BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048I07

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613825.1|  PREDICTED: zinc finger BED domain-containing...    140   3e-34   Nicotiana tomentosiformis
ref|XP_009761601.1|  PREDICTED: zinc finger BED domain-containing...    139   8e-34   Nicotiana sylvestris
ref|XP_009621122.1|  PREDICTED: zinc finger BED domain-containing...    138   9e-34   Nicotiana tomentosiformis
ref|XP_011078385.1|  PREDICTED: zinc finger BED domain-containing...    135   1e-32   Sesamum indicum [beniseed]
ref|XP_010313784.1|  PREDICTED: zinc finger BED domain-containing...    135   2e-32   
ref|XP_010313785.1|  PREDICTED: zinc finger BED domain-containing...    135   2e-32   
ref|XP_010313787.1|  PREDICTED: zinc finger BED domain-containing...    135   2e-32   
ref|XP_010313781.1|  PREDICTED: zinc finger BED domain-containing...    135   2e-32   Solanum lycopersicum
ref|XP_009791008.1|  PREDICTED: zinc finger BED domain-containing...    129   2e-30   Nicotiana sylvestris
ref|XP_011457831.1|  PREDICTED: zinc finger BED domain-containing...    128   7e-30   Fragaria vesca subsp. vesca
ref|XP_011457833.1|  PREDICTED: zinc finger BED domain-containing...    127   8e-30   Fragaria vesca subsp. vesca
gb|EYU34976.1|  hypothetical protein MIMGU_mgv1a002172mg                126   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_007013534.1|  BED zinc finger,hAT family dimerization doma...    125   3e-29   
ref|XP_009363983.1|  PREDICTED: zinc finger BED domain-containing...    125   4e-29   
ref|XP_009363984.1|  PREDICTED: zinc finger BED domain-containing...    125   5e-29   Pyrus x bretschneideri [bai li]
gb|KHN15060.1|  Putative AC transposase                                 125   1e-28   Glycine soja [wild soybean]
ref|XP_010047980.1|  PREDICTED: zinc finger BED domain-containing...    123   2e-28   Eucalyptus grandis [rose gum]
ref|XP_007013535.1|  BED zinc finger,hAT family dimerization doma...    123   2e-28   
ref|XP_010656463.1|  PREDICTED: zinc finger BED domain-containing...    122   4e-28   Vitis vinifera
gb|KHG03691.1|  Putative AC transposase                                 118   4e-28   Gossypium arboreum [tree cotton]
gb|KHN03605.1|  Putative AC transposase                                 121   2e-27   Glycine soja [wild soybean]
ref|XP_006453082.1|  hypothetical protein CICLE_v10007308mg             121   2e-27   Citrus clementina [clementine]
gb|KDO73493.1|  hypothetical protein CISIN_1g002915mg                   120   2e-27   Citrus sinensis [apfelsine]
ref|XP_007155048.1|  hypothetical protein PHAVU_003G168600g             121   3e-27   Phaseolus vulgaris [French bean]
ref|XP_007203781.1|  hypothetical protein PRUPE_ppa001983mg             120   3e-27   Prunus persica
ref|XP_008242814.1|  PREDICTED: putative AC transposase isoform X1      120   3e-27   Prunus mume [ume]
ref|XP_010687925.1|  PREDICTED: zinc finger BED domain-containing...    120   3e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687924.1|  PREDICTED: zinc finger BED domain-containing...    120   3e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007203782.1|  hypothetical protein PRUPE_ppa001983mg             119   3e-27   Prunus persica
ref|XP_008242815.1|  PREDICTED: putative AC transposase isoform X2      119   3e-27   Prunus mume [ume]
gb|KGN65126.1|  hypothetical protein Csa_1G229510                       119   4e-27   Cucumis sativus [cucumbers]
gb|KJB64716.1|  hypothetical protein B456_010G061600                    119   6e-27   Gossypium raimondii
gb|KJB64715.1|  hypothetical protein B456_010G061500                    119   6e-27   Gossypium raimondii
ref|XP_007138404.1|  hypothetical protein PHAVU_009G205900g             119   7e-27   Phaseolus vulgaris [French bean]
ref|XP_004493926.1|  PREDICTED: uncharacterized protein LOC101507...    119   8e-27   
ref|XP_010312124.1|  PREDICTED: zinc finger BED domain-containing...    118   9e-27   Solanum lycopersicum
ref|XP_008457064.1|  PREDICTED: putative AC transposase                 118   1e-26   Cucumis melo [Oriental melon]
gb|KGN60709.1|  hypothetical protein Csa_2G008020                       118   1e-26   Cucumis sativus [cucumbers]
gb|EPS67926.1|  hypothetical protein M569_06846                         117   1e-26   Genlisea aurea
gb|KJB23615.1|  hypothetical protein B456_004G107300                    117   2e-26   Gossypium raimondii
ref|XP_011017830.1|  PREDICTED: zinc finger BED domain-containing...    117   2e-26   Populus euphratica
ref|XP_010535860.1|  PREDICTED: zinc finger BED domain-containing...    117   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_010541714.1|  PREDICTED: zinc finger BED domain-containing...    116   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_010541713.1|  PREDICTED: zinc finger BED domain-containing...    116   4e-26   Tarenaya hassleriana [spider flower]
ref|XP_002325201.2|  hypothetical protein POPTR_0018s12680g             115   7e-26   
gb|KHN24413.1|  Putative AC transposase                                 116   9e-26   Glycine soja [wild soybean]
ref|XP_002325202.1|  hypothetical protein POPTR_0018s12690g             114   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011017829.1|  PREDICTED: zinc finger BED domain-containing...    114   2e-25   Populus euphratica
ref|XP_006384324.1|  hypothetical protein POPTR_0004s12760g             113   8e-25   Populus trichocarpa [western balsam poplar]
gb|KHG07202.1|  Putative AC transposase                                 111   8e-25   Gossypium arboreum [tree cotton]
ref|XP_011014817.1|  PREDICTED: zinc finger BED domain-containing...    112   1e-24   Populus euphratica
gb|EPS65666.1|  hypothetical protein M569_09109                         112   2e-24   Genlisea aurea
gb|KJB66355.1|  hypothetical protein B456_010G137500                    111   2e-24   Gossypium raimondii
ref|XP_010425789.1|  PREDICTED: zinc finger BED domain-containing...    111   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007023276.1|  BED zinc finger,hAT family dimerization domain     111   3e-24   
ref|XP_006385302.1|  hypothetical protein POPTR_0003s02610g             110   4e-24   
ref|XP_006384329.1|  hypothetical protein POPTR_0004s12810g             111   5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010496529.1|  PREDICTED: zinc finger BED domain-containing...    109   8e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010514702.1|  PREDICTED: zinc finger BED domain-containing...    109   9e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002875576.1|  hypothetical protein ARALYDRAFT_323059             109   1e-23   Arabidopsis lyrata subsp. lyrata
