S
Sbjct  126  GLKQRSEANEAREVLELLLDTFHVVSKVEKLIQELPSVPADWLNGDVNLAEKNFITNGTS  185

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             QH E G+NLR+TQSM LERIASEMNRLKFYIAHA
Sbjct  186  LQHVENGTNLRDTQSMLLERIASEMNRLKFYIAHA  220



>ref|XP_007155537.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
 gb|ESW27531.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
Length=755

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 174/215 (81%), Gaps = 1/215 (0%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APPRSATDLF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATDLFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L  +L+DLINRDYADFV+LSTKL DVDA VVRMRAPL+E+R KI  FR +VE SL ++ +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAVVVRMRAPLVELRDKIEQFRGSVEVSLVSIKN  125

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
            RL QR++A  ARE LELLLDTFHVVSKVEKLIKELPS  T+ +NG  N ++  YLSNGVS
Sbjct  126  RLNQRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNYLSNGVS  185

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             Q  E  +++RETQSM LERIASEMNRLKFY+ HA
Sbjct  186  VQQVENETSIRETQSMLLERIASEMNRLKFYVTHA  220



>ref|XP_008463108.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
 ref|XP_008463109.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
Length=754

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 174/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            P RSA DLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRS+L SHLS+L
Sbjct  8    PHRSANDLFSDPLDSHP-LWFKPNLFLSPNFDSESYISELRTFVPFDTLRSQLHSHLSAL  66

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
             R+L+DLINRDY DFV+LSTKL DV+AAVVRMRAPL+E+R KI  FR +VE SLSAL + 
Sbjct  67   NRELIDLINRDYTDFVNLSTKLVDVEAAVVRMRAPLVELREKIEQFRASVEFSLSALQNG  126

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  DN  LSNG S 
Sbjct  127  LRQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSAPADGSNGTTNLTDNSGLSNGASL  186

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             H E G+NLRETQSM LERI+SEMNRLKFYIAHA
Sbjct  187  PHMENGTNLRETQSMLLERISSEMNRLKFYIAHA  220



>ref|XP_008392829.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 174/216 (81%), Gaps = 1/216 (0%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             AP RSA +LF DP D++P  W  P LFL  +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAANLFSDPLDSHP-LWFKPALFLXPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V+ SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQDSLVALT  124

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  604
            + L QR +A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLXQRLEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSVSNGT  184

Query  605  SFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            S QH E G+NLR+TQSM LERIASEMNRLKFYIAHA
Sbjct  185  SLQHAENGTNLRDTQSMLLERIASEMNRLKFYIAHA  220



>ref|XP_008351743.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 174/216 (81%), Gaps = 1/216 (0%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             AP RSA +LF DP D++P  W  P LFL  +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAANLFSDPLDSHP-LWFKPALFLXPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V+ SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQDSLVALT  124

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  604
            + L QR +A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLXQRLEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSVSNGT  184

Query  605  SFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            S QH E G+NLR+TQSM LERIASEMNRLKFYIAHA
Sbjct  185  SLQHAENGTNLRDTQSMLLERIASEMNRLKFYIAHA  220



>ref|XP_004138387.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cucumis sativus]
 gb|KGN45847.1| hypothetical protein Csa_6G014670 [Cucumis sativus]
Length=754

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            P RSA DLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRS+L SHLS+L
Sbjct  8    PHRSANDLFSDPLDSHP-LWFKPDLFLSPNFDSESYISELRTFVPFDTLRSQLHSHLSAL  66

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
             R+L+DLINRDY DFV+LSTKL DV+AAVVRMRAPL+E+R KI  FR +VE SLSAL + 
Sbjct  67   NRELIDLINRDYTDFVNLSTKLVDVEAAVVRMRAPLVELREKIEQFRGSVEFSLSALQNG  126

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  D   LSNG S 
Sbjct  127  LRQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSAPADGSNGTMNLTDKSGLSNGASL  186

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             H E G+NLRETQSM LERI+SEMNRLKFYIAHA
Sbjct  187  PHIENGTNLRETQSMLLERISSEMNRLKFYIAHA  220



>ref|XP_002511204.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
 gb|EEF51806.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
Length=756

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 173/213 (81%), Gaps = 1/213 (0%)
 Frame = +2

Query  74   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  253
            PRSATDLF DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSEL++HLSSL 
Sbjct  10   PRSATDLFSDPLDSHP-LWFKPNLFLSPTFDSESYISELRTFVPFDTLRSELQAHLSSLN  68

Query  254  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  433
             +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR +VE SL AL + L
Sbjct  69   HELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIEGFRGSVEGSLVALRNGL  128

Query  434  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  613
            +QR++A  ARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N      +SNG+S Q
Sbjct  129  QQRSEAASAREILELLLDTFHVVSKVEKLIKELPSLPADWSNGDVNSTVKNAMSNGISLQ  188

Query  614  HTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
              E G+NLRETQSM LERIASEMNRLKFY+AH+
Sbjct  189  SIENGTNLRETQSMLLERIASEMNRLKFYMAHS  221



>ref|XP_003549849.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   273 bits (699),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 171/215 (80%), Gaps = 1/215 (0%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APPRSATDLF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATDLFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L  +L+DLINRDYADFV+LSTKL DVDA VVRMRAPL+E+R KI  FR +VE SL A+ +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAVVVRMRAPLVELRDKIEQFRGSVEVSLVAIKN  125

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
            RL+QR++   ARE LELLLD FHVVSKVEKLIKELPS  T+ +NG  N ++   LSNGVS
Sbjct  126  RLRQRSEVASARETLELLLDAFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNNLSNGVS  185

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             QH E    +RETQSM LERIASEMNRLKFY+ HA
Sbjct  186  AQHVENEMIIRETQSMLLERIASEMNRLKFYVTHA  220



>gb|KDP30933.1| hypothetical protein JCGZ_11309 [Jatropha curcas]
Length=756

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 175/218 (80%), Gaps = 3/218 (1%)
 Frame = +2

Query  56   STPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrs  235
            STP  PPRSATDLF DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSEL++
Sbjct  6    STP--PPRSATDLFSDPLDSHP-LWFKPNLFLSPTFDSESYISELRTFVPFDTLRSELQA  62

Query  236  hlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLS  415
            +L+SL  DL+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR +VE  L 
Sbjct  63   YLASLNHDLIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIEGFRRSVEGLLV  122

Query  416  ALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS  595
            AL + L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  + +    +S
Sbjct  123  ALRNGLQQRSEAAAAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDLSSSVKNAMS  182

Query  596  NGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAH  709
            NG S Q  E G+NLRETQSM LERIA+EMNRLKFYIAH
Sbjct  183  NGNSVQSIENGTNLRETQSMLLERIATEMNRLKFYIAH  220



>ref|XP_003525701.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 171/215 (80%), Gaps = 1/215 (0%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APPRSAT+LF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATELFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L  +L+DLINRDYADFV+LSTKL DVDA VVRMRAPL+E+R KI  FR +VE SL A+ S
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAVVVRMRAPLVELRDKIEQFRGSVEVSLVAIKS  125

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
            RL+QR++   ARE LELLLD FHVVSKVEKLIKELPS  T+ +NG  N ++    SNGVS
Sbjct  126  RLRQRSEVASARETLELLLDAFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNNFSNGVS  185

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             QH E   ++RETQSM LERIASEMNRLK+Y+ HA
Sbjct  186  VQHVENEMSIRETQSMLLERIASEMNRLKYYVTHA  220



>ref|XP_004515820.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cicer arietinum]
Length=755

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            RSAT+LF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL ++LSSL  
Sbjct  10   RSATNLFSDPLDSHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNNYLSSLNH  68

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
            +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +V+ SL A+ + LK
Sbjct  69   ELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVDVSLIAIKNGLK  128

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  616
            QR++A  ARE LELLLDTFHVVSKVEKLIKELPS  ++ +NG  N ++   LSNGVS QH
Sbjct  129  QRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNSSEKNSLSNGVSVQH  188

Query  617  TEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             E G+++RETQSM LERIASEMNRLKFY+ HA
Sbjct  189  VENGTSVRETQSMLLERIASEMNRLKFYVTHA  220



>gb|KDO52635.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=546

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDFDVNLEERKSMSSATTF  188

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            Q  E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  189  QPVENGTNVRETQSMLLERIASEMNRLKFYIAHA  222



>ref|XP_007023398.1| Golgi organization, COG2 isoform 3 [Theobroma cacao]
 gb|EOY26020.1| Golgi organization, COG2 isoform 3 [Theobroma cacao]
Length=517

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 174/224 (78%), Gaps = 7/224 (3%)
 Frame = +2

Query  44   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  223
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  224  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  403
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  404  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  583
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  584  GYLSNGVSFQHTEKG-SNLRETQSMHLERIASEMNRLKFYIAHA  712
                N    QH E G +NLRETQSM LERIASEMNRL FYIAHA
Sbjct  179  ---KNASGLQHVENGTTNLRETQSMLLERIASEMNRLNFYIAHA  219



>ref|XP_010677897.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Beta 
vulgaris subsp. vulgaris]
Length=759

 Score =   268 bits (686),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 171/219 (78%), Gaps = 0/219 (0%)
 Frame = +2

Query  56   STPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrs  235
            + P  PPRS TD+FGDP + + P W    LFLS  FD+ETYISDLRTFVP DTLRS+L S
Sbjct  7    AQPSPPPRSHTDVFGDPFEDSSPLWFKKDLFLSPKFDSETYISDLRTFVPFDTLRSQLHS  66

Query  236  hlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLS  415
            HLSSL+  LVDLINRDY DFV+LST L DVD++V RMRAPL ++R KIS FR+ V+ SL 
Sbjct  67   HLSSLKHQLVDLINRDYNDFVNLSTNLVDVDSSVARMRAPLSDLREKISAFRDCVQDSLV  126

Query  416  ALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS  595
            +L + L QRA A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N ++  +LS
Sbjct  127  SLQNGLNQRAQAANAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSSEKSHLS  186

Query  596  NGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            NG+S Q +E  SN+RETQSM LERI+SEMNRLKFY+AHA
Sbjct  187  NGLSLQQSENESNVRETQSMLLERISSEMNRLKFYMAHA  225



>ref|XP_007023399.1| Golgi organization, COG2 isoform 4 [Theobroma cacao]
 gb|EOY26021.1| Golgi organization, COG2 isoform 4 [Theobroma cacao]
Length=533

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 174/224 (78%), Gaps = 7/224 (3%)
 Frame = +2

Query  44   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  223
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  224  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  403
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  404  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  583
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  584  GYLSNGVSFQHTEKG-SNLRETQSMHLERIASEMNRLKFYIAHA  712
                N    QH E G +NLRETQSM LERIASEMNRL FYIAHA
Sbjct  179  ---KNASGLQHVENGTTNLRETQSMLLERIASEMNRLNFYIAHA  219



>ref|XP_004297537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Fragaria 
vesca subsp. vesca]
Length=768

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 176/228 (77%), Gaps = 13/228 (6%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             AP RS TD F DP D++P  W  P LFLS DFD+E YISDLRTFVP DTLRSEL+S+L+
Sbjct  8    AAPHRSNTDFFSDPLDSHP-LWFKPSLFLSPDFDSEAYISDLRTFVPFDTLRSELQSYLA  66

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL  DL+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V+ SL AL 
Sbjct  67   SLNHDLIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQGSLVALT  126

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG-  601
            + LKQR++A EARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N A+  ++SNG 
Sbjct  127  NGLKQRSEAAEAREILELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNFISNGT  186

Query  602  -----------VSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                       +S   TE G+++R+TQSM LERIASEMNRLKFYIAHA
Sbjct  187  AENGTSQTKNVISNGTTENGTSVRDTQSMLLERIASEMNRLKFYIAHA  234



>ref|XP_010250762.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nelumbo 
nucifera]
Length=747

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 170/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRS TDLFGDP D+ P  W     FL E+FD+E YI+DLRTFVP D LRSEL++HLSSL
Sbjct  6    PPRSPTDLFGDPIDSQP-LWFKKNAFLEENFDSEAYITDLRTFVPFDNLRSELQTHLSSL  64

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
            + +LV+LINRDYADFV+LSTKL DVD  ++RMRAPL E+R KIS FR +VESSL+AL + 
Sbjct  65   KHELVELINRDYADFVNLSTKLVDVDGTILRMRAPLTELREKISQFRGSVESSLAALQNG  124

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS  ++ +NG  N  + G      S 
Sbjct  125  LRQRAEASAAREVLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNSTEKG------SL  178

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            QHTE G+N RETQSM LERIASEMNRLKFY+AHA
Sbjct  179  QHTENGTNFRETQSMLLERIASEMNRLKFYMAHA  212



>ref|XP_010026579.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Eucalyptus grandis]
Length=776

 Score =   266 bits (680),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 171/210 (81%), Gaps = 3/210 (1%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            DLF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSELRSHLSSL  +L+D
Sbjct  22   DLFSDPQDSHP-LWFKPSAFLSGDFDSESYISELRTFVPFDTLRSELRSHLSSLNHELID  80

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDY DFV+LSTKL DVDAA+VRMRAPLLE+R KI  FR +VE SL AL + L+QR++
Sbjct  81   LINRDYNDFVNLSTKLVDVDAAIVRMRAPLLELRDKIEGFRGSVEGSLVALRNGLRQRSE  140

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGY-LSNGVSFQH-TE  622
            A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+NG  LSNGVS  H  E
Sbjct  141  AASAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNPAENGSPLSNGVSLSHAAE  200

Query  623  KGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             G+NLRETQSM LERIASEMNRLKFYIAHA
Sbjct  201  NGTNLRETQSMLLERIASEMNRLKFYIAHA  230



>ref|XP_006477014.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Citrus sinensis]
Length=757

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSVPADGSDFDVNLEERKSMSSATTF  188

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            Q  E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  189  QPVENGTNVRETQSMLLERIASEMNRLKFYIAHA  222



>ref|XP_007023397.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
 gb|EOY26019.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
Length=674

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 174/224 (78%), Gaps = 7/224 (3%)
 Frame = +2

Query  44   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  223
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  224  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  403
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  404  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  583
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  584  GYLSNGVSFQHTEKG-SNLRETQSMHLERIASEMNRLKFYIAHA  712
                N    QH E G +NLRETQSM LERIASEMNRL FYIAHA
Sbjct  179  ---KNASGLQHVENGTTNLRETQSMLLERIASEMNRLNFYIAHA  219



>ref|XP_010026586.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW83168.1| hypothetical protein EUGRSUZ_B00121 [Eucalyptus grandis]
Length=760

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 171/210 (81%), Gaps = 3/210 (1%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            DLF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSELRSHLSSL  +L+D
Sbjct  22   DLFSDPQDSHP-LWFKPSAFLSGDFDSESYISELRTFVPFDTLRSELRSHLSSLNHELID  80

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDY DFV+LSTKL DVDAA+VRMRAPLLE+R KI  FR +VE SL AL + L+QR++
Sbjct  81   LINRDYNDFVNLSTKLVDVDAAIVRMRAPLLELRDKIEGFRGSVEGSLVALRNGLRQRSE  140

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGY-LSNGVSFQH-TE  622
            A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+NG  LSNGVS  H  E
Sbjct  141  AASAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNPAENGSPLSNGVSLSHAAE  200

Query  623  KGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             G+NLRETQSM LERIASEMNRLKFYIAHA
Sbjct  201  NGTNLRETQSMLLERIASEMNRLKFYIAHA  230



>gb|KDO52629.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=756

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDFDVNLEERKSMSSATTF  188

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            Q  E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  189  QPVENGTNVRETQSMLLERIASEMNRLKFYIAHA  222



>ref|XP_006440092.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
 gb|ESR53332.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
Length=757

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDVDVNLEERKSMSSATTF  188

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            Q  E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  189  QPVENGTNVRETQSMLLERIASEMNRLKFYIAHA  222



>gb|KDO52630.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=757

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDFDVNLEERKSMSSATTF  188

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            Q  E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  189  QPVENGTNVRETQSMLLERIASEMNRLKFYIAHA  222



>ref|XP_003608845.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES91042.1| oligomeric subunit-like protein [Medicago truncatula]
Length=636

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 170/212 (80%), Gaps = 1/212 (0%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            RS T+LF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL ++LSSL  
Sbjct  10   RSTTNLFSDPLDSHP-LWFKPTSFLSPDFDSESYISELRTFVPFDTLRSELNNYLSSLNH  68

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
            +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +V+ SL A+ + LK
Sbjct  69   ELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVDVSLVAIKNGLK  128

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  616
            QR++A  ARE LELLLDTFHVVSKVEKLIKELPS  ++ +NG  N ++    SNGVS Q 
Sbjct  129  QRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNLSEKNPSSNGVSVQQ  188

Query  617  TEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             E G+++RETQSM LERIASEMNRLKFY+ HA
Sbjct  189  VENGTSVRETQSMLLERIASEMNRLKFYVTHA  220



>ref|XP_007023396.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
 gb|EOY26018.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
Length=754

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 174/224 (78%), Gaps = 7/224 (3%)
 Frame = +2

Query  44   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  223
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  224  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  403
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  404  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  583
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  584  GYLSNGVSFQHTEKG-SNLRETQSMHLERIASEMNRLKFYIAHA  712
                N    QH E G +NLRETQSM LERIASEMNRL FYIAHA
Sbjct  179  ---KNASGLQHVENGTTNLRETQSMLLERIASEMNRLNFYIAHA  219



>gb|EPS73270.1| hypothetical protein M569_01480, partial [Genlisea aurea]
Length=757

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 175/226 (77%), Gaps = 12/226 (5%)
 Frame = +2

Query  35   LHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDT  214
            LHSP         P+SATDLFGDP + + P WL P  F   DFD E+YISDLRTFVP DT
Sbjct  6    LHSPL--------PKSATDLFGDPVEDSRPLWLKPSKFSDLDFDPESYISDLRTFVPFDT  57

Query  215  lrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFRE  394
            LRSELRSHL+SL+ +LV+LINRDYADFVSLSTKL DVD+AVVRM APLLEI+ KI  +R 
Sbjct  58   LRSELRSHLASLKNELVELINRDYADFVSLSTKLVDVDSAVVRMWAPLLEIKEKILVYRA  117

Query  395  AVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANY  574
            +V++SL+A+ SRLKQR+ A  AR++LELLLDTFHVVSK+EKLIKELPS  ++  +G A  
Sbjct  118  SVDTSLAAMQSRLKQRSQASGARDMLELLLDTFHVVSKIEKLIKELPSVPSDWPSGPAKS  177

Query  575  ADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            AD   LSNG    H E G+ +RETQ M LER+ASEMNRLKFYIAHA
Sbjct  178  ADKDQLSNG----HVENGTTMRETQGMLLERVASEMNRLKFYIAHA  219



>ref|XP_003608844.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES91041.1| oligomeric subunit-like protein [Medicago truncatula]
Length=754

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 170/212 (80%), Gaps = 1/212 (0%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            RS T+LF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL ++LSSL  
Sbjct  10   RSTTNLFSDPLDSHP-LWFKPTSFLSPDFDSESYISELRTFVPFDTLRSELNNYLSSLNH  68

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
            +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +V+ SL A+ + LK
Sbjct  69   ELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVDVSLVAIKNGLK  128

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  616
            QR++A  ARE LELLLDTFHVVSKVEKLIKELPS  ++ +NG  N ++    SNGVS Q 
Sbjct  129  QRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNLSEKNPSSNGVSVQQ  188

Query  617  TEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             E G+++RETQSM LERIASEMNRLKFY+ HA
Sbjct  189  VENGTSVRETQSMLLERIASEMNRLKFYVTHA  220



>ref|XP_002318717.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
 gb|EEE96937.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
Length=755

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 170/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATD F DP D +P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL
Sbjct  11   PPRSATDFFSDPLDFHP-LWFKPDLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLTSL  69

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + 
Sbjct  70   NHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNG  129

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  +    SNG   
Sbjct  130  LEQRSEATATREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLTEKNAASNG---  186

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
               E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  187  -SIENGTNVRETQSMLLERIASEMNRLKFYIAHA  219



>ref|XP_002279916.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Vitis 
vinifera]
 emb|CBI15649.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            P RSATDLF DP D+ P  W     FL  +FD+E YISDLRT V  DTLRSEL++HL+SL
Sbjct  6    PTRSATDLFSDPIDSQP-LWFKKSSFLQPEFDSEAYISDLRTLVSFDTLRSELQTHLASL  64

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
            + +L+DLINRDYADFV+LSTKL DVD A+VRMRAPL E+R KI  FRE+VES+L A+ + 
Sbjct  65   KHELIDLINRDYADFVNLSTKLVDVDGAIVRMRAPLTELREKILGFRESVESTLVAVQNG  124

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QR++A  ARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N      L+NG+S 
Sbjct  125  LRQRSEASAAREILELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSMARSSLNNGISL  184

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            QH E  +NLRETQSM LERIASEMNRLKFY+AHA
Sbjct  185  QHAENETNLRETQSMLLERIASEMNRLKFYMAHA  218



>emb|CAN71854.1| hypothetical protein VITISV_007347 [Vitis vinifera]
Length=777

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            P RSATDLF DP D+ P  W     FL  +FD+E YISDLRT V  DTLRSEL++HL+SL
Sbjct  6    PTRSATDLFSDPIDSQP-LWFKKSSFLQPEFDSEAYISDLRTLVSFDTLRSELQTHLASL  64

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
            + +L+DLINRDYADFV+LSTKL DVD A+VRMRAPL E+R KI  FRE+VES+L A+ + 
Sbjct  65   KHELIDLINRDYADFVNLSTKLVDVDGAIVRMRAPLTELREKILGFRESVESTLVAVQNG  124

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QR++A  ARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N      L+NG+S 
Sbjct  125  LRQRSEASAAREILELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSMARSSLNNGISL  184

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            QH E  +NLRETQSM LERIASEMNRLKFY+AHA
Sbjct  185  QHAENETNLRETQSMLLERIASEMNRLKFYMAHA  218



>ref|XP_011044173.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=755

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 169/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSA D F DP D +P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL
Sbjct  11   PPRSANDFFSDPLDFHP-LWFKPNLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLASL  69

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + 
Sbjct  70   NHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNG  129

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  +    SNG   
Sbjct  130  LEQRSEAAVTREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSTEKNAASNG---  186

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
               E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  187  -SIENGTNVRETQSMLLERIASEMNRLKFYIAHA  219



>ref|XP_006283181.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
 gb|EOA16079.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
Length=754

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 175/220 (80%), Gaps = 3/220 (1%)
 Frame = +2

Query  53   SSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselr  232
            +++P   PRSATD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELR
Sbjct  6    ATSPSQAPRSATDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELR  64

Query  233  shlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSL  412
            SHL+SL R+LVDLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L
Sbjct  65   SHLASLNRELVDLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAAL  124

Query  413  SALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYL  592
             AL + L+QR+DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN      +
Sbjct  125  FALRNGLQQRSDAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDANSIGKSSM  184

Query  593  SNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            ++  S Q  + G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  185  NDENSTQ--QDGTTMRETQSMLLERIASEMNRLKFYMAHA  222



>gb|KJB43167.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43168.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43169.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43170.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=754

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  62   PGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshl  241
            P   PRSATDLF DP D++P  W  P LFLS DFD+E+YI++LRTFVP DTLRSEL++HL
Sbjct  6    PSPAPRSATDLFSDPLDSHP-MWFKPSLFLSPDFDSESYIAELRTFVPFDTLRSELQAHL  64

Query  242  sslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSAL  421
            SSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE SL++L
Sbjct  65   SSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVEGSLTSL  124

Query  422  HSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  601
             + L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS +++ +NG  N       SN 
Sbjct  125  KNGLSQRAEAAAAREVLELLLDTFHVVSKVEKLIKELPSVSSDWSNGDVNSMQK---SNA  181

Query  602  VSFQHTEKG-SNLRETQSMHLERIASEMNRLKFYIAHA  712
            +S QH E G +NLRETQSM LERIASEMNRL FYIAHA
Sbjct  182  LSSQHVENGTTNLRETQSMLLERIASEMNRLNFYIAHA  219



>gb|KJB43171.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=748

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  62   PGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshl  241
            P   PRSATDLF DP D++P  W  P LFLS DFD+E+YI++LRTFVP DTLRSEL++HL
Sbjct  6    PSPAPRSATDLFSDPLDSHP-MWFKPSLFLSPDFDSESYIAELRTFVPFDTLRSELQAHL  64

Query  242  sslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSAL  421
            SSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE SL++L
Sbjct  65   SSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVEGSLTSL  124

Query  422  HSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  601
             + L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS +++ +NG  N       SN 
Sbjct  125  KNGLSQRAEAAAAREVLELLLDTFHVVSKVEKLIKELPSVSSDWSNGDVNSMQK---SNA  181

Query  602  VSFQHTEKG-SNLRETQSMHLERIASEMNRLKFYIAHA  712
            +S QH E G +NLRETQSM LERIASEMNRL FYIAHA
Sbjct  182  LSSQHVENGTTNLRETQSMLLERIASEMNRLNFYIAHA  219



>gb|KHG07418.1| Conserved oligomeric Golgi complex subunit 2 [Gossypium arboreum]
Length=754

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  62   PGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshl  241
            P   PRSATDLF DP D++P  W  P LFLS DFD+E+YI++LRTFVP DTLRSEL++HL
Sbjct  6    PSPAPRSATDLFSDPLDSHP-MWFKPSLFLSPDFDSESYIAELRTFVPFDTLRSELQAHL  64

Query  242  sslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSAL  421
            SSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE SL++L
Sbjct  65   SSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVEGSLTSL  124

Query  422  HSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  601
             + L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS +++ +NG  N       SN 
Sbjct  125  KNGLSQRAEAAAAREVLELLLDTFHVVSKVEKLIKELPSVSSDWSNGDVNSMQK---SNA  181

Query  602  VSFQHTEKG-SNLRETQSMHLERIASEMNRLKFYIAHA  712
            +S QH E G +NLRETQSM LERIASEMNRL FYIAHA
Sbjct  182  LSSQHVENGTTNLRETQSMLLERIASEMNRLNFYIAHA  219



>ref|XP_011024042.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=757

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 168/212 (79%), Gaps = 5/212 (2%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            RS   LF DP D++P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL  
Sbjct  15   RSNAYLFSDPLDSHP-LWFKPDLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLTSLNH  73

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
            +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + L+
Sbjct  74   ELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNGLE  133

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  616
            QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  +   +SNG     
Sbjct  134  QRSEAAATREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLVEKNVVSNG----S  189

Query  617  TEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             E G+N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  190  IENGTNVRETQSMLLERIASEMNRLKFYIAHA  221



>ref|XP_008794572.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
 ref|XP_008794573.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
Length=751

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLFGDP ++ P  W     F   DFD E+YI+DLR+FVPL++L +ELR+HLSSL
Sbjct  6    PPRSATDLFGDPIESQP-LWFKASSFHRPDFDPESYIADLRSFVPLESLAAELRAHLSSL  64

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
            + +LVDLINRDYADFVSLST+L DVD+AV RMRAPL E R K++ FR  V+SSLS L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRAPLAEFRDKVAAFRAVVDSSLSNLRSG  124

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L++      +    ++G S 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSSADIASIEKNSPNSGNSL  184

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            QH E G+NLRETQS+ LERIASEMNRLKFYI +A
Sbjct  185  QHIESGANLRETQSILLERIASEMNRLKFYITNA  218



>ref|XP_002322242.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
 gb|EEF06369.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
Length=757

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 168/212 (79%), Gaps = 5/212 (2%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            RS   LF DP D++P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL  
Sbjct  15   RSNAYLFSDPLDSHP-LWFKPDLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLTSLNH  73

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
            +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + L+
Sbjct  74   ELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNGLE  133

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  616
            QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG     
Sbjct  134  QRSEAAATREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNVVSNG----S  189

Query  617  TEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             E  +N+RETQSM LERIASEMNRLKFYIAHA
Sbjct  190  IENVTNVRETQSMLLERIASEMNRLKFYIAHA  221



>ref|XP_010926721.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X2 [Elaeis guineensis]
Length=631

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLFGDP ++ P  W     FL  DF+ E+YI+DLR+FVPL++L +ELR+HL++L
Sbjct  6    PPRSATDLFGDPIESQP-LWFKAASFLRPDFEPESYIADLRSFVPLESLAAELRAHLAAL  64

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
            + +LVDLINRDYADFVSLST+L DVD+AV RMRAPL E R K++ F   V+SSL+ L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRAPLAEFRDKVAAFHAVVDSSLANLCSG  124

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L+       D+   ++  + 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSTADMASIDSSAPNSENAL  184

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            QH E G+NLRETQS+ LERIASEMNRLKFYIA+A
Sbjct  185  QHIESGANLRETQSILLERIASEMNRLKFYIANA  218



>ref|XP_010927713.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Elaeis guineensis]
Length=751

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPR ATDLFGDP ++ P  W     F S DFD E+YI+DLR+FVPL++L +ELR+HLS+L
Sbjct  6    PPRLATDLFGDPIESQP-LWFKASSFHSPDFDPESYIADLRSFVPLESLAAELRAHLSAL  64

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
            + +LVDLINRDYADFVSLST+L DVD+AV RMR PL E R K++ FR  V+SSLS L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRDPLAEFRDKVAAFRTVVDSSLSNLRSG  124

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L++      +    ++G S 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSSADIASIEKSSPNSGNSL  184

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            QH E G+NLRETQS+ LERIASEMNRLKFY+ HA
Sbjct  185  QHIESGANLRETQSILLERIASEMNRLKFYMTHA  218



>ref|XP_010926719.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010926720.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
Length=753

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  71   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  250
            PPRSATDLFGDP ++ P  W     FL  DF+ E+YI+DLR+FVPL++L +ELR+HL++L
Sbjct  6    PPRSATDLFGDPIESQP-LWFKAASFLRPDFEPESYIADLRSFVPLESLAAELRAHLAAL  64

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
            + +LVDLINRDYADFVSLST+L DVD+AV RMRAPL E R K++ F   V+SSL+ L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRAPLAEFRDKVAAFHAVVDSSLANLCSG  124

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L+       D+   ++  + 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSTADMASIDSSAPNSENAL  184

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            QH E G+NLRETQS+ LERIASEMNRLKFYIA+A
Sbjct  185  QHIESGANLRETQSILLERIASEMNRLKFYIANA  218



>ref|XP_010536632.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
 ref|XP_010536633.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
Length=757

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 168/218 (77%), Gaps = 3/218 (1%)
 Frame = +2

Query  56   STPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrs  235
            +T   PPRSATDLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRS
Sbjct  6    TTASPPPRSATDLFSDPQDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRS  64

Query  236  hlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLS  415
            HL+SL R+LVDLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR +VE+ L 
Sbjct  65   HLASLNRELVDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIVGFRGSVEAVLF  124

Query  416  ALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS  595
            AL S L+QR+DA  ARE LE LL+TFH+VSKVEKLIK LPS  ++     AN      ++
Sbjct  125  ALRSGLQQRSDAAAAREDLESLLNTFHLVSKVEKLIKGLPSSPSDWPKDDANLIVKSSMN  184

Query  596  NGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAH  709
            +G S Q  + G+ +RET S HLERIASEMNRLKFY  H
Sbjct  185  DGNSLQ--QDGTTMRETLSTHLERIASEMNRLKFYTTH  220



>emb|CAB41124.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
 emb|CAB79394.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
Length=724

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQQRS  137

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN      +++  S Q  + 
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDANSMGRSSMNDENSTQ--QD  195

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  196  GTTMRETQSMLLERIASEMNRLKFYMAHA  224



>gb|KFK29022.1| hypothetical protein AALP_AA7G078500 [Arabis alpina]
Length=756

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 169/213 (79%), Gaps = 3/213 (1%)
 Frame = +2

Query  74   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  253
            PRSATD F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSELRSHL+SL 
Sbjct  11   PRSATDFFSDPYDSHP-LWFKPSLFLSPDFDSESYISELRTFVPFDTLRSELRSHLASLN  69

Query  254  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  433
            R+LVDLINRDYADFV+LSTKL D+D AV RMRAPLL++R KI+ FR +V+S+L +L S L
Sbjct  70   RELVDLINRDYADFVNLSTKLVDIDTAVARMRAPLLDLREKITGFRGSVDSALFSLRSGL  129

Query  434  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  613
            +QR+DA  AREVLELLLDTFHVVSKVEKLIK L +  ++  N  AN      L++  S Q
Sbjct  130  QQRSDAAAAREVLELLLDTFHVVSKVEKLIKVLQTTPSDWQNEDANSMGRSSLNDENSAQ  189

Query  614  HTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            +   G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  190  N--DGTTMRETQSMLLERIASEMNRLKFYMAHA  220



>ref|NP_567710.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84970.1| uncharacterized protein AT4G24840 [Arabidopsis thaliana]
Length=756