gb|ABA18109.1|  hAT-like transposase                                    108   1e-23   Arabidopsis arenosa
ref|XP_010250193.1|  PREDICTED: zinc finger BED domain-containing...    108   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006279357.1|  hypothetical protein CARUB_v10008021mg             108   2e-23   Capsella rubella
ref|XP_011044854.1|  PREDICTED: zinc finger BED domain-containing...    109   2e-23   Populus euphratica
ref|XP_011044853.1|  PREDICTED: zinc finger BED domain-containing...    109   2e-23   Populus euphratica
ref|XP_010063482.1|  PREDICTED: zinc finger BED domain-containing...    108   2e-23   Eucalyptus grandis [rose gum]
ref|XP_006369308.1|  hypothetical protein POPTR_0001s20900g             109   2e-23   
ref|XP_008790202.1|  PREDICTED: zinc finger BED domain-containing...    108   3e-23   Phoenix dactylifera
ref|XP_011007705.1|  PREDICTED: zinc finger BED domain-containing...    108   3e-23   Populus euphratica
ref|XP_011007704.1|  PREDICTED: zinc finger BED domain-containing...    108   3e-23   Populus euphratica
ref|XP_011007700.1|  PREDICTED: zinc finger BED domain-containing...    108   3e-23   Populus euphratica
ref|XP_011007706.1|  PREDICTED: zinc finger BED domain-containing...    108   3e-23   Populus euphratica
ref|XP_011467072.1|  PREDICTED: zinc finger BED domain-containing...    108   3e-23   Fragaria vesca subsp. vesca
ref|XP_011044850.1|  PREDICTED: zinc finger BED domain-containing...    108   3e-23   Populus euphratica
ref|XP_008643805.1|  PREDICTED: transposon protein isoform X1           108   4e-23   Zea mays [maize]
ref|XP_011007708.1|  PREDICTED: zinc finger BED domain-containing...    108   4e-23   Populus euphratica
ref|XP_010241568.1|  PREDICTED: zinc finger BED domain-containing...    107   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_011007707.1|  PREDICTED: zinc finger BED domain-containing...    108   4e-23   Populus euphratica
gb|ABA18094.1|  hAT-like transposase                                    107   4e-23   Olimarabidopsis pumila
ref|XP_008776870.1|  PREDICTED: zinc finger BED domain-containing...    107   5e-23   Phoenix dactylifera
gb|KHN27849.1|  Putative AC transposase                                 107   6e-23   Glycine soja [wild soybean]
ref|NP_189803.1|  BED zinc finger and hAT dimerization domain-con...    107   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAW28145.1|  hAT-like transposase                                    107   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151544.1|  transposon protein                                 107   9e-23   Zea mays [maize]
ref|XP_008675089.1|  PREDICTED: transposon protein isoform X1           106   2e-22   Zea mays [maize]
ref|NP_001147988.1|  transposon protein                                 106   2e-22   
ref|XP_002461238.1|  hypothetical protein SORBIDRAFT_02g043380          103   2e-22   
ref|XP_009379895.1|  PREDICTED: zinc finger BED domain-containing...    105   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002463929.1|  hypothetical protein SORBIDRAFT_01g009090          105   3e-22   Sorghum bicolor [broomcorn]
gb|EAY97185.1|  hypothetical protein OsI_19106                          102   4e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_010654811.1|  PREDICTED: zinc finger BED domain-containing...    105   4e-22   Vitis vinifera
gb|EAY91763.1|  hypothetical protein OsI_13406                          102   5e-22   Oryza sativa Indica Group [Indian rice]
gb|EEE64835.1|  hypothetical protein OsJ_19692                          104   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006369306.1|  hypothetical protein POPTR_0001s20900g             105   6e-22   
ref|NP_001147437.1|  LOC100281046                                       104   6e-22   Zea mays [maize]
ref|XP_008643588.1|  PREDICTED: LOC100281046 isoform X1                 104   6e-22   Zea mays [maize]
emb|CAN81954.1|  hypothetical protein VITISV_014020                     105   6e-22   Vitis vinifera
gb|EEC79762.1|  hypothetical protein OsI_21153                          104   6e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_009379897.1|  PREDICTED: zinc finger BED domain-containing...    103   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009336302.1|  PREDICTED: zinc finger BED domain-containing...    103   1e-21   Pyrus x bretschneideri [bai li]
gb|KDO48633.1|  hypothetical protein CISIN_1g005485mg                   103   1e-21   Citrus sinensis [apfelsine]
ref|XP_006427320.1|  hypothetical protein CICLE_v10025036mg             103   1e-21   Citrus clementina [clementine]
ref|XP_009594303.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-21   Nicotiana tomentosiformis
ref|XP_010906913.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-21   Elaeis guineensis
ref|NP_001174288.1|  Os05g0239150                                       103   2e-21   
ref|XP_011457838.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-21   Fragaria vesca subsp. vesca
ref|XP_010906914.1|  PREDICTED: zinc finger BED domain-containing...    102   3e-21   Elaeis guineensis
ref|NP_001051173.1|  Os03g0733400                                       102   3e-21   
ref|XP_009757855.1|  PREDICTED: zinc finger BED domain-containing...    102   3e-21   Nicotiana sylvestris
ref|XP_011081945.1|  PREDICTED: zinc finger BED domain-containing...    102   3e-21   Sesamum indicum [beniseed]
ref|XP_009390780.1|  PREDICTED: zinc finger BED domain-containing...    102   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097200.1|  Putative AC transposase                            102   4e-21   Morus notabilis
ref|XP_009757867.1|  PREDICTED: zinc finger BED domain-containing...    102   4e-21   Nicotiana sylvestris
ref|XP_010319094.1|  PREDICTED: zinc finger BED domain-containing...  99.4    6e-21   
ref|XP_006419173.1|  hypothetical protein EUTSA_v10002435mg             101   8e-21   Eutrema salsugineum [saltwater cress]
ref|XP_009147901.1|  PREDICTED: zinc finger BED domain-containing...    100   2e-20   Brassica rapa
emb|CDY48867.1|  BnaA06g03150D                                          100   2e-20   Brassica napus [oilseed rape]
emb|CDO98171.1|  unnamed protein product                                100   2e-20   Coffea canephora [robusta coffee]
ref|XP_007215012.1|  hypothetical protein PRUPE_ppa002495mg           99.8    2e-20   Prunus persica
ref|XP_009415017.1|  PREDICTED: zinc finger BED domain-containing...  98.6    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010691104.1|  PREDICTED: zinc finger BED domain-containing...  98.6    8e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010229494.1|  PREDICTED: zinc finger BED domain-containing...  95.9    8e-20   
ref|XP_009139828.1|  PREDICTED: zinc finger BED domain-containing...  97.8    1e-19   Brassica rapa
emb|CDY60307.1|  BnaUnng00680D                                        97.8    1e-19   Brassica napus [oilseed rape]
emb|CDX74476.1|  BnaA04g09130D                                        98.2    1e-19   
emb|CDY37871.1|  BnaC04g31350D                                        97.8    1e-19   Brassica napus [oilseed rape]
ref|XP_010521534.1|  PREDICTED: zinc finger BED domain-containing...  98.2    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_009392578.1|  PREDICTED: zinc finger BED domain-containing...  97.4    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN37997.1|  hypothetical protein glysoja_007039                   94.0    3e-19   Glycine soja [wild soybean]
dbj|BAK01733.1|  predicted protein                                    96.3    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007135765.1|  hypothetical protein PHAVU_010G156900g           95.1    9e-19   Phaseolus vulgaris [French bean]
gb|KHN01319.1|  Putative AC transposase                               93.6    3e-18   Glycine soja [wild soybean]
ref|XP_009379900.1|  PREDICTED: zinc finger BED domain-containing...  91.3    2e-17   
ref|XP_010472999.1|  PREDICTED: zinc finger BED domain-containing...  90.9    4e-17   
ref|XP_010520572.1|  PREDICTED: zinc finger BED domain-containing...  90.1    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_010472998.1|  PREDICTED: zinc finger BED domain-containing...  90.9    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010417759.1|  PREDICTED: zinc finger BED domain-containing...  90.9    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010417758.1|  PREDICTED: zinc finger BED domain-containing...  90.9    4e-17   
ref|NP_001056445.1|  Os05g0583200                                     90.5    5e-17   
ref|XP_010497099.1|  PREDICTED: zinc finger BED domain-containing...  90.1    7e-17   
gb|EEE64837.1|  hypothetical protein OsJ_19694                        90.1    7e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EYU24629.1|  hypothetical protein MIMGU_mgv1a023531mg              89.4    1e-16   Erythranthe guttata [common monkey flower]
dbj|BAJ96825.1|  predicted protein                                    89.0    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88673.1|  predicted protein                                    89.0    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006300389.1|  hypothetical protein CARUB_v10019720mg           88.6    2e-16   Capsella rubella
ref|XP_006409564.1|  hypothetical protein EUTSA_v10022530mg           87.4    6e-16   
ref|XP_009138908.1|  PREDICTED: zinc finger BED domain-containing...  87.0    6e-16   Brassica rapa
gb|AAD55482.1|AC009322_22  Hypothetical protein                       85.1    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KCW78838.1|  hypothetical protein EUGRSUZ_C00272                   77.4    7e-15   Eucalyptus grandis [rose gum]
gb|KHN44191.1|  Putative AC transposase                               83.6    8e-15   Glycine soja [wild soybean]
ref|XP_011081954.1|  PREDICTED: zinc finger BED domain-containing...  83.2    9e-15   Sesamum indicum [beniseed]
gb|EPS64824.1|  hypothetical protein M569_09955                       82.8    1e-14   Genlisea aurea
emb|CDY00623.1|  BnaC04g23020D                                        83.6    1e-14   
ref|XP_007150768.1|  hypothetical protein PHAVU_005G179200g           82.4    2e-14   Phaseolus vulgaris [French bean]
ref|XP_002442948.1|  hypothetical protein SORBIDRAFT_08g005330        82.0    3e-14   Sorghum bicolor [broomcorn]
ref|XP_010230399.1|  PREDICTED: zinc finger BED domain-containing...  81.6    3e-14   Brachypodium distachyon [annual false brome]
gb|KCW78851.1|  hypothetical protein EUGRSUZ_C00290                   72.8    5e-13   Eucalyptus grandis [rose gum]
emb|CDY36545.1|  BnaA06g09980D                                        76.3    2e-12   Brassica napus [oilseed rape]
ref|XP_009148917.1|  PREDICTED: zinc finger BED domain-containing...  75.9    3e-12   Brassica rapa
gb|KCW78871.1|  hypothetical protein EUGRSUZ_C00312                   71.2    3e-12   Eucalyptus grandis [rose gum]
gb|KCW79083.1|  hypothetical protein EUGRSUZ_C00524                   69.3    4e-12   Eucalyptus grandis [rose gum]
gb|KCW78865.1|  hypothetical protein EUGRSUZ_C00306                   70.1    4e-12   Eucalyptus grandis [rose gum]
emb|CDX83987.1|  BnaC08g16580D                                        75.1    4e-12   
ref|XP_006416924.1|  hypothetical protein EUTSA_v10009614mg           75.1    5e-12   
sp|Q0JMB2.3|RSLE4_ORYSJ  RecName: Full=Zinc finger BED domain-con...  74.7    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043202.2|  Os01g0518400                                     74.7    6e-12   
emb|CDX89026.1|  BnaA04g01600D                                        73.9    9e-12   
ref|XP_010497000.1|  PREDICTED: zinc finger BED domain-containing...  73.6    1e-11   Camelina sativa [gold-of-pleasure]
emb|CDY39631.1|  BnaC05g11600D                                        73.2    2e-11   Brassica napus [oilseed rape]
ref|XP_004968803.1|  PREDICTED: uncharacterized protein LOC101784...  73.2    2e-11   Setaria italica
ref|XP_009110492.1|  PREDICTED: zinc finger BED domain-containing...  72.8    3e-11   Brassica rapa
gb|EEC70768.1|  hypothetical protein OsI_02196                        72.0    3e-11   Oryza sativa Indica Group [Indian rice]
gb|KGN52935.1|  hypothetical protein Csa_4G006420                     72.0    4e-11   Cucumis sativus [cucumbers]
ref|XP_006851229.1|  hypothetical protein AMTR_s00180p00017340        71.2    9e-11   
ref|XP_010462713.1|  PREDICTED: zinc finger BED domain-containing...  70.9    1e-10   
ref|XP_006305940.1|  hypothetical protein CARUB_v10011179mg           67.0    2e-09   Capsella rubella
ref|XP_010108145.1|  hypothetical protein L484_023234                 58.2    5e-08   