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQQRS  137

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN      +++  S Q  + 
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDANSMGRSSMNDENSTQ--QD  195

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  196  GTTMRETQSMLLERIASEMNRLKFYMAHA  224



>gb|AAK32887.1|AF367300_1 AT4g24840/F6I7_50 [Arabidopsis thaliana]
 gb|AAM10288.1| AT4g24840/F6I7_50 [Arabidopsis thaliana]
Length=756

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQQRS  137

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN      +++  S Q  + 
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDANSMGRSSMNDENSTQ--QD  195

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  196  GTTMRETQSMLLERIASEMNRLKFYMAHA  224



>gb|EYU23122.1| hypothetical protein MIMGU_mgv1a024704mg [Erythranthe guttata]
Length=739

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 159/210 (76%), Gaps = 3/210 (1%)
 Frame = +2

Query  83   ATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDL  262
            ATDLFGDP + +    LNP  F   +FD E+YISDLRTFVP DTLRSELRSHL +L+ +L
Sbjct  2    ATDLFGDPIEDSH---LNPSKFSDPEFDPESYISDLRTFVPFDTLRSELRSHLGALKHEL  58

Query  263  VDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQR  442
            VDLINRDY DFVSLSTKL DVDAAVVRMRAPLLEI+ KI  FR +V+ SL+AL SR KQR
Sbjct  59   VDLINRDYVDFVSLSTKLVDVDAAVVRMRAPLLEIKEKILNFRGSVDFSLAALQSRRKQR  118

Query  443  ADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTE  622
            + A E REVLELLLDTFH VSKVEK+I ELPS    L NG     +   L N + FQH+E
Sbjct  119  SQADETREVLELLLDTFHAVSKVEKMINELPSVPAELPNGTTGSTEKDRLRNSIPFQHSE  178

Query  623  KGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             G+NLRETQS+ LERIA EMN+LK Y  HA
Sbjct  179  NGTNLRETQSVLLERIAIEMNQLKLYTTHA  208



>ref|XP_010433717.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=757

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  20   TDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  78

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  79   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAALFALRNGLQQRS  138

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
            DAG AREVLELLLDTFHVVSKVEKLIK LPS  ++  +  A+      +S+  S Q  + 
Sbjct  139  DAGAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQSEDASSMGRISMSDENSTQ--QD  196

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  197  GTTMRETQSMLLERIASEMNRLKFYMAHA  225



>ref|XP_002867640.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43899.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 167/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L +L + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFSLRNGLQQRS  137

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN      ++   S Q  + 
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDANSMGRSSMNYENSTQ--QD  195

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  196  GTTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_009385490.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=716

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 171/229 (75%), Gaps = 10/229 (4%)
 Frame = +2

Query  26   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  205
            MTDL       TP +P   ATDLFGDP DA PP W     FL  DF  E Y++DLR+FVP
Sbjct  1    MTDL------VTPRSP---ATDLFGDPIDAKPP-WFKSSSFLRPDFVPEFYVADLRSFVP  50

Query  206  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  385
            L++L +ELRSHL+ L+ +LVDLINRDYADFV LST+L DVDAA  RMRAPL+E R K+++
Sbjct  51   LESLAAELRSHLADLKAELVDLINRDYADFVGLSTRLVDVDAAAGRMRAPLVEFRDKVAS  110

Query  386  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGI  565
            FR  V+++L A+ S L+QR++A  ARE+L+LLLDTFHVVSKVEKLIKELP+  +N ++  
Sbjct  111  FRAVVDAALVAIRSGLRQRSEASAAREILQLLLDTFHVVSKVEKLIKELPTTHSNQSSPD  170

Query  566  ANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
               ++ G L+N  S Q+ E GSNLRE QS+ LERIASEMNRLKFY +HA
Sbjct  171  TVSSEKGSLTNANSIQNVEIGSNLREDQSILLERIASEMNRLKFYTSHA  219



>ref|XP_009385489.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=750

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 171/229 (75%), Gaps = 10/229 (4%)
 Frame = +2

Query  26   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  205
            MTDL       TP +P   ATDLFGDP DA PP W     FL  DF  E Y++DLR+FVP
Sbjct  1    MTDL------VTPRSP---ATDLFGDPIDAKPP-WFKSSSFLRPDFVPEFYVADLRSFVP  50

Query  206  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  385
            L++L +ELRSHL+ L+ +LVDLINRDYADFV LST+L DVDAA  RMRAPL+E R K+++
Sbjct  51   LESLAAELRSHLADLKAELVDLINRDYADFVGLSTRLVDVDAAAGRMRAPLVEFRDKVAS  110

Query  386  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGI  565
            FR  V+++L A+ S L+QR++A  ARE+L+LLLDTFHVVSKVEKLIKELP+  +N ++  
Sbjct  111  FRAVVDAALVAIRSGLRQRSEASAAREILQLLLDTFHVVSKVEKLIKELPTTHSNQSSPD  170

Query  566  ANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
               ++ G L+N  S Q+ E GSNLRE QS+ LERIASEMNRLKFY +HA
Sbjct  171  TVSSEKGSLTNANSIQNVEIGSNLREDQSILLERIASEMNRLKFYTSHA  219



>emb|CDX92658.1| BnaC07g39160D [Brassica napus]
Length=757

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 164/210 (78%), Gaps = 7/210 (3%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            D F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPDFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFVSLSTKL D+D AVVRMRAPLL IR KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGIREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLAN--GIANYADNGYLSNGVSFQHTE  622
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  G++     G  S  V     +
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWKNEDGVS----LGRSSVNVENSTQQ  194

Query  623  KGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  195  DGTTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_006413377.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
 gb|ESQ54830.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
Length=759

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 164/208 (79%), Gaps = 3/208 (1%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            D F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFV+LSTKL D+DAAVVRMRAPLL++R KI+ FR +VE++L AL S L+QR+ 
Sbjct  79   LINRDYADFVNLSTKLVDIDAAVVRMRAPLLDLREKITGFRGSVEAALFALRSGLQQRSH  138

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKG  628
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN      +S   S Q  + G
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQNEDANSLGRSSMSVETSTQ--QDG  196

Query  629  SNLRETQSMHLERIASEMNRLKFYIAHA  712
            + +RETQSM LERIASEMNRLKFY+AHA
Sbjct  197  TTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_009137478.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=757

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 164/210 (78%), Gaps = 7/210 (3%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            D F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSE+RSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPDFDSESYISELRTFVPFDTLRSEIRSHLASLNRELVD  78

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFVSLSTKL D+D AVVRMRAPLL IR KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGIREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLAN--GIANYADNGYLSNGVSFQHTE  622
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  G++     G  +  V     +
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWKNEDGVS----LGRSAVNVENATQQ  194

Query  623  KGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  195  DGNTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_010448510.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 166/209 (79%), Gaps = 3/209 (1%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAALFALRNGLQQRS  137

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  +   N      +++  S Q  + 
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQSEDVNSMGRISMNDENSTQ--QD  195

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  196  GTTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_010438959.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 166/209 (79%), Gaps = 3/209 (1%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAALFALRNGLQQRS  137

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  +   N      +++  S Q  + 
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQSEDVNSMGRISMNDENSTQ--QD  195

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  196  GTTMRETQSMLLERIASEMNRLKFYMAHA  224



>emb|CDY11039.1| BnaA03g46980D [Brassica napus]
Length=757

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 164/210 (78%), Gaps = 7/210 (3%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            D F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPDFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFVSLSTKL D+D AVVRMRAPLL IR KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGIREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLA--NGIANYADNGYLSNGVSFQHTE  622
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++    +G++     G  +  V     +
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQKEDGVS----LGRSAVNVENATQQ  194

Query  623  KGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  195  DGNTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_010485902.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=760

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 164/208 (79%), Gaps = 3/208 (1%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            + F DP D +P  W  P LFLS  FD+E+YIS+LRTFVP DTLRS+L+SHL+SL R+LVD
Sbjct  22   EFFSDPYDPHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSQLQSHLASLNRELVD  80

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFV+LSTKL D+DAAV+RMRAPLLE+R KI+ FR +VE++L AL + L QR+D
Sbjct  81   LINRDYADFVNLSTKLVDIDAAVIRMRAPLLELREKITRFRGSVEAALFALRNALHQRSD  140

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKG  628
            A  +REVLELLL+TFHVVSKVEKLIK LP+   +  N  AN    G +S+ +  Q  + G
Sbjct  141  AAASREVLELLLNTFHVVSKVEKLIKVLPNTPCDWQNEDANSLVRGSMSDEIPTQ--QDG  198

Query  629  SNLRETQSMHLERIASEMNRLKFYIAHA  712
            + +RETQSM LERIASEMNRLKFY+AHA
Sbjct  199  TTMRETQSMLLERIASEMNRLKFYMAHA  226



>emb|CDY34317.1| BnaA01g14200D [Brassica napus]
Length=758

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 165/211 (78%), Gaps = 9/211 (4%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            D F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPVFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFVSLSTKL D+D AVVRMRAPLL +R KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGLREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGY-LSNGVSFQHT--  619
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++         D G  L + VS +++  
Sbjct  139  AASAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQK-----EDGGVSLRSSVSVENSTQ  193

Query  620  EKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            + G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  194  QDGTTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_006848427.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
 gb|ERN10008.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
Length=805

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 162/213 (76%), Gaps = 1/213 (0%)
 Frame = +2

Query  74   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  253
            PRS +DLFGDP D+ P  W    +F  +DFD + Y++DLR FVPL++LR+ELR+HLS+L+
Sbjct  12   PRSTSDLFGDPHDSQP-LWFKKEVFSQQDFDPDAYVADLRRFVPLESLRAELRAHLSTLK  70

Query  254  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  433
             +LV+LINRDYADFVSLSTKL DVD AV+RMRAPL E+R +IS FR +VE+S ++L   L
Sbjct  71   SELVELINRDYADFVSLSTKLVDVDGAVLRMRAPLNELRARISQFRASVEASFTSLRDGL  130

Query  434  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  613
            ++RADA  +REVLE LLDT HVVSKVEKLI ELPS   + +N      +    SN  S Q
Sbjct  131  QKRADAAASREVLERLLDTSHVVSKVEKLILELPSTPADWSNPDIAPTNKSLFSNDASLQ  190

Query  614  HTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
              E G+NLRETQSM LERIASEMNRLKFY+AHA
Sbjct  191  PVEHGANLRETQSMLLERIASEMNRLKFYMAHA  223



>emb|CDY03412.1| BnaC01g16700D [Brassica napus]
Length=760

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 179/232 (77%), Gaps = 9/232 (4%)
 Frame = +2

Query  26   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  205
            M+DL +   S +P + PRSA+D F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP
Sbjct  1    MSDLVATSPSPSPSSAPRSASDFFSDPYDSHP-LWFKPSLFLSPVFDSESYISELRTFVP  59

Query  206  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  385
             DTLRSELRSHL+SL R+LVDLINRDYADFVSLSTKL D+D AVVRMRAPLL +R KI+ 
Sbjct  60   FDTLRSELRSHLASLNRELVDLINRDYADFVSLSTKLVDIDEAVVRMRAPLLGLREKIAA  119

Query  386  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGI  565
            FR +VE++L AL S L+QR+DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++     
Sbjct  120  FRGSVEAALFALRSGLQQRSDAASAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQK--  177

Query  566  ANYADNGY-LSNGVSFQHT--EKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                D G  L + V+ +++  + G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  178  ---EDGGVSLRSSVNVENSTQQDGTTMRETQSMLLERIASEMNRLKFYMAHA  226



>gb|KHN34411.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=735

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 155/215 (72%), Gaps = 21/215 (10%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APPRSATDLF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATDLFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L  +L+DLINRDYADFV+LSTKL DVDA                     +VE SL A+ S
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAG--------------------SVEVSLVAIKS  105

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
            RL+QR++   ARE LELLLD FHVVSKVEKLIKELPS  T+ +NG  N ++    SNGVS
Sbjct  106  RLRQRSEVASARETLELLLDAFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNNFSNGVS  165

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             QH E   ++RETQSM LERIASEMNRLK+Y+ HA
Sbjct  166  VQHVENEMSIRETQSMLLERIASEMNRLKYYVTHA  200



>ref|XP_006296685.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
 gb|EOA29583.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
Length=760

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 165/208 (79%), Gaps = 3/208 (1%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            + F DP +++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRS+LRSHL+SL  +LVD
Sbjct  22   EFFSDPFESHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSQLRSHLASLNGELVD  80

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFV+LSTKL D+DAAV+RMRAPLLE+R KI+ FR ++E+SL +L + L QR+D
Sbjct  81   LINRDYADFVNLSTKLVDIDAAVIRMRAPLLELREKITGFRGSLEASLFSLSNGLHQRSD  140

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKG  628
            A  AREVL+LLL+TFHVVSKVEKLIK LP+  ++  N  AN     ++S+ +  Q  + G
Sbjct  141  AAAAREVLDLLLNTFHVVSKVEKLIKVLPTAPSDWQNEGANSLGRSFMSDDIPTQ--QDG  198

Query  629  SNLRETQSMHLERIASEMNRLKFYIAHA  712
            + +RETQSM LERIASEMNRL+FY+AHA
Sbjct  199  TTMRETQSMLLERIASEMNRLRFYMAHA  226



>ref|XP_009138596.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brassica 
rapa]
Length=758

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 164/211 (78%), Gaps = 9/211 (4%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            D F DP D++P  W  P LFLS  FD+E+YIS+LRT VP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPFLFLSPVFDSESYISELRTSVPFDTLRSELRSHLASLNRELVD  78

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFVSLSTKL D+D AVVRMRAPLL +R KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGLREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGY-LSNGVSFQHT--  619
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++         D G  L + VS +++  
Sbjct  139  AASAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQK-----EDGGVSLRSSVSVENSTQ  193

Query  620  EKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            + G+ +RETQSM LERIASEMNRLKFY+AHA
Sbjct  194  QDGTTMRETQSMLLERIASEMNRLKFYMAHA  224



>ref|XP_010464008.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=764

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 163/208 (78%), Gaps = 3/208 (1%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            + F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRS+LRSHL+SL R+LVD
Sbjct  26   EFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSQLRSHLASLNRELVD  84

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFV+LSTKL D+DAAV+RMRAPLLE+R KI+ FR +VE++L +L + L QR+D
Sbjct  85   LINRDYADFVNLSTKLVDIDAAVIRMRAPLLELREKITGFRGSVEAALFSLRNGLHQRSD  144

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKG  628
            A  +REVLELLL+TFHVVSKVEKLIK LP+   +  N  A       +S+ +  +  + G
Sbjct  145  AAASREVLELLLNTFHVVSKVEKLIKVLPTTPCHWQNEDAKSLVRSCMSDEIPTE--QDG  202

Query  629  SNLRETQSMHLERIASEMNRLKFYIAHA  712
            + +RETQSM LERIASE+NRLKFY+AHA
Sbjct  203  TTMRETQSMLLERIASEVNRLKFYMAHA  230



>ref|NP_001051898.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|AAO37946.1| putative conserved oligomeric Golgi complex component [Oryza 
sativa Japonica Group]
 gb|ABF99909.1| brefeldin A-sensitive Golgi protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13812.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|EAZ29309.1| hypothetical protein OsJ_13370 [Oryza sativa Japonica Group]
Length=754

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             APP   TDLFG+P +A+PP W  P  FL  DFD + Y++DLR++VPLD+L +ELRSHL+
Sbjct  7    AAPP--PTDLFGEPIEAHPP-WFKPDSFLRPDFDPDAYVADLRSYVPLDSLAAELRSHLA  63

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL+ +LV LINRDYADFV LS +L  VDAA  RMR PL E+R K+++FR A  + L+AL 
Sbjct  64   SLRAELVGLINRDYADFVGLSARLKGVDAAAARMRPPLAELRDKVASFRAAAAAGLAALR  123

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  604
            S L+QRA A  ARE+LELLLDT HVVSKVEKLIKELPS  ++ +N  A   D GY  N  
Sbjct  124  SGLEQRAAATAARELLELLLDTSHVVSKVEKLIKELPSAPSDSSNVEAVSGDKGYSGNVA  183

Query  605  SFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            +  + + G+++RETQS+ LERIASEMNRLKFYI+HA
Sbjct  184  TPPNMDDGTDVRETQSILLERIASEMNRLKFYISHA  219



>gb|EEC76534.1| hypothetical protein OsI_14326 [Oryza sativa Indica Group]
Length=754