>ref|XP_009613825.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=785

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 84/119 (71%), Gaps = 13/119 (11%)
 Frame = +1

Query  352  NNELVVHSEMMADH------EILP-DEMMLNNEIVPM------EMQENSLGTPLNGSEMQ  492
            N+E+V   EM  +H      EI+P DEM+ +NE++P+      E Q N + TP N  E Q
Sbjct  72   NHEMVQEHEMTHEHHIVLGNEIVPGDEMVRDNEMIPLNEMVLAEPQPNYIETPPNDLETQ  131

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            P KRRKKKS+VWE FTIE VG G RRACCKQCKQSFAYS G KVAGTSHLKRHIAKG C
Sbjct  132  PSKRRKKKSIVWEHFTIENVGAGTRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGAC  190



>ref|XP_009761601.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
 ref|XP_009761602.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=798

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 85/118 (72%), Gaps = 12/118 (10%)
 Frame = +1

Query  352  NNELVVHSEMMADH------EILP-DEMMLNNEIVPM-EM----QENSLGTPLNGSEMQP  495
            N+E+V   EM  +H      EI+P DEM+ +NE++P+ EM    Q N + TP N  E QP
Sbjct  86   NHEMVQEHEMTHEHHIVLGNEIVPGDEMVPDNEMIPLNEMVLAEQPNYIETPPNDLETQP  145

Query  496  KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
             KRRKKKS+VWE FTIE VG G RRACCKQCKQSFAYS G KVAGTSHLKRHIAKG C
Sbjct  146  SKRRKKKSIVWEHFTIENVGAGTRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGAC  203



>ref|XP_009621122.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=743

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 89/146 (61%), Gaps = 30/146 (21%)
 Frame = +1

Query  322  TPTTPETPIDNNELV------------VHSEMMADHEILPDEMMLNNEIVP---------  438
            TP TP TP +N+E+V            +  EM+ +HE++  +M+L NEIVP         
Sbjct  3    TPVTPATPTENHEMVPDHQMIPEHGMVLEHEMVHEHEMVEHDMVLGNEIVPGNGMVSDSE  62

Query  439  ---------MEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCK  591
                      E Q N + TP + SE QP KRRKKKS+VWE FTIE V  G RRA C QCK
Sbjct  63   MFPGNEMVLAEPQPNHVETPPSNSETQPGKRRKKKSIVWEHFTIETVAVGTRRAQCNQCK  122

Query  592  QSFAYSQGCKVAGTSHLKRHIAKGTC  669
            QSFAYS G KVAGTSHLKRHIAKGTC
Sbjct  123  QSFAYSTGSKVAGTSHLKRHIAKGTC  148



>ref|XP_011078385.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Sesamum indicum]
 ref|XP_011078386.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Sesamum indicum]
Length=700

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMV  525
            ++N+  ++++E++   E  P +  +  +I  +E Q N +  P N +E QP KRRKKKS+V
Sbjct  3    VENSNQIMNNELIPMEETQPLDSEMQLDI--LEPQPNHIELPPNNAEQQPTKRRKKKSIV  60

Query  526  WEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            WE FTIE VG GCRRACCKQCKQSFAYS G KVAGTSHLKRHIAKGTC
Sbjct  61   WEHFTIETVGAGCRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTC  108



>ref|XP_010313784.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Solanum lycopersicum]
Length=921

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +1

Query  355  NELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEF  534
            +E+V  +EM+ D     DEM+  NE+V  E Q N + TP N  E QP KRRKKKS+VWE 
Sbjct  235  HEIVPSNEMVPD-----DEMIPLNEMVLAEPQPNYIETPPNNPETQPSKRRKKKSIVWEH  289

Query  535  FTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            FTIE VG G RRA CKQCKQSFAYS G KVAGTSHLKRHIAKGTC  
Sbjct  290  FTIENVGGGTRRAQCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPV  336



>ref|XP_010313785.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Solanum lycopersicum]
 ref|XP_010313786.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X4 [Solanum lycopersicum]
Length=921

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +1

Query  355  NELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEF  534
            +E+V  +EM+ D     DEM+  NE+V  E Q N + TP N  E QP KRRKKKS+VWE 
Sbjct  235  HEIVPSNEMVPD-----DEMIPLNEMVLAEPQPNYIETPPNNPETQPSKRRKKKSIVWEH  289

Query  535  FTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            FTIE VG G RRA CKQCKQSFAYS G KVAGTSHLKRHIAKGTC  
Sbjct  290  FTIENVGGGTRRAQCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPV  336



>ref|XP_010313787.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X5 [Solanum lycopersicum]
Length=907

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +1

Query  355  NELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEF  534
            +E+V  +EM+ D     DEM+  NE+V  E Q N + TP N  E QP KRRKKKS+VWE 
Sbjct  221  HEIVPSNEMVPD-----DEMIPLNEMVLAEPQPNYIETPPNNPETQPSKRRKKKSIVWEH  275

Query  535  FTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            FTIE VG G RRA CKQCKQSFAYS G KVAGTSHLKRHIAKGTC  
Sbjct  276  FTIENVGGGTRRAQCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPV  322



>ref|XP_010313781.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010313782.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010313783.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
Length=935

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +1

Query  355  NELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEF  534
            +E+V  +EM+ D     DEM+  NE+V  E Q N + TP N  E QP KRRKKKS+VWE 
Sbjct  249  HEIVPSNEMVPD-----DEMIPLNEMVLAEPQPNYIETPPNNPETQPSKRRKKKSIVWEH  303

Query  535  FTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            FTIE VG G RRA CKQCKQSFAYS G KVAGTSHLKRHIAKGTC  
Sbjct  304  FTIENVGGGTRRAQCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPV  350



>ref|XP_009791008.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=742

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 87/145 (60%), Gaps = 29/145 (20%)
 Frame = +1