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +2

Query  65   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  244
             APP   TDLFG+P +A+PP W  P  FL  DFD + Y++DLR++VPLD+L +ELRSHL+
Sbjct  7    AAPP--PTDLFGEPIEAHPP-WFKPDSFLRPDFDPDAYVADLRSYVPLDSLAAELRSHLA  63

Query  245  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  424
            SL+ +LV LINRDYADFV LS +L  VDAA  RMR PL E+R K+++FR A  + L+AL 
Sbjct  64   SLRAELVGLINRDYADFVGLSARLKGVDAAAARMRPPLAELRDKVASFRAAAAAGLAALR  123

Query  425  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  604
            + L+QRA A  ARE+LELLLDT HVVSKVEKLIKELPS  ++ +N  A   D GY  N  
Sbjct  124  AGLEQRAAATAARELLELLLDTSHVVSKVEKLIKELPSAPSDSSNVEAVSGDKGYSGNVA  183

Query  605  SFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
            +  + + G+++RETQS+ LERIASEMNRLKFYI+HA
Sbjct  184  TPPNMDDGTDVRETQSILLERIASEMNRLKFYISHA  219



>dbj|BAK01513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = +2

Query  89   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  268
            DLFG+  +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELRSHL++L+ +LV 
Sbjct  26   DLFGETIEAHPP-WFRPEAFLRAGFDPDAYVAELRSYVPLESLAAELRSHLAALRAELVG  84

Query  269  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  448
            LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR A  ++L+AL + L+QRA 
Sbjct  85   LINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAAFRAAASAALAALRAGLEQRAA  144

Query  449  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKG  628
            A +ARE+LELLLDT HVVSKVEKLIKELP+  ++ ++      D GY  N  +  + E G
Sbjct  145  ATQARELLELLLDTSHVVSKVEKLIKELPTAPSDSSDVEVRSVDKGYSGNDTTPSNVEAG  204

Query  629  SNLRETQSMHLERIASEMNRLKFYIAHA  712
            +++RETQS+ LERIASEMNRLKFYI+HA
Sbjct  205  TDVRETQSILLERIASEMNRLKFYISHA  232



>emb|CDY51233.1| BnaA03g07050D [Brassica napus]
Length=724

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 143/213 (67%), Gaps = 31/213 (15%)
 Frame = +2

Query  74   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  253
            PRSA D+F D  D+ PP W NP LFLS  FD+E++ISDLRTFVP DTLRSELRSHLSSL 
Sbjct  11   PRSAADVFWD--DSRPPLWFNPSLFLSPVFDSESFISDLRTFVPFDTLRSELRSHLSSLN  68

Query  254  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  433
             +LVD INRDYADFV+LS KL D+D   VRMRAPLLE+R +IS FR +VE +  A  S L
Sbjct  69   GELVDHINRDYADFVNLSAKLVDIDETAVRMRAPLLELREEISAFRGSVEDAHVARASGL  128

Query  434  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  613
             QR D G AREVLE  LD F VVSKVEKL++E   GAT                      
Sbjct  129  NQRNDTGAAREVLESSLDAFRVVSKVEKLLQEQQDGAT----------------------  166

Query  614  HTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                   +RE+QS+ LERIASE+NRLKF++ HA
Sbjct  167  -------MRESQSILLERIASELNRLKFHMTHA  192



>emb|CDX70811.1| BnaC03g08950D [Brassica napus]
Length=725

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 143/214 (67%), Gaps = 32/214 (15%)
 Frame = +2

Query  74   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDL-RTFVPLDTlrselrshlssl  250
            PRSA D+F D  D+ PP W NP  FLS  FD+E++ISDL RTFVP DTLRSELRSH++SL
Sbjct  11   PRSAADVFWD--DSRPPLWFNPSPFLSPVFDSESFISDLLRTFVPFDTLRSELRSHVTSL  68

Query  251  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  430
              +L+D INRDYADFV LSTKL D+DA   RMRAPLLE+R +I+TFR +VE++  A  S 
Sbjct  69   NSELLDRINRDYADFVDLSTKLVDIDATATRMRAPLLELRDEINTFRGSVEAARVARASG  128

Query  431  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  610
            L QR DA  AREVLE  L+ F VVSKVEKLI+E   GA+                     
Sbjct  129  LNQRYDAEAAREVLESSLEAFRVVSKVEKLIQEQQDGAST--------------------  168

Query  611  QHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                     RETQSM LERIASE+NR+KFY+ HA
Sbjct  169  ---------RETQSMVLERIASELNRIKFYMDHA  193



>ref|XP_009131654.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=724

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 140/213 (66%), Gaps = 31/213 (15%)
 Frame = +2

Query  74   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  253
            PRSA D+F D  D+ PP W NP LFLS  FD+E++ISDLRTFVP DTLRSELRSHLSSL 
Sbjct  11   PRSAADVFWD--DSRPPLWFNPSLFLSPVFDSESFISDLRTFVPFDTLRSELRSHLSSLN  68

Query  254  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  433
             +LV  INRDYADF +LS KL D+D   VRMRAP LE+R +IS FR +VE +  A  S L
Sbjct  69   GELVGHINRDYADFGNLSAKLVDIDETAVRMRAPPLELREEISAFRGSVEDAHVARASGL  128

Query  434  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  613
             QR D G AREVLE  LD F VVSKVEKL++E   GAT                      
Sbjct  129  NQRNDTGAAREVLESSLDAFRVVSKVEKLLQEQQDGAT----------------------  166

Query  614  HTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                   +RE+QSM LERIASE+NRLKF++ HA
Sbjct  167  -------MRESQSMLLERIASELNRLKFHMTHA  192



>ref|XP_004981048.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Setaria italica]
Length=751

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 154/209 (74%), Gaps = 10/209 (5%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TDLFG+P +A+PP W  P  FL  DFD + Y+++LR++VPL++L +ELR+HL++L+ +LV
Sbjct  20   TDLFGEPIEAHPP-WFKPDSFLRADFDPDAYVAELRSYVPLESLAAELRAHLAALRAELV  78

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
             LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR    ++L+AL + L+QRA
Sbjct  79   GLINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAGFRAGASAALAALRAGLEQRA  138

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
             A  ARE+LELLLDT HVVSKVEKLIKELPS  ++ +N      D          Q+ E 
Sbjct  139  AATAARELLELLLDTSHVVSKVEKLIKELPSAPSDSSNAEVPSIDA---------QNVEA  189

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQS+ LERIASEMNRLKFYI+HA
Sbjct  190  GTGVRETQSILLERIASEMNRLKFYISHA  218



>ref|NP_001169749.1| uncharacterized protein LOC100383630 [Zea mays]
 gb|ACN34776.1| unknown [Zea mays]
Length=522

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 156/215 (73%), Gaps = 9/215 (4%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APP  A DLFG+P +A+PP W  P  FL   FDA+ Y+++LR++VPLD+L +ELR+HL++
Sbjct  2    APP-PAMDLFGEPIEAHPP-WFKPDAFLRAGFDADAYVAELRSYVPLDSLAAELRAHLAA  59

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L+ +LV LINRDYADFV LS  L  VDAA  RMRAPL ++R K++ FR    ++L+AL  
Sbjct  60   LRAELVGLINRDYADFVGLSAHLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRE  119

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
             L+QRA A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G   NG  
Sbjct  120  GLQQRAAATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEIPINDTG-TPNG--  176

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                + G+ +RETQS+ LERIASEMNRLKFYI+HA
Sbjct  177  ----KAGTGVRETQSILLERIASEMNRLKFYISHA  207



>ref|XP_002463519.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
 gb|EER90517.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
Length=748

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 155/209 (74%), Gaps = 8/209 (4%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TDLFG+P +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELR+HL++L+ +LV
Sbjct  15   TDLFGEPIEAHPP-WFKPDAFLRAGFDPDAYVAELRSYVPLESLAAELRAHLAALRAELV  73

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
             LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR    ++L+AL + L+QRA
Sbjct  74   GLINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRAGLEQRA  133

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
             A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G + NG      E 
Sbjct  134  AATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEVPNNDTG-MPNG------EA  186

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
            G+ +RETQS+ LERIASEMNRLKFYI+HA
Sbjct  187  GTGVRETQSILLERIASEMNRLKFYISHA  215



>ref|XP_001761415.1| predicted protein [Physcomitrella patens]
 gb|EDQ73804.1| predicted protein [Physcomitrella patens]
Length=678

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 7/215 (3%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            +S   LF D  D++ P W     FLS  FDAE YISDLR FVP +TLR+ELR HL  L+ 
Sbjct  20   KSVASLFQD--DSSGPLWFKKDAFLSGSFDAEAYISDLRRFVPFETLRAELRDHLGGLKS  77

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
            +LV+LINRDYADFV+L+TKL DVD AV+RMR PL E+R K+   R+ V S+L  L   LK
Sbjct  78   ELVELINRDYADFVNLTTKLVDVDGAVLRMRMPLNELRGKLVVVRDNVNSTLLLLQDGLK  137

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKEL---PSGATNLANGIANYADNGYLSNGVS  607
            +RADA  +RE+L+LLLDT HVVSKVEKL+ EL   P     +     N       SN  S
Sbjct  138  RRADASASREMLDLLLDTSHVVSKVEKLLLELQSMPEEGPQVPPAERNDGFRRVYSN--S  195

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                E+G++  E +S  LERIASEMNRLKFY+A A
Sbjct  196  NLGEEQGASPEEARSRLLERIASEMNRLKFYVARA  230



>tpg|DAA52497.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=691

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 156/215 (73%), Gaps = 9/215 (4%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APP  A DLFG+P +A+PP W  P  FL   FDA+ Y+++LR++VPLD+L +ELR+HL++
Sbjct  7    APP-PAMDLFGEPIEAHPP-WFKPDAFLRAGFDADAYVAELRSYVPLDSLAAELRAHLAA  64

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L+ +LV LINRDYADFV LS  L  VDAA  RMRAPL ++R K++ FR    ++L+AL  
Sbjct  65   LRAELVGLINRDYADFVGLSAHLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRE  124

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
             L+QRA A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G   NG  
Sbjct  125  GLQQRAAATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEIPINDTG-TPNG--  181

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                + G+ +RETQS+ LERIASEMNRLKFYI+HA
Sbjct  182  ----KAGTGVRETQSILLERIASEMNRLKFYISHA  212



>ref|XP_008645319.1| PREDICTED: uncharacterized protein LOC100383630 isoform X1 [Zea 
mays]
 tpg|DAA52498.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=745

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 156/215 (73%), Gaps = 9/215 (4%)
 Frame = +2

Query  68   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  247
            APP  A DLFG+P +A+PP W  P  FL   FDA+ Y+++LR++VPLD+L +ELR+HL++
Sbjct  7    APP-PAMDLFGEPIEAHPP-WFKPDAFLRAGFDADAYVAELRSYVPLDSLAAELRAHLAA  64

Query  248  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  427
            L+ +LV LINRDYADFV LS  L  VDAA  RMRAPL ++R K++ FR    ++L+AL  
Sbjct  65   LRAELVGLINRDYADFVGLSAHLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRE  124

Query  428  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  607
             L+QRA A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G   NG  
Sbjct  125  GLQQRAAATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEIPINDTG-TPNG--  181

Query  608  FQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                + G+ +RETQS+ LERIASEMNRLKFYI+HA
Sbjct  182  ----KAGTGVRETQSILLERIASEMNRLKFYISHA  212



>ref|XP_001764075.1| predicted protein [Physcomitrella patens]
 gb|EDQ71214.1| predicted protein [Physcomitrella patens]
Length=761

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 141/213 (66%), Gaps = 3/213 (1%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            +S   LF D  D + P W     F +  FD E YISDLR FVP +TLR+ELR HL  L+ 
Sbjct  20   KSVAFLFED--DTSGPLWFKKDAFSNASFDPEAYISDLRRFVPFETLRAELRDHLGGLKS  77

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
            +LV+LINRDYADFV+LSTKL DVD AV+RMR PL E+R K+ + R+ V S+L  L   LK
Sbjct  78   ELVELINRDYADFVNLSTKLVDVDGAVLRMRMPLNELRGKLVSVRDNVNSTLLLLQDGLK  137

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS-NGVSFQ  613
            +R+DA  +RE LELLLDT HVVSKVEKL+ EL     +    +    ++G+   N  +  
Sbjct  138  RRSDASASRETLELLLDTCHVVSKVEKLLLELQCMPEDGPQPLQIEKNDGFRKVNSNNNL  197

Query  614  HTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
              + G++L E +S  LERIASEMNRLKFY+A A
Sbjct  198  GEDHGASLEEPRSRLLERIASEMNRLKFYVARA  230



>ref|XP_003562360.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brachypodium 
distachyon]
Length=759

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 158/209 (76%), Gaps = 1/209 (0%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  265
            TDLFG+P +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELR+HL++L+ +LV
Sbjct  17   TDLFGEPIEAHPP-WFRPDAFLRAGFDPDAYVTELRSYVPLESLAAELRAHLAALRAELV  75

Query  266  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  445
             LINRDYADFV LS +L  VDAA  RMRAPL E+R K++ FR A  ++L+AL + L+QRA
Sbjct  76   GLINRDYADFVGLSARLKGVDAAAARMRAPLAELRDKVAAFRAAASAALAALRAGLEQRA  135

Query  446  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK  625
             A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D GY  N V+  + E 
Sbjct  136  AAAAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEVVSVDKGYSGNDVTPSNVEA  195

Query  626  GSNLRETQSMHLERIASEMNRLKFYIAHA  712
             +++RETQS+ +ERIASEMNRLKFYI+HA
Sbjct  196  RTDVRETQSILVERIASEMNRLKFYISHA  224



>ref|XP_002966110.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
 gb|EFJ32137.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
Length=714

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 141/209 (67%), Gaps = 13/209 (6%)
 Frame = +2

Query  83   ATDLFGDPTDANP-PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrD  259
            A+ LFGD  D +P P W     F+  DFD + +IS LR+FVPL+ LR ELRSHL++L+ +
Sbjct  2    ASMLFGD--DPDPLPLWFKKDAFMDPDFDCDAHISSLRSFVPLEALRGELRSHLAALKNE  59

Query  260  LVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  439
            LV+LINRDY DFVSLST+L DVD AV+RMR PL E+R K+ T R+ V+ +L AL   LK+
Sbjct  60   LVELINRDYNDFVSLSTQLVDVDGAVLRMRTPLQELRGKLVTVRDGVDGALLALQDALKR  119

Query  440  RADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHT  619
            R++A  +RE+LELLLDT HVVSK+EKL+ EL            N   NG L +G      
Sbjct  120  RSEASASREILELLLDTSHVVSKIEKLLLELKE----------NRISNGNLVSGSEGSMD  169

Query  620  EKGSNLRETQSMHLERIASEMNRLKFYIA  706
               ++  + +S  LERIASEMNRLKFY+A
Sbjct  170  PVDNSGDDPRSRLLERIASEMNRLKFYVA  198



>ref|XP_002982190.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
 gb|EFJ16858.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
Length=714

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 141/209 (67%), Gaps = 13/209 (6%)
 Frame = +2

Query  83   ATDLFGDPTDANP-PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrD  259
            A+ LFGD  D +P P W     F+  DFD + +IS LR+FVPL+ LR ELRSHL++L+ +
Sbjct  2    ASMLFGD--DPDPLPLWFKKDAFMDPDFDCDAHISSLRSFVPLEALRGELRSHLAALKNE  59

Query  260  LVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  439
            LV+LINRDY DFVSLST+L DVD AV+RMR PL E+R K+ T R+ V+ +L AL   LK+
Sbjct  60   LVELINRDYNDFVSLSTQLVDVDGAVLRMRTPLQELRGKLVTVRDGVDGALLALQDALKR  119

Query  440  RADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHT  619
            R++A  +RE+LELLLDT HVVSK+EKL+ EL            N   NG L +G      
Sbjct  120  RSEASASREILELLLDTSHVVSKIEKLLLELKE----------NRISNGNLVSGSEGSLD  169

Query  620  EKGSNLRETQSMHLERIASEMNRLKFYIA  706
               ++  + +S  LERIASEMNRLKFY+A
Sbjct  170  PVDNSGDDPRSRLLERIASEMNRLKFYVA  198



>ref|XP_008644331.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Zea mays]
 gb|AFW66981.1| hypothetical protein ZEAMMB73_946461 [Zea mays]
Length=739

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 156/210 (74%), Gaps = 8/210 (4%)
 Frame = +2

Query  83   ATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDL  262
            ATDLFG+P +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELR+HL +L+ +L
Sbjct  5    ATDLFGEPIEAHPP-WFKPDAFLRASFDPDAYVAELRSYVPLESLAAELRAHLDALRAEL  63