Query  322  TPTTPETPIDNNELV------------------VHSEMMADHEILPDEMMLNNEIVP---  438
            TP TP TP +N+E+V                  +  EM+ +HE++  EM+L NEIVP   
Sbjct  3    TPVTPATPTENHEMVPEHQMIPEHGMVLEHEMVLEHEMVHEHEMVGHEMVLGNEIVPGNG  62

Query  439  -MEMQENSLGTPL-------NGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQ  594
             +  +E   G  +       N  E QP KRRKKKS+VWE FTIE V  G RRA C QCKQ
Sbjct  63   MVSDREMFPGNEMVRAEPQPNHVETQPGKRRKKKSIVWEHFTIETVAVGTRRAQCNQCKQ  122

Query  595  SFAYSQGCKVAGTSHLKRHIAKGTC  669
            SFAYS G KVAGTSHLKRHIAKGTC
Sbjct  123  SFAYSTGSKVAGTSHLKRHIAKGTC  147



>ref|XP_011457831.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=949

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = +1

Query  340  TPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKS  519
            TP  NNE+  +      H    D  + NNE+      EN+ GT     E  P KRRKKKS
Sbjct  257  TPYANNEMTPYVNHELTHYANHDAPLANNELT---TYENTEGT---NPEAHPNKRRKKKS  310

Query  520  MVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            +VWE FTIE V  GCRRACCKQCKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  311  VVWEHFTIENVSPGCRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPA  362



>ref|XP_011457833.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=917

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = +1

Query  340  TPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKS  519
            TP  NNE+  +      H    D  + NNE+      EN+ GT     E  P KRRKKKS
Sbjct  225  TPYANNEMTPYVNHELTHYANHDAPLANNELT---TYENTEGT---NPEAHPNKRRKKKS  278

Query  520  MVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            +VWE FTIE V  GCRRACCKQCKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  279  VVWEHFTIENVSPGCRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPA  330



>gb|EYU34976.1| hypothetical protein MIMGU_mgv1a002172mg [Erythranthe guttata]
Length=705

 Score =   126 bits (317),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 66/105 (63%), Positives = 74/105 (70%), Gaps = 17/105 (16%)
 Frame = +1

Query  403  PDEMMLNNEIVPME--------MQENSLGTPLNGSEMQP--------KKRRKKKSMVWEF  534
            P+E+M +NE+VPME        +Q + + T  N  EM P         KRRKKKS+VWE 
Sbjct  6    PNEIM-SNELVPMEETQPIESDLQLDIIDTEPNHYEMAPPDITEQPPTKRRKKKSIVWEH  64

Query  535  FTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            FTIE VG GCRRACCKQCKQSFAYS G KVAGTSHLKRHIAKGTC
Sbjct  65   FTIETVGAGCRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTC  109



>ref|XP_007013534.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY31153.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
Length=711

 Score =   125 bits (314),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 63/83 (76%), Gaps = 5/83 (6%)
 Frame = +1

Query  427  EIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAY  606
            E  P E   N L TP    E QP KRRKKKS+VWE+FTIE V  GCRRACCK+CKQSFAY
Sbjct  49   ETTPEE-NNNQLATP----ETQPNKRRKKKSIVWEYFTIETVSAGCRRACCKRCKQSFAY  103

Query  607  SQGCKVAGTSHLKRHIAKGTCAA  675
            S G KVAGTSHLKRHIAKGTC A
Sbjct  104  STGSKVAGTSHLKRHIAKGTCPA  126



>ref|XP_009363983.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X1 [Pyrus x bretschneideri]
Length=864

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 82/129 (64%), Gaps = 14/129 (11%)
 Frame = +1

Query  292  YFVFKMASQFT-PTTPETPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGT  468
            +F   MA+ F  P T  TPI++       +MM   E   +E ML   + P E  E     
Sbjct  164  HFEDSMAAHFEEPMT--TPINHKRATPDEDMM---ETPDEEKMLT--LTPYENNE-----  211

Query  469  PLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
             +  +E QP KRRKKKS+VWE FTIE V  GCRRACCKQCKQSFAYS G KVAGTSHLKR
Sbjct  212  -VENTETQPNKRRKKKSIVWEHFTIENVSPGCRRACCKQCKQSFAYSTGSKVAGTSHLKR  270

Query  649  HIAKGTCAA  675
            HIAKGTC A
Sbjct  271  HIAKGTCPA  279



>ref|XP_009363984.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X2 [Pyrus x bretschneideri]
Length=852

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 82/129 (64%), Gaps = 14/129 (11%)
 Frame = +1

Query  292  YFVFKMASQFT-PTTPETPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGT  468
            +F   MA+ F  P T  TPI++       +MM   E   +E ML   + P E  E     
Sbjct  152  HFEDSMAAHFEEPMT--TPINHKRATPDEDMM---ETPDEEKMLT--LTPYENNE-----  199

Query  469  PLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
             +  +E QP KRRKKKS+VWE FTIE V  GCRRACCKQCKQSFAYS G KVAGTSHLKR
Sbjct  200  -VENTETQPNKRRKKKSIVWEHFTIENVSPGCRRACCKQCKQSFAYSTGSKVAGTSHLKR  258

Query  649  HIAKGTCAA  675
            HIAKGTC A
Sbjct  259  HIAKGTCPA  267



>gb|KHN15060.1| Putative AC transposase [Glycine soja]
Length=1154

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 78/120 (65%), Gaps = 13/120 (11%)
 Frame = +1

Query  352  NNELVVH-----SEMMADHEIL---PDEMMLNNEIVPMEMQENSLGTPLNGSE----MQP  495
            N+ L+ H     SE + DH I+   P   ++N   +P     N+  TPLN  E     QP
Sbjct  444  NSHLLPHYGLQTSETLHDHPIVNSRPHYEIVNASNIPSYEIINA-ETPLNSEEPTPETQP  502

Query  496  KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
             KRRKKKS+VWE FTIE V  GCRRACC QCKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  503  SKRRKKKSIVWEHFTIETVSPGCRRACCMQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPA  562



>ref|XP_010047980.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047981.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047982.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047983.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 gb|KCW80053.1| hypothetical protein EUGRSUZ_C01383 [Eucalyptus grandis]
Length=658

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 62/76 (82%), Gaps = 4/76 (5%)
 Frame = +1