Query  263  VDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQR  442
            V LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR    ++L+AL + L+QR
Sbjct  64   VGLINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRAGLEQR  123

Query  443  ADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTE  622
            A A  ARE+LELLLD FHVVSKVEKLIKELP+  ++L+N     +D G   NGV+     
Sbjct  124  AAAAAARELLELLLDAFHVVSKVEKLIKELPTAPSDLSNAEVPNSDTG-TPNGVA-----  177

Query  623  KGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             G+ + ETQS+ LERIASEMNRLKFYI+HA
Sbjct  178  -GTGVSETQSILLERIASEMNRLKFYISHA  206



>gb|KHN14099.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=658

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  344  MRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLI  523
            MRAPL+E+R KI  FR +VE SL A+ +RL+QR++   ARE LELLLD FHVVSKVEKLI
Sbjct  1    MRAPLVELRDKIEQFRGSVEVSLVAIKNRLRQRSEVASARETLELLLDAFHVVSKVEKLI  60

Query  524  KELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYI  703
            KELPS  T+ +NG  N ++   LSNGVS QH E    +RETQSM LERIASEMNRLKFY+
Sbjct  61   KELPSVPTDWSNGDVNLSERNNLSNGVSAQHVENEMIIRETQSMLLERIASEMNRLKFYV  120

Query  704  AHA  712
             HA
Sbjct  121  THA  123



>gb|KEH35882.1| oligomeric component, putative [Medicago truncatula]
Length=179

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 112/193 (58%), Gaps = 28/193 (15%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            R+ T+LF DP       W  P  FLS +FD+E+YIS L TFVP  TLRS+L ++LSSL  
Sbjct  10   RTVTNLFSDPL------WFKPEPFLSPNFDSESYISQLPTFVPFHTLRSQLNNYLSSLNH  63

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
             L+ LINRDY+DF +L+  + DVD  VV       E   K                    
Sbjct  64   QLIHLINRDYSDFANLTANIVDVDDVVVPACGAAGEYSAK--------------------  103

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  616
              + A  ARE LE LL +FH+VSKVEKLIKELP+  ++ +NG  N      LSNGV+ QH
Sbjct  104  --SQAASARETLEFLLYSFHLVSKVEKLIKELPTVHSDWSNGGVNLLKKSSLSNGVTVQH  161

Query  617  TEKGSNLRETQSM  655
             E G++LRETQSM
Sbjct  162  VENGTSLRETQSM  174



>ref|XP_002947088.1| component of oligomeric golgi complex 2 [Volvox carteri f. nagariensis]
 gb|EFJ51678.1| component of oligomeric golgi complex 2 [Volvox carteri f. nagariensis]
Length=1174

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 128/199 (64%), Gaps = 4/199 (2%)
 Frame = +2

Query  113  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  292
            A  P WLNP  FL+ DF+A+  ++DLR +VPL TL++EL S+L++L+  LV++IN DYAD
Sbjct  22   AGCPVWLNPERFLAPDFNADACVADLRRYVPLATLQNELSSYLATLKTKLVEVINEDYAD  81

Query  293  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  472
            +V LS +L +V+ +VVRMR PLL++R K+   +EAV S L++L+  L++R +    R +L
Sbjct  82   YVGLSGRLANVEGSVVRMRKPLLDLRDKLHAVQEAVRSELNSLNQGLRKRKEVATQRALL  141

Query  473  ELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRE---  643
            EL+L+  HV +KV+KL++EL +   + +   A  A+        S   +  GS   +   
Sbjct  142  ELILEVSHVAAKVDKLLEELAASDRSGSTTPAAAANGAAPGGPASADGSGAGSGTSDAEL  201

Query  644  -TQSMHLERIASEMNRLKF  697
              Q   LER+A+E++RL F
Sbjct  202  LAQCRMLERVAAEVSRLAF  220



>ref|XP_005644140.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19596.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
Length=752

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 114/197 (58%), Gaps = 25/197 (13%)
 Frame = +2

Query  122  PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVS  301
            P W NP  F+   FDAETY++DLR +VPL+ L SEL +HL  L+  LV++IN  Y DFVS
Sbjct  24   PHWFNPERFVEPQFDAETYVADLRRYVPLEALSSELEAHLQVLRNRLVEVINEHYGDFVS  83

Query  302  LSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELL  481
            LS+KL +VD+AV+RM+ PL EI+ K+   R  V ++L AL   L++R     A+ +LEL+
Sbjct  84   LSSKLVNVDSAVIRMQKPLTEIKEKLLGVRGEVTAALDALREGLERRQSVASAKALLELM  143

Query  482  LDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEK----GSNLRETQ  649
             DT HV+SKVEKL+ E+                       +  Q  EK    G    + +
Sbjct  144  QDTAHVMSKVEKLLAEI---------------------QAMEGQSPEKPGPVGRGGLDGR  182

Query  650  SMHLERIASEMNRLKFY  700
                ER+ASE+ RL FY
Sbjct  183  VRMFERLASEVARLNFY  199



>ref|XP_003603203.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
Length=798

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 112/193 (58%), Gaps = 28/193 (15%)
 Frame = +2

Query  77   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  256
            R+ T+LF DP       W  P  FLS +FD+E+YIS L TFVP  TLRS+L ++LSSL  
Sbjct  10   RTVTNLFSDPL------WFKPEPFLSPNFDSESYISQLPTFVPFHTLRSQLNNYLSSLNH  63

Query  257  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  436
             L+ LINRDY+DF +L+  + DVD  VV       E   K                    
Sbjct  64   QLIHLINRDYSDFANLTANIVDVDDVVVPACGAAGEYSAK--------------------  103

Query  437  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  616
              + A  ARE LE LL +FH+VSKVEKLIKELP+  ++ +NG  N      LSNGV+ QH
Sbjct  104  --SQAASARETLEFLLYSFHLVSKVEKLIKELPTVHSDWSNGGVNLLKKSSLSNGVTVQH  161

Query  617  TEKGSNLRETQSM  655
             E G++LRETQSM
Sbjct  162  VENGTSLRETQSM  174



>ref|XP_001695227.1| component of oligomeric golgi complex 2 [Chlamydomonas reinhardtii]
 gb|EDP01935.1| component of oligomeric golgi complex 2 [Chlamydomonas reinhardtii]
Length=567

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 125/200 (63%), Gaps = 20/200 (10%)
 Frame = +2

Query  113  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  292
            A  P WLNP  FL ++F+A+  ++DLR +VPL TL++EL S+L++L+  LV++IN DYAD
Sbjct  23   AACPVWLNPERFLEQEFNADACVADLRRYVPLATLQNELSSYLATLKTKLVEVINEDYAD  82

Query  293  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  472
            +V LS +L +V+ AVVRMR PLLE+R K+   +EAV + L++L+  L++R +    R +L
Sbjct  83   YVGLSGRLANVEGAVVRMRKPLLELRDKLHAVQEAVRTELNSLNQGLRKRKEVATQRALL  142

Query  473  ELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQS  652
            EL+L+  HV +K  +L++ + +  + LA          +L+N        KG +L   +S
Sbjct  143  ELILEVAHVAAKC-RLLERVAAEVSRLA----------FLAN--------KGKDLAFVRS  183

Query  653  MHLERIASEMNRLKFYIAHA  712
            +   RIA+    L+ ++  A
Sbjct  184  LE-PRIAAHRAALRGHLGEA  202



>ref|XP_005848758.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
 gb|EFN56656.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
Length=767

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 114/195 (58%), Gaps = 22/195 (11%)
 Frame = +2

Query  128  WLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLS  307
            W  P LF   +F    Y+SDL+ +VPL+TL SEL SHL +L+  LV++IN DY DFVSLS
Sbjct  31   WFKPELFTEPEFSPVGYVSDLKRYVPLETLSSELHSHLGALKNKLVEVINDDYNDFVSLS  90

Query  308  TKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLD  487
            TKL +VD A+ RM+ PLLE++ K+   R  +    + L S L++R     AR +LEL+ D
Sbjct  91   TKLVNVDGALTRMQKPLLELQEKLEAARGGIAGQAAELQSGLQRRQTVAAARALLELMQD  150

Query  488  TFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLER  667
            T HV+SKV+KL+ E+ +               G +  G S +  E    L       L+R
Sbjct  151  TAHVMSKVDKLLGEVRAA--------------GEVGGG-SPEELEAHCRL-------LDR  188

Query  668  IASEMNRLKFYIAHA  712
            +ASE++RL+F+ A  
Sbjct  189  VASEVSRLQFFAARG  203



>ref|XP_011431284.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Crassostrea gigas]
 gb|EKC22030.1| Conserved oligomeric Golgi complex subunit 2 [Crassostrea gigas]
Length=735

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 112/211 (53%), Gaps = 33/211 (16%)
 Frame = +2

Query  98   GDPTDANP------PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrD  259
            GDP    P          +  +F+ E+FD + ++ + R  VPL+ LR +L ++L  L+  
Sbjct  3    GDPNKGLPLPSGPASLCFDKDVFMQENFDVDQFVMECRRRVPLENLRDDLNTYLKILRSA  62

Query  260  LVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  439
            +++LIN+DYADFV+LST L  +D A+  +  PL  ++ +I T + A+E ++ A+  +LK+
Sbjct  63   MIELINKDYADFVNLSTNLVGMDKAIGNLTTPLEHLKEEIMTVKTAMEDAILAVEEKLKK  122

Query  440  RADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHT  619
            R    + +  L+ L++  H V K+EKL+  + SG  + + G      NG L         
Sbjct  123  REQIRQKKASLQRLMNIIHSVEKIEKLLG-IHSGDHSSSTGQL----NGQL---------  168

Query  620  EKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
                         +ER+A+E N+L+FY+  +
Sbjct  169  -------------IERVANEFNKLQFYVTKS  186



>ref|XP_007510910.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66470.1| predicted protein [Bathycoccus prasinos]
Length=955

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = +2

Query  122  PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVS  301
            P W +P +F  +DF+ + YI ++  FV  + L  E+  +   LQ  LV+++NRDY DFV+
Sbjct  61   PAWFDPHVFEKDDFNPDVYIDEMSPFVTPEDLAVEVEKYADDLQNKLVEMVNRDYKDFVA  120

Query  302  LSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELL  481
            L+T L DVDA V  ++ PL  ++ ++   R+ V+  L  L + L +R +    RE LEL+
Sbjct  121  LTTDLVDVDAYVKDIKEPLEVLKGEVEEARDVVKKELEKLQNALDRRDELARERESLELI  180

Query  482  LDTFHVVSKVEKLIKEL  532
            ++   V SKVE+L++E 
Sbjct  181  MEATTVCSKVERLLEEF  197



>ref|XP_002613283.1| hypothetical protein BRAFLDRAFT_113783 [Branchiostoma floridae]
 gb|EEN69292.1| hypothetical protein BRAFLDRAFT_113783 [Branchiostoma floridae]
Length=651

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 105/191 (55%), Gaps = 28/191 (15%)
 Frame = +2

Query  143  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  322
            +F+ E+FD + ++++ R  V L+TLR +L  +   L+  +++LIN+DYADFV+LST L  
Sbjct  19   VFMKENFDVDQFVAECRRRVSLETLREDLEVYYKLLRSAMIELINKDYADFVNLSTNLVG  78

Query  323  VDAAVVRMRAPLLEIRHKI-STFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHV  499
            +D A+  +  PL ++R ++  T R A+++++  + +RL  R+   + +  L+ L++  H 
Sbjct  79   MDKAINNLSVPLGQLREEVMQTVRTAMDTAVQEIENRLATRSAIRDKKACLQRLMNITHS  138

Query  500  VSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASE  679
            V K+EK++               +  D G            +G   RE     +ER+A+E
Sbjct  139  VEKIEKIL---------------DIQDQG------------QGDGERELTGQLIERVATE  171

Query  680  MNRLKFYIAHA  712
             N+L+FY+  +
Sbjct  172  FNQLQFYVTQS  182



>ref|XP_002158309.2| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Hydra vulgaris]
Length=677

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 104/186 (56%), Gaps = 22/186 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            FL  +F+ + ++S  +   PL TLR +L +H  ++Q  LV+LINRDYADFVSLS+ L   
Sbjct  23   FLDTNFNVDKFVSKYKDLFPLSTLREDLETHYKNIQLALVELINRDYADFVSLSSNLIGT  82

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D  +  ++ PLLEI+ K++  R+ V + L +L  +L++R    E +  L+ L++  H V 
Sbjct  83   DKTIESLKEPLLEIKSKVAVVRDDVSTVLQSLKEKLEKRKLVREKKLYLKHLMNLVHSVE  142

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++      A +L +  A    N         + T+ G         +LERIA E N
Sbjct  143  KIEKIL------AADLKSPDAEILFNQ--------ERTQPGH--------YLERIAGEYN  180

Query  686  RLKFYI  703
            +L+F++
Sbjct  181  QLQFHV  186



>ref|XP_002969327.1| hypothetical protein SELMODRAFT_7944, partial [Selaginella moellendorffii]
 gb|EFJ29415.1| hypothetical protein SELMODRAFT_7944, partial [Selaginella moellendorffii]
Length=98

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ + FD +T+IS L +F+PL+ L  ELRSHL++L+ +L++LIN+DY DF+SLST+L DV
Sbjct  1    FIFQGFDCDTHISSLCSFMPLEALHDELRSHLATLKNELIELINKDYKDFMSLSTQLVDV  60

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  439
            D AV+ M  PL E+R K+ T R  V+  L  L   LKQ
Sbjct  61   DGAVLWMCTPLQELRGKLVTMRNGVDGVLLVLQDALKQ  98



>ref|XP_002970804.1| hypothetical protein SELMODRAFT_7940, partial [Selaginella moellendorffii]
 gb|EFJ28130.1| hypothetical protein SELMODRAFT_7940, partial [Selaginella moellendorffii]
Length=98

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ + FD +T+IS L +F+PL  L  ELRSHL++L+ +L++LIN+DY DFVSLS +L DV
Sbjct  1    FIFQGFDCDTHISSLCSFMPLKALHGELRSHLAALKNELIELINKDYKDFVSLSMQLVDV  60

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  439
            D AV+RM  PL E+R K+ T R  V+  L  L    KQ
Sbjct  61   DGAVLRMCTPLQELRGKLVTVRNGVDGVLLVLQDAFKQ  98



>ref|XP_009346519.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Pyrus x bretschneideri]
Length=599

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +2

Query  515  KLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLK  694
            KLIKELPS   +  NG  N A+   +SNG S QHTE G+NLR+TQSM LERIASEMNRLK
Sbjct  1    KLIKELPSA--DWLNGDVNLAEKNSISNGASLQHTENGTNLRDTQSMLLERIASEMNRLK  58

Query  695  FYIAHA  712
            FY AHA
Sbjct  59   FYFAHA  64



>ref|XP_011401872.1| Conserved oligomeric Golgi complex subunit 2 [Auxenochlorella 
protothecoides]
 gb|KFM28823.1| Conserved oligomeric Golgi complex subunit 2 [Auxenochlorella 
protothecoides]
Length=745

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 98/194 (51%), Gaps = 26/194 (13%)
 Frame = +2

Query  122  PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVS  301
            P W  P  F    F A TY++DL+ +V          +HLS L  DLV++IN+DY  F+ 
Sbjct  14   PAWFKPGEFADPAFSAATYVADLQQYV-------RGSAHLSVLHGDLVEVINKDYEGFLH  66

Query  302  LSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELL  481
            L+++LT V  AV R+  PL  ++ + S  R+A+ +   AL   L  RADA  +R +LEL+
Sbjct  67   LTSRLTSVQGAVKRIEGPLAVVKARASATRDALLAESHALTRGLAARADAAASRGLLELM  126

Query  482  LDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHL  661
             D  HV+SKV+KL+ ELP                     G +F          E Q   L
Sbjct  127  QDLTHVLSKVDKLLAELP-------------------PPGDAFLGKHSSPEAVEGQCHVL  167

Query  662  ERIASEMNRLKFYI  703
             R+ +E+ RL++ +
Sbjct  168  NRVTAEVARLQYQV  181



>gb|KFO34216.1| Conserved oligomeric Golgi complex subunit 2 [Fukomys damarensis]
Length=925

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 101/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  VPL+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  209  FMKEDFDVDHFVSDCRKRVPLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  268

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  269  DRALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  328

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T++       A +  L+  V                  LERIA+E N
Sbjct  329  KIEKILNSQTSKETSVLE-----ASSPLLTGQV------------------LERIATEFN  365

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  366  QLQFHAVQS  374



>ref|XP_010620223.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Fukomys 
damarensis]
Length=738

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 101/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  VPL+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVPLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T++       A +  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQTSKETSVLE-----ASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006652018.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Oryza brachyantha]
Length=693

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  485  DTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLE  664
            D  HVVSKVEKLIKELP+  ++ +NG     D GY  N  +  + E G+++RETQS+ LE
Sbjct  88   DASHVVSKVEKLIKELPTAPSDSSNG-----DKGYPGNTTTPPNVEAGTDVRETQSILLE  142

Query  665  RIASEMNRLKFYIAHA  712
            RIASEMNRLKFYI+HA
Sbjct  143  RIASEMNRLKFYISHA  158


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  86   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDT  214
            TDLFG+P +A+PP W  P  FL  DFD + Y++DLR++VPL++
Sbjct  15   TDLFGEPIEAHPP-WFKPASFLRADFDPDAYVADLRSYVPLES  56



>ref|XP_005106374.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Aplysia californica]
Length=795

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 106/189 (56%), Gaps = 27/189 (14%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ +DF+ + +I + +  VPL+TLR +L  +L  ++  +++LIN+DYADFV+LST L  +
Sbjct  26   FMKKDFEVDKFILECKKKVPLETLRDDLDLYLKVVRSAMIELINKDYADFVNLSTNLVGM  85

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+  +  PL +++ ++ + + A++ ++ A+  +++Q+ +    + +L+ L++  H V 
Sbjct  86   DKAITNLTVPLGQLKEEVLSVQTAMDEAILAVQEKIRQQQEIQRKKTMLQRLMNITHSVE  145

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+E+L+  +  GA  L+ G                          +     +ER+A+E N
Sbjct  146  KIERLLG-IQQGAEPLSPG--------------------------QLTGPLIERVATEFN  178

Query  686  RLKFYIAHA  712
            +L+FY+  +
Sbjct  179  KLQFYVTRS  187



>ref|XP_002113217.1| hypothetical protein TRIADDRAFT_26404 [Trichoplax adhaerens]
 gb|EDV23691.1| hypothetical protein TRIADDRAFT_26404 [Trichoplax adhaerens]
Length=723

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+SE+F+ + +I+  R+ V  + LR++L+++   L+  +V+LIN+DYADFV+LST L  +
Sbjct  36   FVSEEFNVDGFITSCRSSVSPEVLRNDLKTYFDILKSSMVELINKDYADFVNLSTNLVGL  95

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+  + APL +I+ ++ + ++ +  +++ ++ RLK+R +  E +  L+ LL+    V 
Sbjct  96   DKAISNISAPLEQIKTEVGSVKDCIGQAMNGINRRLKKRTELREKKARLQRLLNISDSVD  155

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSM  655
            K+EKL++   +   N+ +  +   + G+L   V+ +  +   NL +++ +
Sbjct  156  KIEKLLQISSTSPQNMMSASSEEENYGHLIERVAIEFNQLLFNLNQSKGL  205



>ref|XP_002931527.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Xenopus (Silurana) tropicalis]
Length=734

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 24/200 (12%)
 Frame = +2

Query  113  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  292
             +P    +   F+ + FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYAD
Sbjct  11   GSPSMCFDKDEFMKDGFDVDVFVSECRKRVQLETLRDDLELYYRLLKTAMVELINKDYAD  70

Query  293  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  472
            FV+LST L  +D A+ ++  PL ++R ++ + + +V   + A+ SRL ++ D    +  +
Sbjct  71   FVNLSTNLVGMDKALSQLSVPLGQLREEVLSLKTSVNEVIQAVDSRLAKQEDVRRKKMCV  130

Query  473  ELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQS  652
              +++  H V K+EK++    S  T L         + +L+  +                
Sbjct  131  LTMMEVIHSVEKIEKILHSQNSKETALE------VKSPHLTGQI----------------  168

Query  653  MHLERIASEMNRLKFYIAHA  712
              LERIA+E N+L+F+   +
Sbjct  169  --LERIATEFNQLQFHAVQS  186



>ref|XP_004914700.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Xenopus (Silurana) tropicalis]
Length=735

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 24/200 (12%)
 Frame = +2

Query  113  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  292
             +P    +   F+ + FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYAD
Sbjct  11   GSPSMCFDKDEFMKDGFDVDVFVSECRKRVQLETLRDDLELYYRLLKTAMVELINKDYAD  70

Query  293  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  472
            FV+LST L  +D A+ ++  PL ++R ++ + + +V   + A+ SRL ++ D    +  +
Sbjct  71   FVNLSTNLVGMDKALSQLSVPLGQLREEVLSLKTSVNEVIQAVDSRLAKQEDVRRKKMCV  130

Query  473  ELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQS  652
              +++  H V K+EK++    S  T L         + +L+  +                
Sbjct  131  LTMMEVIHSVEKIEKILHSQNSKETALE------VKSPHLTGQI----------------  168

Query  653  MHLERIASEMNRLKFYIAHA  712
              LERIA+E N+L+F+   +
Sbjct  169  --LERIATEFNQLQFHAVQS  186



>ref|XP_010996258.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Camelus 
dromedarius]
Length=740

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 101/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR++L  +   L+  +V+LINRDYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRADLELYYKLLKTAMVELINRDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQNSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007936688.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Orycteropus 
afer afer]
Length=738

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +++LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMIELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVEERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+   G      N  L  G                   LERIA+E N
Sbjct  142  KIEKILNSQSSKETSALEG------NSPLLTG-----------------QILERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005405048.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Chinchilla lanigera]
Length=738

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIQSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005405049.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Chinchilla lanigera]
Length=737

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIQSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006212446.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Vicugna pacos]
Length=712

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 101/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            +L EDFD + ++SD R  V L+ LR++L  +   L+  +V+LINRDYADFV+LST L  +
Sbjct  22   YLQEDFDVDHFVSDCRKRVQLEELRADLELYYKLLKTAMVELINRDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQNSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_009055731.1| hypothetical protein LOTGIDRAFT_232605 [Lottia gigantea]
 gb|ESO93530.1| hypothetical protein LOTGIDRAFT_232605 [Lottia gigantea]
Length=744

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/189 (28%), Positives = 104/189 (55%), Gaps = 20/189 (11%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+   FD + ++ + R  V L+TLR +L  +L  L+  +++LIN+DYADFV+LST L  +
Sbjct  25   FMKPGFDVDQFVLECRRRVQLETLRDDLNIYLKILKSAMIELINKDYADFVNLSTNLVGM  84

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+  +  PL +++ ++ + R A++ ++  +  +LKQ+ D    +  L+ L++    V 
Sbjct  85   DKAIGHLTVPLGQLKEEVMSVRSAMDEAIEIVEQKLKQQKDIQHKKACLQRLMNITESVE  144

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EKL+         + +G++++++ G                  +     +ER+A+E N
Sbjct  145  KIEKLL--------GIHSGLSDHSEGGVT------------PTTGQLSGQLIERVATEFN  184

Query  686  RLKFYIAHA  712
            +L+FY+  +
Sbjct  185  KLQFYVTKS  193



>ref|XP_003410940.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Loxodonta 
africana]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004342492.2| hypothetical protein CAOG_08237 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE98244.1| hypothetical protein CAOG_008237 [Capsaspora owczarzaki ATCC 
30864]
Length=805

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 108/223 (48%), Gaps = 29/223 (13%)
 Frame = +2

Query  44   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  223
            P   + PG+ P +A     D   A               F  E +++  R  V L+ L +
Sbjct  65   PSHPNQPGSAPPTANAATSDAGAA---------------FHVEEFVAQCRQRVSLELLLA  109

Query  224  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  403
            +L+  L+SL  +LV+LINRDYADFV+LS+ L  +D A+  +RAPL  +R +++  R  VE
Sbjct  110  DLQVFLASLHSELVELINRDYADFVNLSSNLVGMDKAISDIRAPLWLMREEVTNVRAVVE  169

Query  404  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  583
             S+  + ++L QRA   E +  L L ++    + K+EKL+    S A +         D 
Sbjct  170  DSVMTVQAKLDQRAAVREKKATLTLFINVSASLEKIEKLLAPSSSTAASALAAPGAPVDE  229

Query  584  GYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
               +   S              +  +ER+ASE N+L+FY++  
Sbjct  230  STAAITAS--------------TRLIERVASEFNQLQFYVSQG  258



>ref|XP_005226618.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Bos taurus]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|NP_001070307.2| conserved oligomeric Golgi complex subunit 2 [Bos taurus]
 tpg|DAA14114.1| TPA: component of oligomeric golgi complex 2 [Bos taurus]
Length=739

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_002717435.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Oryctolagus 
cuniculus]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            FL EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FLKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQNSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_010852805.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Bison bison bison]
Length=739

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_010852806.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Bison bison bison]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004028611.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
1 [Gorilla gorilla gorilla]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_001148147.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pan troglodytes]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_002809356.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Pongo 
abelii]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004898237.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
 ref|XP_004854734.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
 gb|EHB11545.1| Conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
Length=738

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T++       A +  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQTSKETSVLE-----ASSPLLTGPV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_009439912.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pan troglodytes]
Length=737

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_008984063.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Callithrix jacchus]
Length=737

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_010372341.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Rhinopithecus roxellana]
Length=738

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|NP_031383.1| conserved oligomeric Golgi complex subunit 2 isoform 1 [Homo 
sapiens]
 sp|Q14746.1|COG2_HUMAN RecName: Full=Conserved oligomeric Golgi complex subunit 2; Short=COG 
complex subunit 2; AltName: Full=Component of oligomeric 
Golgi complex 2; AltName: Full=Low density lipoprotein 
receptor defect C-complementing protein [Homo sapiens]
 emb|CAA84427.1| Cog2 protein [Homo sapiens]
 gb|AAH14960.1| Component of oligomeric golgi complex 2 [Homo sapiens]
 gb|EAW69915.1| component of oligomeric golgi complex 2, isoform CRA_a [Homo 
sapiens]
 gb|ABM83170.1| component of oligomeric golgi complex 2 [synthetic construct]
 gb|ABM86371.1| component of oligomeric golgi complex 2 [synthetic construct]
 gb|ABW03786.1| component of oligomeric golgi complex 2 [synthetic construct]
 dbj|BAG35559.1| unnamed protein product [Homo sapiens]
 gb|AIC50874.1| COG2, partial [synthetic construct]
Length=738

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|NP_001138508.1| conserved oligomeric Golgi complex subunit 2 isoform 2 [Homo 
sapiens]
 gb|AAH51906.1| Component of oligomeric golgi complex 2 [Homo sapiens]
 gb|EAW69916.1| component of oligomeric golgi complex 2, isoform CRA_b [Homo 
sapiens]
Length=737

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_002760957.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Callithrix jacchus]
Length=738

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_010372342.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Rhinopithecus roxellana]
Length=737

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005320438.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Ictidomys 
tridecemlineatus]
Length=738

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRNKKMCVLRLMQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q+  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS---------------------ELEASSPLLTGQT--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004372879.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Trichechus 
manatus latirostris]
Length=738

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005005280.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Cavia porcellus]
Length=737

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 102/189 (54%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ E+FD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKENFDVDHFVSDCRKRVQLEDLRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  ++ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDEQMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A+N  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEANNPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006817460.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Saccoglossus kowalevskii]
Length=672

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 103/189 (54%), Gaps = 24/189 (13%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++++ R  VPL+TLR +L ++  SL+  +V+LIN+DYADFV+LS+ L  +
Sbjct  24   FMQVDFDVDQFVAECRRHVPLETLRDDLDTYFKSLKSAMVELINKDYADFVNLSSNLVGM  83

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+  +  PL ++R ++   R ++  ++  +  +L  R +  + +  L+ L +    V 
Sbjct  84   DKAINNLSVPLGQLREEVLAVRNSMTDAMQVVEKKLIARTEIRKKKATLQRLQNIIQSVD  143

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK+++    G      G+ + +            H+E    L       +ER+ASE N
Sbjct  144  KMEKILQIQKPG-----EGMEHVS------------HSELTGQL-------IERVASEFN  179

Query  686  RLKFYIAHA  712
            +L+FY+  +
Sbjct  180  QLQFYVTQS  188



>ref|XP_003473537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Cavia porcellus]
Length=738

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 102/189 (54%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ E+FD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKENFDVDHFVSDCRKRVQLEDLRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  ++ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDEQMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A+N  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEANNPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006937851.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Felis catus]
Length=737

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T++       A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETSVLE-----ASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_003993981.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Felis catus]
Length=738

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T++       A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETSVLE-----ASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006888781.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Elephantulus edwardii]
Length=738

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 102/189 (54%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    R+    +L    V+ 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERMSKQDD---IRKKKMCVLRLIQVIR  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S ++   +G+   A +  L+  +                  LERIA+E N
Sbjct  139  SVEKIEKILTSQSSKETSGLE--ASSPLLTGKI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005539861.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Macaca fascicularis]
Length=737

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_003893831.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Papio 
anubis]
Length=738

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_002808309.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2-like [Macaca mulatta]
 ref|XP_005539860.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Macaca fascicularis]
 gb|EHH15962.1| hypothetical protein EGK_02145 [Macaca mulatta]
 gb|EHH61454.1| hypothetical protein EGM_20105 [Macaca fascicularis]
Length=738

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004426945.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Ceratotherium 
simum simum]
Length=739

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++   R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLNLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007450662.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Lipotes vexillifer]
Length=738

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 100/193 (52%), Gaps = 31/193 (16%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMH----LERIA  673
            K+EK++                             QH+++ S L  +  +     LERIA
Sbjct  142  KIEKILNS---------------------------QHSKETSALEASSPLLTGQILERIA  174

Query  674  SEMNRLKFYIAHA  712
            +E N+L+F+   +
Sbjct  175  TEFNQLQFHAVQS  187



>ref|XP_007450661.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Lipotes vexillifer]
Length=739

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 100/193 (52%), Gaps = 31/193 (16%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMH----LERIA  673
            K+EK++                             QH+++ S L  +  +     LERIA
Sbjct  142  KIEKILNS---------------------------QHSKETSALEASSPLLTGQILERIA  174

Query  674  SEMNRLKFYIAHA  712
            +E N+L+F+   +
Sbjct  175  TEFNQLQFHAVQS  187



>ref|XP_006065100.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Bubalus bubalis]
Length=739

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRLSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIQSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006065101.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Bubalus bubalis]
Length=738

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRLSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIQSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004310291.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tursiops 
truncatus]
Length=739

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 100/193 (52%), Gaps = 31/193 (16%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMH----LERIA  673
            K+EK++                             QH+++ S L  +  +     LERIA
Sbjct  142  KIEKILNS---------------------------QHSKETSALEASSPLLTGQILERIA  174

Query  674  SEMNRLKFYIAHA  712
            +E N+L+F+   +
Sbjct  175  TEFNQLQFHAVQS  187



>ref|XP_010196213.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Colius striatus]
 gb|KFP30106.1| Conserved oligomeric Golgi complex subunit 2 [Colius striatus]
Length=740

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDQFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMAKQED---IRRKKVCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  LS G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---KELSSLEGNSSLSTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005958561.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pantholops hodgsonii]
Length=739

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFVSLS  L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVSLSANLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006531536.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Mus musculus]
Length=574

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S  VS Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDVSSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_010196214.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Colius striatus]
Length=739

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDQFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMAKQED---IRRKKVCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  LS G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---KELSSLEGNSSLSTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005958562.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pantholops hodgsonii]
Length=738

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFVSLS  L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVSLSANLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_008687758.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Ursus maritimus]
Length=739

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSKETS---------------------ALEASSPLWTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_008687757.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Ursus maritimus]
Length=740

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSKETS---------------------ALEASSPLWTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_002927656.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Ailuropoda melanoleuca]
Length=739

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSKETS---------------------ALEASSPLWTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>dbj|BAE34057.1| unnamed protein product [Mus musculus]
Length=553

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S  VS Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDVSSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004640874.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Octodon degus]
Length=738

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+        A +  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETSTLE-----ASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004281614.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Orcinus 
orca]
Length=739

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 99/193 (51%), Gaps = 31/193 (16%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRRKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMH----LERIA  673
            K+EK++                             QH+++ S L  +  +     LERIA
Sbjct  142  KIEKILNS---------------------------QHSKETSALEASSPLLTGQILERIA  174

Query  674  SEMNRLKFYIAHA  712
            +E N+L+F+   +
Sbjct  175  TEFNQLQFHAVQS  187