Query  448  QENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVA  627
            + N++ TP    E QP KRRKKKS+VWE FTIE VG GCRRACCKQCKQSFAYS G KVA
Sbjct  6    ENNNVKTP----ETQPNKRRKKKSIVWEHFTIETVGPGCRRACCKQCKQSFAYSTGSKVA  61

Query  628  GTSHLKRHIAKGTCAA  675
            GTSHLKRHIAKGTC A
Sbjct  62   GTSHLKRHIAKGTCPA  77



>ref|XP_007013535.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 ref|XP_007013536.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 ref|XP_007013537.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31154.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31155.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31156.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
Length=673

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 61/78 (78%), Gaps = 4/78 (5%)
 Frame = +1

Query  442  EMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCK  621
            E   N L TP    E QP KRRKKKS+VWE+FTIE V  GCRRACCK+CKQSFAYS G K
Sbjct  15   EENNNQLATP----ETQPNKRRKKKSIVWEYFTIETVSAGCRRACCKRCKQSFAYSTGSK  70

Query  622  VAGTSHLKRHIAKGTCAA  675
            VAGTSHLKRHIAKGTC A
Sbjct  71   VAGTSHLKRHIAKGTCPA  88



>ref|XP_010656463.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656464.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656465.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656466.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656467.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656468.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
Length=675

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +1

Query  448  QENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVA  627
            + N L      SE QP KRRKKKS+VWE FTIE VG GCRRACCKQCKQSFAYS G KVA
Sbjct  6    ENNELALAEVNSETQPNKRRKKKSIVWEHFTIETVGAGCRRACCKQCKQSFAYSTGSKVA  65

Query  628  GTSHLKRHIAKGTCA  672
            GTSHLKRHIAKGTC 
Sbjct  66   GTSHLKRHIAKGTCT  80



>gb|KHG03691.1| Putative AC transposase [Gossypium arboreum]
 gb|KHG03692.1| Putative AC transposase [Gossypium arboreum]
 gb|KHG06906.1| Putative AC transposase [Gossypium arboreum]
 gb|KHG21679.1| Putative AC transposase [Gossypium arboreum]
Length=282

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 70/98 (71%), Gaps = 14/98 (14%)
 Frame = +1

Query  382  MADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNG  561
            +AD E +P E   NN++        +L TP    E QP KRRKKKSMVWE+FTIE V  G
Sbjct  29   IADMETIPGES--NNQL--------ALTTP----EAQPIKRRKKKSMVWEYFTIENVSAG  74

Query  562  CRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            CRRA CK+CKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  75   CRRAYCKRCKQSFAYSTGSKVAGTSHLKRHIAKGTCRA  112



>gb|KHN03605.1| Putative AC transposase [Glycine soja]
Length=1180

 Score =   121 bits (304),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 71/147 (48%), Positives = 82/147 (56%), Gaps = 39/147 (27%)
 Frame = +1

Query  352  NNELVVHSEMMADH-----EILPDEMMLNNEIVPMEMQENS-------------------  459
            +N  + HSE +++H     E L  E + N+E++P    +NS                   
Sbjct  442  SNNHMDHSEAVSNHQLTHSETLSHEQLANSELLPQYGLQNSETLHGNQLVNSQPHYEIVN  501

Query  460  -----------LGTPLNGSE----MQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQ  594
                         TPLN  E     QP KRRKKKS+VWE FTIE V  GCRRACCKQCKQ
Sbjct  502  ASNIPSYEIVNAETPLNSEEPTPETQPSKRRKKKSIVWEHFTIETVSPGCRRACCKQCKQ  561

Query  595  SFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            SFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  562  SFAYSTGSKVAGTSHLKRHIAKGTCPA  588



>ref|XP_006453082.1| hypothetical protein CICLE_v10007308mg [Citrus clementina]
 gb|ESR66322.1| hypothetical protein CICLE_v10007308mg [Citrus clementina]
Length=1064

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +1

Query  421  NNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSF  600
            NN +  +  Q N+  T     E QP KRRKKKS+VWE FTIE V  GCRRACCKQCKQSF
Sbjct  399  NNALAIVNTQPNNEVT---SPETQPNKRRKKKSIVWEHFTIETVSAGCRRACCKQCKQSF  455

Query  601  AYSQGCKVAGTSHLKRHIAKGTCAA  675
            AYS G KVAGTSHLKRHIAKGTC A
Sbjct  456  AYSTGSKVAGTSHLKRHIAKGTCPA  480



>gb|KDO73493.1| hypothetical protein CISIN_1g002915mg [Citrus sinensis]
 gb|KDO73494.1| hypothetical protein CISIN_1g002915mg [Citrus sinensis]
Length=866

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +1

Query  421  NNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSF  600
            NN +  +  Q N+  T     E QP KRRKKKS+VWE FTIE V  GCRRACCKQCKQSF
Sbjct  201  NNALAIVNTQPNNEVT---SPETQPNKRRKKKSIVWEHFTIETVSAGCRRACCKQCKQSF  257

Query  601  AYSQGCKVAGTSHLKRHIAKGTCAA  675
            AYS G KVAGTSHLKRHIAKGTC A
Sbjct  258  AYSTGSKVAGTSHLKRHIAKGTCPA  282



>ref|XP_007155048.1| hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris]
 gb|ESW27042.1| hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris]
Length=1252

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 14/121 (12%)
 Frame = +1

Query  334  PETPIDNNELVVHSEMMAD---HEILPDEMMLNNEIVPMEMQENSLGTPLNGSE----MQ  492
            P   + N+E ++ ++++     +EI+    + + EIV  E       TPLN  E     Q
Sbjct  550  PHYGLQNSETLLDNQLVNSQPHYEIVNASNIPSYEIVNAE-------TPLNSEEPTPETQ  602

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCA  672
            P KRRKKKS+VWE FTIE V  GCRRACCKQCKQSFAYS G KVAGTSHLKRHIAKGTC 
Sbjct  603  PSKRRKKKSIVWEHFTIETVSPGCRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCP  662

Query  673  A  675
            A
Sbjct  663  A  663



>ref|XP_007203781.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
 gb|EMJ04980.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
Length=724

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 76/125 (61%), Gaps = 13/125 (10%)
 Frame = +1

Query  340  TPIDNNELVVHSEMMA----DHEILPDEMMLNN----EIVPMEMQENSLGTPLNGSEM--  489
            TPI++       E MA    D    PDE  +      + + +   E+   TP   +E+  
Sbjct  11   TPIEDKMATPVEEEMATPIQDKMATPDEDKMETPDEEKTLALTQYEDKTATPYENNEVAI  70