>ref|XP_011233523.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Ailuropoda melanoleuca]
Length=740

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSKETS---------------------ALEASSPLWTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005602674.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Equus caballus]
Length=739

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVIEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_001497419.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Equus caballus]
 ref|XP_008533779.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Equus przewalskii]
Length=740

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVIEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>dbj|BAE42634.1| unnamed protein product [Mus musculus]
Length=731

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S  VS Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDVSSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004640875.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Octodon degus]
Length=737

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+        A +  L+  V                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETSTLE-----ASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005602673.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Equus caballus]
 ref|XP_008533778.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Equus przewalskii]
Length=741

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVIEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004404911.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Odobenus 
rosmarus divergens]
Length=739

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSKETS---------------------ALEASSPLWTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|NP_084022.2| conserved oligomeric Golgi complex subunit 2 [Mus musculus]
 sp|Q921L5.2|COG2_MOUSE RecName: Full=Conserved oligomeric Golgi complex subunit 2; Short=COG 
complex subunit 2; AltName: Full=Component of oligomeric 
Golgi complex 2; AltName: Full=Low density lipoprotein 
receptor defect C-complementing protein [Mus musculus]
 dbj|BAE41054.1| unnamed protein product [Mus musculus]
Length=731

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S  VS Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDVSSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>gb|AAH11435.1| Component of oligomeric golgi complex 2 [Mus musculus]
Length=731

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S  VS Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDVSSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>gb|EDL11770.1| component of oligomeric golgi complex 2 [Mus musculus]
Length=731

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S  VS Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDVSSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>dbj|BAC40996.1| unnamed protein product [Mus musculus]
Length=732

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S  VS Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDVSSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005291293.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Chrysemys 
picta bellii]
Length=767

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 106/218 (49%), Gaps = 24/218 (11%)
 Frame = +2

Query  62   PGAPPRSATDLFGDPTDANPPQ-WLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrsh  238
            PGA PR+  +  G      P     +   F+  DFD + ++SD R  V L+ LR +L  +
Sbjct  21   PGAGPRAGMEARGMCLPRGPGNLCFDKDEFMKPDFDVDHFVSDCRKRVQLEELRDDLELY  80

Query  239  lsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSA  418
               L+  +V+LIN+DYADFV+LST L  +D A+ ++  PL ++R ++ + +  V   + A
Sbjct  81   YKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVMSLKSCVSEGIRA  140

Query  419  LHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSN  598
            +   + ++ D    +  +  L+     V K+EK++    S   +L       A++  L+ 
Sbjct  141  VDEHMSKQEDIRRKKMCVLRLIQVIQSVEKIEKILHSQSSKELSLLE-----ANSPLLTG  195

Query  599  GVSFQHTEKGSNLRETQSMHLERIASEMNRLKFYIAHA  712
             +                  LERIA+E N+L+F+   +
Sbjct  196  QI------------------LERIATEFNQLQFHAVQS  215



>ref|XP_010705329.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Meleagris 
gallopavo]
Length=739

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSECRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R  V   + A+  RL ++ D    R+    +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAIDDRLSKQED---IRKKKVCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T   N ++    N  L  G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---NELSTLEGNSPLLTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004935546.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Gallus gallus]
Length=738

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSECRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R  V   + A+  RL ++ D    R+    +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAIDDRLSKQED---IRKKKVCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T   N ++    N  L  G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---NELSTLEGNSPLLTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004659682.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Jaculus 
jaculus]
Length=738

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSKETS---------------------SLEASSPLLTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_419583.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Gallus gallus]
Length=739

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSECRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R  V   + A+  RL ++ D    R+    +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAIDDRLSKQED---IRKKKVCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T   N ++    N  L  G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---NELSTLEGNSPLLTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004690717.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Condylura 
cristata]
Length=680

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMYKQEDIRKKKMCVLRLMQVLQSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A    +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEVSSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>gb|ELR48452.1| Conserved oligomeric Golgi complex subunit 2, partial [Bos mutus]
Length=718

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            +  EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  1    YFQEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  60

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  61   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  120

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  121  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  157

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  158  QLQFHAVQS  166



>ref|XP_006146049.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tupaia 
chinensis]
 gb|ELW68164.1| Conserved oligomeric Golgi complex subunit 2 [Tupaia chinensis]
Length=737

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRRKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSPSSKDTS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005906657.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Bos 
mutus]
Length=740

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 99/187 (53%), Gaps = 23/187 (12%)
 Frame = +2

Query  152  SEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDA  331
            SEDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D 
Sbjct  25   SEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDK  84

Query  332  AVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKV  511
            A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V K+
Sbjct  85   ALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVEKI  144

Query  512  EKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRL  691
            EK++    S  T+     A  A +  L+  +                  LERIA+E N+L
Sbjct  145  EKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFNQL  181

Query  692  KFYIAHA  712
            +F+   +
Sbjct  182  QFHAVQS  188



>ref|XP_003940815.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Saimiri 
boliviensis boliviensis]
Length=738

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSRETS---------------------ALETSSPLLTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004458735.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Dasypus novemcinctus]
Length=161

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  E +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIREKKMCVLRLIQVIRSVE  141

Query  506  KVEKLI  523
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_008844006.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nannospalax 
galili]
Length=737

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLEQYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL + R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQFREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLSLIQVIQSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQSSKDTS---------------------SLEASSPLLTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004021628.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Ovis aries]
Length=736

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + + +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLQSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQHSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007987957.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Chlorocebus 
sabaeus]
Length=738

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ E+FD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKENFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005699448.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Capra hircus]
Length=908

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 98/188 (52%), Gaps = 31/188 (16%)
 Frame = +2

Query  149  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  328
            L+EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  192  LNEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVNLSTNLVGMD  251

Query  329  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  508
             A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V K
Sbjct  252  KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVEK  311

Query  509  VEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMH----LERIAS  676
            +EK++                             QH ++ S L  +  +     LERIA+
Sbjct  312  IEKILNS---------------------------QHPKETSALEASSPLLTGQILERIAT  344

Query  677  EMNRLKFY  700
            E N+L+F+
Sbjct  345  EFNQLQFH  352



>ref|XP_008156867.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Eptesicus 
fuscus]
Length=303

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 103/190 (54%), Gaps = 25/190 (13%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADA-GEAREVLELLLDTFHVV  502
            D  + ++  PL ++R ++ + R +V   + A+  R+ ++ D  G+   VL L+     V+
Sbjct  82   DKVLNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLI----QVI  137

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
              VEK+ K L S ++  ++ +  ++    L+  +                  LERIA+E 
Sbjct  138  RSVEKIEKILNSPSSKESSALEGHSP--LLTGQI------------------LERIATEF  177

Query  683  NRLKFYIAHA  712
            N+L+F+   +
Sbjct  178  NQLQFHAVQS  187



>ref|XP_006255878.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Rattus norvegicus]
Length=741

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQDDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S   S Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDASSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|NP_001103964.1| conserved oligomeric Golgi complex subunit 2 [Rattus norvegicus]
 gb|EDL96731.1| rCG50865, isoform CRA_b [Rattus norvegicus]
Length=730

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQDDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++                   N   S   S Q  E  S L   Q   LERIA+E N
Sbjct  142  KIEKIL-------------------NSQSSKDASSQ--EASSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>gb|ERE80256.1| conserved oligomeric Golgi complex subunit 2 [Cricetulus griseus]
Length=725

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  17   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  76

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  77   DRALNQLSVPLGQLREEVMSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  136

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++      + N  +  +  A +  L+  V                  LERIA+E N
Sbjct  137  KIEKIL-----NSQNSKDASSLEASSPLLTGQV------------------LERIATEFN  173

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  174  QLQFHAVQS  182



>ref|XP_003496865.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cricetulus 
griseus]
 ref|XP_007611385.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cricetulus 
griseus]
Length=730

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVMSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++      + N  +  +  A +  L+  V                  LERIA+E N
Sbjct  142  KIEKIL-----NSQNSKDASSLEASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007086077.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Panthera 
tigris altaica]
Length=716

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 100/188 (53%), Gaps = 23/188 (12%)
 Frame = +2

Query  149  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  328
            ++EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MNEDFDVDHFVSDCRKRVQLEELRGDLELYYRLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  329  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  508
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVEK  120

Query  509  VEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNR  688
            +EK++    S  T++       A +  L+  +                  LERIA+E N+
Sbjct  121  IEKILNSQSSKETSVLE-----ASSPLLTGQI------------------LERIATEFNQ  157

Query  689  LKFYIAHA  712
            L+F+   +
Sbjct  158  LQFHAVQS  165



>ref|XP_005064728.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Mesocricetus 
auratus]
Length=730

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++      + N  +  +  A +  L+  V                  LERIA+E N
Sbjct  142  KIEKIL-----NSQNSTDASSLEASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_794127.3| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Strongylocentrotus 
purpuratus]
Length=739

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 102/190 (54%), Gaps = 25/190 (13%)
 Frame = +2

Query  143  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  322
            +FL  DFD ++++++ R  V L+TLR +L  +  +L+  +V+LIN+DYADFV+LS+ L  
Sbjct  23   IFLRGDFDVDSFVAECRHHVQLETLREDLHIYFKTLKNAMVELINKDYADFVNLSSNLVG  82

Query  323  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  502
            +D A+  +  PL ++R ++ + R A++ ++  +  ++  R    + +  L+ L++   +V
Sbjct  83   MDKAIGNLSVPLGQLREEVMSVRCAIDEAIQDVEEKMATRNRTRQKKACLQRLMN---IV  139

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
              VEK+             GI    ++    +  S + T             +ER+ASE 
Sbjct  140  KSVEKM------------EGILRITEDSEPQDNTSIELT----------GQQIERVASEF  177

Query  683  NRLKFYIAHA  712
            N+L++Y+  +
Sbjct  178  NQLQYYVTQS  187



>ref|XP_006106578.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Myotis 
lucifugus]
Length=757

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 96/185 (52%), Gaps = 23/185 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D  + ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKVLNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+   G      +  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQSSKETSALEG-----HSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFY  700
            +L+F+
Sbjct  179  QLQFH  183



>ref|XP_007256131.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Astyanax 
mexicanus]
Length=731

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 103/190 (54%), Gaps = 25/190 (13%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  18   FMKDDFDVDRFVAECRKHVQLEQMREDLEQYYRLLKTAMVELINKDYADFVNLSTNLVGM  77

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAR-EVLELLLDTFHVV  502
            D A+ ++  PL ++R ++ + R AV   + A+ ++L ++ D  + +  VL L+    HVV
Sbjct  78   DKALNQLSVPLGQLREEVLSLRSAVNEVIQAIDTQLSKQDDIQKKKISVLRLI----HVV  133

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
              VEK+ K L S          N  D   L         E  S L   Q   LERIA+E 
Sbjct  134  RSVEKIEKILHS---------QNAKDTTSL---------ESSSPLLAGQI--LERIATEF  173

Query  683  NRLKFYIAHA  712
            N+L+F+   +
Sbjct  174  NQLQFHAVQS  183



>ref|XP_005539862.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X4 [Macaca fascicularis]
Length=680

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 99/187 (53%), Gaps = 23/187 (12%)
 Frame = +2

Query  152  SEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDA  331
            +EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D 
Sbjct  26   TEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDK  85

Query  332  AVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKV  511
            A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K+
Sbjct  86   ALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVEKI  145

Query  512  EKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRL  691
            EK++    S  T+     A  A +  L+  +                  LERIA+E N+L
Sbjct  146  EKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFNQL  182

Query  692  KFYIAHA  712
            +F+   +
Sbjct  183  QFHAVQS  189



>gb|ELU10240.1| hypothetical protein CAPTEDRAFT_184924 [Capitella teleta]
Length=394

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 105/189 (56%), Gaps = 7/189 (4%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DF+ E +I + R  V L+TLR +L  +L  LQ  +++LIN+DYADFV+LST L  +
Sbjct  23   FMRPDFNVELFIVECRRRVQLETLRDDLALYLKILQSAMIELINKDYADFVNLSTNLVGM  82

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+  +  PL +++ +I   R A++ +++A+  ++  +A   + +  L+ L++    V+
Sbjct  83   DKAINTLVTPLDQLKSEIQNVRGALDDAIAAVEVKMTHQAKIRQKKVCLQRLMNIVQSVA  142

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             +EKL+   P   T +     +   +   +  V  +  E    L       +ER+A+E N
Sbjct  143  TMEKLLGIPPPTPTGIPTPPPSPGPHQTKAPSVLPKDDEPSGQL-------IERVATEFN  195

Query  686  RLKFYIAHA  712
            +L+FY++ +
Sbjct  196  KLQFYVSKS  204



>ref|XP_004619081.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sorex 
araneus]
Length=667

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 99/185 (54%), Gaps = 23/185 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR  L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELREHLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMFKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+     A  A++  L+  +                  LERIA+E N
Sbjct  142  KIEKILNSQNSKETS-----ALEANSPLLTGQI------------------LERIATEFN  178

Query  686  RLKFY  700
            +L+F+
Sbjct  179  QLQFH  183



>ref|XP_006992872.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Peromyscus 
maniculatus bairdii]
Length=730

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 104/190 (55%), Gaps = 25/190 (13%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAR-EVLELLLDTFHVV  502
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  VL L+     V+
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLI----QVI  137

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
              VEK+ K L S ++  A+ +   A +  L+  V                  LERIA+E 
Sbjct  138  RSVEKIEKILNSQSSKDASSLE--ASSPLLTGQV------------------LERIATEF  177

Query  683  NRLKFYIAHA  712
            N+L+F+   +
Sbjct  178  NQLQFHAVQS  187



>ref|XP_007127671.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Physeter 
catodon]
Length=717

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 99/192 (52%), Gaps = 31/192 (16%)
 Frame = +2

Query  149  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  328
            + EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  329  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  508
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   RALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVEK  120

Query  509  VEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMH----LERIAS  676
            +EK++                             QH+++ S L  +  +     LERIA+
Sbjct  121  IEKILNS---------------------------QHSKETSALEASSPLLTGQILERIAT  153

Query  677  EMNRLKFYIAHA  712
            E N+L+F+   +
Sbjct  154  EFNQLQFHAVQS  165



>ref|XP_003791030.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Otolemur 
garnettii]
Length=738

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+L    ++    G +                      LERIA+E N
Sbjct  142  KIEKILNSQSSKETSLLE-ASSLLSTGQI----------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007173849.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Balaenoptera acutorostrata scammoni]
Length=717

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 99/192 (52%), Gaps = 31/192 (16%)
 Frame = +2

Query  149  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  328
            + EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  329  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  508
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   RALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVEK  120

Query  509  VEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMH----LERIAS  676
            +EK++                             QH+++ S L  +  +     LERIA+
Sbjct  121  IEKILNS---------------------------QHSKETSALEASSPLLTGQILERIAT  153

Query  677  EMNRLKFYIAHA  712
            E N+L+F+   +
Sbjct  154  EFNQLQFHAVQS  165



>ref|XP_005539859.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Macaca fascicularis]
Length=740

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 99/187 (53%), Gaps = 23/187 (12%)
 Frame = +2

Query  152  SEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDA  331
            +EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D 
Sbjct  26   TEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDK  85

Query  332  AVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKV  511
            A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K+
Sbjct  86   ALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVEKI  145

Query  512  EKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRL  691
            EK++    S  T+     A  A +  L+  +                  LERIA+E N+L
Sbjct  146  EKILNSQSSKETS-----ALEASSPLLTGQI------------------LERIATEFNQL  182

Query  692  KFYIAHA  712
            +F+   +
Sbjct  183  QFHAVQS  189



>ref|XP_004077119.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Oryzias latipes]
Length=733

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 102/190 (54%), Gaps = 23/190 (12%)
 Frame = +2

Query  143  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  322
            +F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQLEEMREDLELYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  323  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  502
            +D A+ ++  PL ++R ++ + R  V   + A+ + L ++ D  + ++ +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDNELSKQDDIQKKKDCVLRLIQVVRSV  135

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
             K+EK++                ++ N   SN +     E  S L   Q   LERIA+E 
Sbjct  136  EKIEKIL----------------HSQNSKESNSL-----ELSSPLLAGQI--LERIATEF  172

Query  683  NRLKFYIAHA  712
            N+L+F+   +
Sbjct  173  NQLQFHAVQS  182



>ref|NP_998519.1| conserved oligomeric Golgi complex subunit 2 [Danio rerio]
 gb|AAH49314.1| Component of oligomeric golgi complex 2 [Danio rerio]
Length=730

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 100/189 (53%), Gaps = 24/189 (13%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ +DFD + +++D R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  18   FMKDDFDVDKFVADCRKRVQLEEMREDLEQYYRLLKTAMVELINKDYADFVNLSTNLVGM  77

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+ ++L ++ D  + +  +  L+     V 
Sbjct  78   DKALNQLSIPLGQLREEVLSLRSSVNEVIEAIDTQLSKQDDIQKKKLCVLRLIQVVRSVE  137

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++ +     T+L                      E  S L   Q   LERIA+E N
Sbjct  138  KIEKILHQNTKDTTSL----------------------ETSSPLLAGQI--LERIATEFN  173

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  174  QLQFHAVQS  182



>ref|XP_546096.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Canis 
lupus familiaris]
Length=715

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 97/188 (52%), Gaps = 23/188 (12%)
 Frame = +2

Query  149  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  328
            + EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  329  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  508
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   KALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERMCKQEDIRKKKMCVLRLIQVIRSVEK  120

Query  509  VEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNR  688
            +EK++    S  T+                       E  S L   Q   LERIA+E N+
Sbjct  121  IEKILNSQNSKETS---------------------TLEASSPLWTGQI--LERIATEFNQ  157

Query  689  LKFYIAHA  712
            L+F+   +
Sbjct  158  LQFHAVQS  165



>gb|ELT94120.1| hypothetical protein CAPTEDRAFT_214095 [Capitella teleta]
Length=764

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 105/189 (56%), Gaps = 7/189 (4%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DF+ E +I + R  V L+TLR +L  +L  LQ  +++LIN+DYADFV+LST L  +
Sbjct  23   FMRPDFNVELFIVECRRRVQLETLRDDLALYLKILQSAMIELINKDYADFVNLSTNLVGM  82

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+  +  PL +++ +I   R A++ +++A+  ++  +A   + +  L+ L++    V+
Sbjct  83   DKAINTLVTPLDQLKSEIQNVRGALDDAIAAVEVKMTHQAKIRQKKVCLQRLMNIVQSVA  142

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             +EKL+   P   T +     +   +   +  V  +  E    L       +ER+A+E N
Sbjct  143  TMEKLLGIPPPTPTGIPTPPPSPGPHQTKAPSVLPKDDEPSGQL-------IERVATEFN  195

Query  686  RLKFYIAHA  712
            +L+FY++ +
Sbjct  196  KLQFYVSKS  204



>ref|XP_007903669.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Callorhinchus milii]
Length=592

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  131  LNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLST  310
             N   F+ ++FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYADFV+LST
Sbjct  18   FNKEEFMKDNFDVDHFVSECRKHVQLETLRDDLELYYKLLKTAMVELINKDYADFVNLST  77

Query  311  KLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDT  490
             L  +D A+ ++  PL ++R ++ + + AV   + A+ +RL ++ D  + +  +  L   
Sbjct  78   NLVGMDRALNQLTVPLGQLREEVLSLKFAVSEGIQAIDNRLVKQEDVRKKKMCVLRLFQV  137

Query  491  FHVVSKVEKLI-----KELPS  538
               V K+EK++     +ELPS
Sbjct  138  IRSVEKIEKILHSQSSRELPS  158



>ref|XP_010887016.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Esox 
lucius]
Length=731

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 101/190 (53%), Gaps = 23/190 (12%)
 Frame = +2

Query  143  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  322
            +F+ +DFD + +++D R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVADCRKHVQLEEMREDLEMYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  323  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  502
            +D A+ ++  PL ++R ++ + R +V   + A+ ++L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVLSLRTSVSEVIQAIDNQLSKQDDLQKKKMCVMRLIQVVRSV  135

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
             K+EK++               N  D+  L         E  S L   Q   LERIA+E 
Sbjct  136  EKIEKILHS------------QNSKDSTSL---------EISSPLLAGQI--LERIATEF  172

Query  683  NRLKFYIAHA  712
            N+L+F+   +
Sbjct  173  NQLQFHAVQS  182



>ref|XP_005518612.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pseudopodoces humilis]
Length=737

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  21   FMKADFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  80

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  81   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAIDDRMTKQED---IRRKKMCVLRLIHVIQ  137

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  138  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  177

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  178  QLQFHAVQS  186



>ref|XP_005518611.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pseudopodoces humilis]
Length=738

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  21   FMKADFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  80

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  81   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAIDDRMTKQED---IRRKKMCVLRLIHVIQ  137

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  138  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  177

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  178  QLQFHAVQS  186



>ref|XP_010219183.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Tinamus guttatus]
Length=730

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  +FD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  13   FMKPNFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  72

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V+  + A+  R+ ++ D    R     +L   HV+ 
Sbjct  73   DKALNQLSVPLGQLREEVLSLKSCVKEGIQAVDDRMSKQED---IRRKKMCVLRLIHVIQ  129

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S +T                    F   E  S L   Q   LERIA+E N
Sbjct  130  SVEKIEKILHSQSTK------------------EFSSLEGNSPLLTGQV--LERIATEFN  169

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  170  QLQFHAVQS  178



>ref|XP_006267974.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Alligator 
mississippiensis]
Length=737

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 94/189 (50%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDRFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R  V   + A+   + ++ D    +     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAVDEHMSKQEDIRRKKMC---VLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S                   N       E  S L   Q   LERIA+E N
Sbjct  139  SVEKIEKILHS------------------QNSKELSSLEANSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_004819666.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Mustela putorius furo]
Length=751

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 97/188 (52%), Gaps = 23/188 (12%)
 Frame = +2

Query  149  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  328
              EDFD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  35   FQEDFDVDHFVSDCRKRVQLEELRADLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  94

Query  329  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  508
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  95   KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIXSVEK  154

Query  509  VEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNR  688
            +EK++    S  T+                       E  S L   Q   LERIA+E N+
Sbjct  155  IEKILNSQSSKETS---------------------ALEASSPLWTGQI--LERIATEFNQ  191

Query  689  LKFYIAHA  712
            L+F+   +
Sbjct  192  LQFHAVQS  199



>ref|XP_010560974.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Haliaeetus leucocephalus]
Length=734

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  17   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  76

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  77   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMAKQED---IRRKKMCVLRLIHVIQ  133

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  134  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  173

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  174  QLQFHAVQS  182



>ref|XP_010192959.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Mesitornis unicolor]
 gb|KFQ29464.1| Conserved oligomeric Golgi complex subunit 2 [Mesitornis unicolor]
Length=734

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  17   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  76

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  77   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKMCVLRLIHVIQ  133

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  134  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  173

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  174  QLQFHAVQS  182



>ref|XP_007535190.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Erinaceus europaeus]
Length=738

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ E FD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEVFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  ++ ++ D  + +  +  L+     V 
Sbjct  82   DKAISQLSVPLGQLREEVLSLRSSVSEGIQAVDEQMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S        I+   +N  L  G                   LERIA+E N
Sbjct  142  KIEKILNSQSS------KEISTLEENSPLLTG-----------------QILERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007535191.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Erinaceus europaeus]
Length=644

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 98/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ E FD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEVFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  ++ ++ D  + +  +  L+     V 
Sbjct  82   DKAISQLSVPLGQLREEVLSLRSSVSEGIQAVDEQMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++       +  +  I+   +N  L  G                   LERIA+E N
Sbjct  142  KIEKILN------SQSSKEISTLEENSPLLTG-----------------QILERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>gb|EFB20161.1| hypothetical protein PANDA_017452 [Ailuropoda melanoleuca]
Length=685

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 23/188 (12%)
 Frame = +2

Query  149  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  328
              EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    FQEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  329  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  508
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVEK  120

Query  509  VEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNR  688
            +EK++    S  T+                       E  S L   Q   LERIA+E N+
Sbjct  121  IEKILNSQSSKETS---------------------ALEASSPLWTGQI--LERIATEFNQ  157

Query  689  LKFYIAHA  712
            L+F+   +
Sbjct  158  LQFHAVQS  165



>ref|XP_005440305.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Falco cherrug]
Length=738

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKMCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007535189.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Erinaceus europaeus]
Length=739

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ E FD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEVFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  ++ ++ D  + +  +  L+     V 
Sbjct  82   DKAISQLSVPLGQLREEVLSLRSSVSEGIQAVDEQMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S        I+   +N  L  G                   LERIA+E N
Sbjct  142  KIEKILNSQSS------KEISTLEENSPLLTG-----------------QILERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005440304.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Falco cherrug]
Length=739

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKMCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_010192960.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Mesitornis unicolor]
Length=733

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  17   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  76

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  77   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKMCVLRLIHVIQ  133

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  134  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  173

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  174  QLQFHAVQS  182



>ref|XP_001176329.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Strongylocentrotus purpuratus]
Length=232

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 99/185 (54%), Gaps = 25/185 (14%)
 Frame = +2

Query  158  DFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAV  337
            DFD ++++++ R  V L+TLR +L  +  +L+  +V+LIN+DYADFV+LS+ L  +D A+
Sbjct  2    DFDVDSFVAECRHHVQLETLREDLHIYFKTLKNAMVELINKDYADFVNLSSNLVGMDKAI  61

Query  338  VRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEK  517
              +  PL ++R ++ + R A++ ++  +  ++  R    + +  L+ L++   +V  VEK
Sbjct  62   GNLSVPLGQLREEVMSVRCAIDEAIQDVEEKMATRNRTRQKKACLQRLMN---IVKSVEK  118

Query  518  LIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMNRLKF  697
            +             GI    ++    +  S + T             +ER+ASE N+L++
Sbjct  119  M------------EGILRITEDSEPQDNTSIELT----------GQQIERVASEFNQLQY  156

Query  698  YIAHA  712
            Y+  +
Sbjct  157  YVTQS  161



>gb|ETE65446.1| Conserved oligomeric Golgi complex subunit 2 [Ophiophagus hannah]
Length=716

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 97/189 (51%), Gaps = 24/189 (13%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +++LIN+DYADFV+LST L  +
Sbjct  17   FMKPDFDVDHFVSECRKRVQLEELRDDLELYYKLLKTAMIELINKDYADFVNLSTNLVGM  76

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  77   DKALNQLSVPLGQLREEVMSLKSCVSEEIRAIDDRLSKQEDIRKKKMCVLRLIQVIKSVE  136

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+L                      E  S L   Q   LERIA+E N
Sbjct  137  KIEKILHSQNSKETSL----------------------EVSSPLLTGQI--LERIATEFN  172

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  173  QLQFHAVQS  181



>ref|XP_010787277.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Notothenia 
coriiceps]
Length=724

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 101/190 (53%), Gaps = 23/190 (12%)
 Frame = +2

Query  143  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  322
            +F+ +DFD + ++++ R  V ++ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQMEEMREDLELYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  323  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  502
            +D A+ ++  PL ++R ++ + R  V   + A+ ++L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDNQLTKQEDLQKKKVCVLRLIQVVRSV  135

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
             K+EK++               N  ++G L         E  S L   Q   LERIA+E 
Sbjct  136  EKIEKILNS------------QNSKESGSL---------EISSPLLAGQV--LERIATEF  172

Query  683  NRLKFYIAHA  712
            N+L+F+   +
Sbjct  173  NQLQFHAVQS  182



>ref|XP_006017038.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Alligator sinensis]
Length=736

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 94/189 (50%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDRFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R  V   + A+   + ++ D    +     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIRAVDEHMSKQEDIRRKKMC---VLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S                   N       E  S L   Q   LERIA+E N
Sbjct  139  SVEKIEKILHS------------------QNSKELSSLEANSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_006017037.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Alligator sinensis]
Length=737

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 94/189 (50%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDRFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R  V   + A+   + ++ D    +     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIRAVDEHMSKQEDIRRKKMC---VLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S                   N       E  S L   Q   LERIA+E N
Sbjct  139  SVEKIEKILHS------------------QNSKELSSLEANSPLLTGQV--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_010741537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Larimichthys crocea]
Length=729

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 102/190 (54%), Gaps = 23/190 (12%)
 Frame = +2

Query  143  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  322
            +F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQLEEMREDLELYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  323  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  502
            +D A+ ++  PL ++R ++ + R  V   + A+ S+L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDSQLSKQEDLQKKKVCVLRLIQVVRSV  135

Query  503  SKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEM  682
             K+EK++                ++ N   S+ +     E  S L   Q   LERIA+E 
Sbjct  136  EKIEKIL----------------HSQNSKESSSL-----EISSPLLAGQI--LERIATEF  172

Query  683  NRLKFYIAHA  712
            N+L+F+   +
Sbjct  173  NQLQFHAVQS  182



>ref|XP_003767876.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sarcophilus 
harrisii]
Length=739

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 96/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ +DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKDDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSTVSEGIRAVDERMSKQEDIRRKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQNSKETS---------------------SLEASSPLLTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_007903668.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Callorhinchus milii]
Length=749

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  131  LNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLST  310
             N   F+ ++FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYADFV+LST
Sbjct  18   FNKEEFMKDNFDVDHFVSECRKHVQLETLRDDLELYYKLLKTAMVELINKDYADFVNLST  77

Query  311  KLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDT  490
             L  +D A+ ++  PL ++R ++ + + AV   + A+ +RL ++ D  + +  +  L   
Sbjct  78   NLVGMDRALNQLTVPLGQLREEVLSLKFAVSEGIQAIDNRLVKQEDVRKKKMCVLRLFQV  137

Query  491  FHVVSKVEKLI-----KELPS  538
               V K+EK++     +ELPS
Sbjct  138  IRSVEKIEKILHSQSSRELPS  158



>gb|ELK34853.1| Conserved oligomeric Golgi complex subunit 2 [Myotis davidii]
Length=815

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 100/202 (50%), Gaps = 23/202 (11%)
 Frame = +2

Query  107  TDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDY  286
            T  NP       + L EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DY
Sbjct  13   TTRNPSSAQISCIGLLEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDY  72

Query  287  ADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEARE  466
            ADFV+LST L  +D  + ++  PL ++R ++ + R +V   + A+  R+ ++ D    + 
Sbjct  73   ADFVNLSTNLVGMDKVLNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKM  132

Query  467  VLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRET  646
             +  L+     V K+EK++    S  T+   G                      S L   
Sbjct  133  CVLRLIQVIRSVEKIEKILNSQSSKETSALEG---------------------HSPLLTG  171

Query  647  QSMHLERIASEMNRLKFYIAHA  712
            Q+  LERIA+E N+L+F+   +
Sbjct  172  QT--LERIATEFNQLQFHAVQS  191



>ref|XP_009565361.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Cuculus canorus]
 gb|KFO80730.1| Conserved oligomeric Golgi complex subunit 2 [Cuculus canorus]
Length=739

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKVCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_001369328.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Monodelphis 
domestica]
Length=739

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 96/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ +DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKDDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSTVSDGIRAVDERMSKQEDIRRKKMCVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++    S  T+                       E  S L   Q   LERIA+E N
Sbjct  142  KIEKILNSQNSKETS---------------------SLEASSPLLTGQI--LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_009565362.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Cuculus canorus]
Length=738

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKVCVLRLIHVIQ  138

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  139  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>ref|XP_005345929.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Microtus 
ochrogaster]
Length=730

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 99/189 (52%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D ++ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRSLNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
            K+EK++        +  +  +  A +  L+  V                  LERIA+E N
Sbjct  142  KIEKIL-----NTQSCKDAPSLEASSPLLTGQV------------------LERIATEFN  178

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  179  QLQFHAVQS  187



>gb|EDL96730.1| rCG50865, isoform CRA_a [Rattus norvegicus]
Length=173

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQDDIRKKKMSVLRLIQVIRSVE  141

Query  506  KVEKLI  523
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_009091144.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Serinus canaria]
Length=724

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 95/189 (50%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  7    FMKADFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  66

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  67   DKALNQLSVPLGQLREEVMSLKSCVSEGIKAVDDRMTKQED---IRRKKMCVLRLIHVIQ  123

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T                        E  S L   Q   LERIA+E N
Sbjct  124  SVEKIEKILHSQGTK------------------ELSSLEGSSPLLTGQV--LERIATEFN  163

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  164  QLQFHAVQS  172



>ref|XP_002190632.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Taeniopygia 
guttata]
Length=636

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
 Frame = +2

Query  146  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  325
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  12   FMKADFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  71

Query  326  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  505
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  72   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKICVLRLIHVIQ  128

Query  506  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTEKGSNLRETQSMHLERIASEMN  685
             VEK+ K L S  T     +++   N  L  G                   LERIA+E N
Sbjct  129  SVEKIEKILHSQGT---KELSSLEGNSPLLTG-----------------QVLERIATEFN  168

Query  686  RLKFYIAHA  712
            +L+F+   +
Sbjct  169  QLQFHAVQS  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380