Query  490  ---QPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
               QP KRRKKKS+VWE FTIE V  GCRRACC QCKQSFAYS G KVAGTSHLKRHIAK
Sbjct  71   PEAQPNKRRKKKSIVWEHFTIETVSAGCRRACCNQCKQSFAYSTGAKVAGTSHLKRHIAK  130

Query  661  GTCAA  675
            GTC A
Sbjct  131  GTCPA  135



>ref|XP_008242814.1| PREDICTED: putative AC transposase isoform X1 [Prunus mume]
Length=733

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 66/96 (69%), Gaps = 9/96 (9%)
 Frame = +1

Query  403  PDEMMLNNEIVPMEMQENSLGTPLNGSEM-----QPKKRRKKKSMVWEFFTIEAVGNGCR  567
            PDE     + + +   E+   TP   +E+     QP KRRKKKS+VWE FTIE V  GCR
Sbjct  53   PDE----EKTLALTQYEDKTATPYENNEVAIPEAQPNKRRKKKSIVWEHFTIETVSAGCR  108

Query  568  RACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            RACC QCKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  109  RACCNQCKQSFAYSTGAKVAGTSHLKRHIAKGTCPA  144



>ref|XP_010687925.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1053

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 4/85 (5%)
 Frame = +1

Query  415  MLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQ  594
            ++N + +  E+  + L TP    E QP KRRKKKS+VWE FTIE VG GCRRA CK CKQ
Sbjct  383  LINTQPLSTELPNSQLATP----ETQPNKRRKKKSIVWEHFTIETVGVGCRRAYCKVCKQ  438

Query  595  SFAYSQGCKVAGTSHLKRHIAKGTC  669
            SFAYS G KVAGTSHLKRHIAKGTC
Sbjct  439  SFAYSTGSKVAGTSHLKRHIAKGTC  463



>ref|XP_010687924.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1065

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 4/85 (5%)
 Frame = +1

Query  415  MLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQ  594
            ++N + +  E+  + L TP    E QP KRRKKKS+VWE FTIE VG GCRRA CK CKQ
Sbjct  395  LINTQPLSTELPNSQLATP----ETQPNKRRKKKSIVWEHFTIETVGVGCRRAYCKVCKQ  450

Query  595  SFAYSQGCKVAGTSHLKRHIAKGTC  669
            SFAYS G KVAGTSHLKRHIAKGTC
Sbjct  451  SFAYSTGSKVAGTSHLKRHIAKGTC  475



>ref|XP_007203782.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
 gb|EMJ04981.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
Length=733

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 76/125 (61%), Gaps = 13/125 (10%)
 Frame = +1

Query  340  TPIDNNELVVHSEMMA----DHEILPDEMMLNN----EIVPMEMQENSLGTPLNGSEM--  489
            TPI++       E MA    D    PDE  +      + + +   E+   TP   +E+  
Sbjct  20   TPIEDKMATPVEEEMATPIQDKMATPDEDKMETPDEEKTLALTQYEDKTATPYENNEVAI  79

Query  490  ---QPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
               QP KRRKKKS+VWE FTIE V  GCRRACC QCKQSFAYS G KVAGTSHLKRHIAK
Sbjct  80   PEAQPNKRRKKKSIVWEHFTIETVSAGCRRACCNQCKQSFAYSTGAKVAGTSHLKRHIAK  139

Query  661  GTCAA  675
            GTC A
Sbjct  140  GTCPA  144



>ref|XP_008242815.1| PREDICTED: putative AC transposase isoform X2 [Prunus mume]
Length=724

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 66/96 (69%), Gaps = 9/96 (9%)
 Frame = +1

Query  403  PDEMMLNNEIVPMEMQENSLGTPLNGSEM-----QPKKRRKKKSMVWEFFTIEAVGNGCR  567
            PDE     + + +   E+   TP   +E+     QP KRRKKKS+VWE FTIE V  GCR
Sbjct  44   PDE----EKTLALTQYEDKTATPYENNEVAIPEAQPNKRRKKKSIVWEHFTIETVSAGCR  99

Query  568  RACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            RACC QCKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  100  RACCNQCKQSFAYSTGAKVAGTSHLKRHIAKGTCPA  135



>gb|KGN65126.1| hypothetical protein Csa_1G229510 [Cucumis sativus]
Length=751

 Score =   119 bits (299),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 10/113 (9%)
 Frame = +1

Query  361  LVVHSEMMADHEIL-PD-EMMLNNEIVPMEMQEN-SLGTP-----LNGSEMQPKKRRKKK  516
            +V+H +   DH++  P+ E M+  E   ME  +   LG+P     L   E+QP KRRKKK
Sbjct  43   MVIHHD--EDHDLTTPNGENMVAREDELMETPDTGKLGSPDGHNELALVEVQPNKRRKKK  100

Query  517  SMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            S+VWE FTIE+V   CRRA CKQCKQSFAYS G KVAGTSHLKRHIAKGTC+A
Sbjct  101  SIVWEHFTIESVSADCRRAYCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCSA  153



>gb|KJB64716.1| hypothetical protein B456_010G061600 [Gossypium raimondii]
Length=678

 Score =   119 bits (297),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 69/98 (70%), Gaps = 14/98 (14%)
 Frame = +1

Query  382  MADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNG  561
            + D E +P E   NN++        +L TP    E QP KRRKKKSMVWE+FTIE V  G
Sbjct  7    ITDMETIPGES--NNQL--------ALTTP----EAQPIKRRKKKSMVWEYFTIENVSAG  52

Query  562  CRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            CRRA CK+CKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  53   CRRAYCKRCKQSFAYSTGSKVAGTSHLKRHIAKGTCRA  90



>gb|KJB64715.1| hypothetical protein B456_010G061500 [Gossypium raimondii]
Length=678

 Score =   119 bits (297),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 69/98 (70%), Gaps = 14/98 (14%)
 Frame = +1

Query  382  MADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNG  561
            + D E +P E   NN++        +L TP    E QP KRRKKKSMVWE+FTIE V  G
Sbjct  7    ITDMETIPGES--NNQL--------ALTTP----EAQPIKRRKKKSMVWEYFTIENVSAG  52

Query  562  CRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            CRRA CK+CKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  53   CRRAYCKRCKQSFAYSTGSKVAGTSHLKRHIAKGTCRA  90



>ref|XP_007138404.1| hypothetical protein PHAVU_009G205900g [Phaseolus vulgaris]
 gb|ESW10398.1| hypothetical protein PHAVU_009G205900g [Phaseolus vulgaris]
Length=856

 Score =   119 bits (298),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 83/129 (64%), Gaps = 17/129 (13%)
 Frame = +1

Query  340  TPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQEN-------------SLGTPLNG  480
            T + +++ +V+S+M++ +E+   E M +N++V  +                 S  TPLN 
Sbjct  137  TDVFSHDQLVNSQMLSHYELENSETMHHNQLVNSQANYEIAISDAIPSYEIISAETPLNN  196

Query  481  ----SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
                SE Q  KRRKKKS+VWE FTIE V  GCRRA CKQC Q+FAYS G KVAGTSHLKR
Sbjct  197  EDHISETQTPKRRKKKSIVWEHFTIETVSPGCRRARCKQCAQTFAYSTGSKVAGTSHLKR  256

Query  649  HIAKGTCAA  675
            HIAKGTC+A
Sbjct  257  HIAKGTCSA  265



>ref|XP_004493926.1| PREDICTED: uncharacterized protein LOC101507795 isoform X1 [Cicer 
arietinum]
 ref|XP_004493927.1| PREDICTED: uncharacterized protein LOC101507795 isoform X2 [Cicer 
arietinum]
Length=1274

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 73/118 (62%), Gaps = 17/118 (14%)
 Frame = +1

Query  373  SEMMADHEILPDEMMLNNEIV--------------PMEMQENSLGTPLN---GSEMQPKK  501
            S+MM  +E+   EM+ +N+++              P     N+   P N     E QP K
Sbjct  566  SQMMTHYELANSEMLHDNQLISSQAHYEIVNANTFPSYEIVNAETPPHNEERTPETQPNK  625

Query  502  RRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            RRKKKS+VWE FTIE V  GCRRACC QCKQ+FAYS G KVAGTSHLKRHIAKG C A
Sbjct  626  RRKKKSIVWEHFTIETVSAGCRRACCNQCKQTFAYSTGSKVAGTSHLKRHIAKGACPA  683



>ref|XP_010312124.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Solanum lycopersicum]
Length=772

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 9/105 (9%)
 Frame = +1

Query  355  NELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEF  534
            NE+V  + M+ D+E++P      NE+V  E Q N + TP    E QP K RKKKS+VWE 
Sbjct  82   NEMVPGNGMVQDYEMIP-----GNEMVLAEPQPNYVETP----ETQPGKHRKKKSIVWEH  132

Query  535  FTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            FTIE V  G RRA CK+CKQSFAYS G KVAGTSHLKRHIAKG+C
Sbjct  133  FTIENVAVGTRRAQCKKCKQSFAYSTGSKVAGTSHLKRHIAKGSC  177



>ref|XP_008457064.1| PREDICTED: putative AC transposase [Cucumis melo]
 ref|XP_008457073.1| PREDICTED: putative AC transposase [Cucumis melo]
Length=677

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 61/93 (66%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +1

Query  403  PDEMMLNN--EIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRAC  576
            P +MML    E  P   +  +L T    +E QP KRRKKKS+VWE FTIE V  GCRRA 
Sbjct  4    PHDMMLTPYVEKTPNSDEYGALTT----TETQPNKRRKKKSIVWEHFTIETVSAGCRRAY  59

Query  577  CKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            CKQCKQSFAYS G KVAGTSHLKRHIAKG CAA
Sbjct  60   CKQCKQSFAYSTGSKVAGTSHLKRHIAKGICAA  92



>gb|KGN60709.1| hypothetical protein Csa_2G008020 [Cucumis sativus]
Length=677

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 61/93 (66%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +1

Query  403  PDEMMLNN--EIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRAC  576
            P +MML    E  P   +  +L T    +E QP KRRKKKS+VWE FTIE V  GCRRA 
Sbjct  4    PHDMMLTPYVEKTPNSDEYGALTT----TETQPNKRRKKKSIVWEHFTIETVSAGCRRAY  59

Query  577  CKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            CKQCKQSFAYS G KVAGTSHLKRHIAKG CAA
Sbjct  60   CKQCKQSFAYSTGSKVAGTSHLKRHIAKGICAA  92



>gb|EPS67926.1| hypothetical protein M569_06846, partial [Genlisea aurea]
Length=696

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            TP N     P KRRKKKS+VWE FTIE+VG GCRRA CKQCKQSFAYS G KVAGTSHLK
Sbjct  23   TPANVELEPPIKRRKKKSVVWEHFTIESVGPGCRRAYCKQCKQSFAYSTGSKVAGTSHLK  82

Query  646  RHIAKGTCAA  675
            RHIAKGTC A
Sbjct  83   RHIAKGTCPA  92



>gb|KJB23615.1| hypothetical protein B456_004G107300 [Gossypium raimondii]
 gb|KJB23616.1| hypothetical protein B456_004G107300 [Gossypium raimondii]
Length=673

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 65/86 (76%), Gaps = 6/86 (7%)
 Frame = +1

Query  421  NNEIVPMEMQ-ENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQS  597
            N E  P+E   E +L TP    E QPK RRKKKSMVWE+FTIE V  GCRRACC +CKQS
Sbjct  9    NMETTPVENNNELALITP----ETQPK-RRKKKSMVWEYFTIETVSAGCRRACCNRCKQS  63

Query  598  FAYSQGCKVAGTSHLKRHIAKGTCAA  675
            FAYS G KVAGTSHLKRHIAKGTC A
Sbjct  64   FAYSTGSKVAGTSHLKRHIAKGTCPA  89



>ref|XP_011017830.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=716

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  445  MQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKV  624
             +ENS  TP  G E QP KRRK+KSMVWE FTIE V + CRRA CKQC++SFAYS G KV
Sbjct  55   FEENSRSTP--GPETQPSKRRKRKSMVWEHFTIETVSSDCRRASCKQCRKSFAYSMGSKV  112

Query  625  AGTSHLKRHIAKGTCAA  675
            +GTSHLKRHIAKGTC A
Sbjct  113  SGTSHLKRHIAKGTCLA  129



>ref|XP_010535860.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=641

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E QP KRRKKKSMVWE FTIE V  GCRRACCK CKQSFAYS G KVAGTSHLKRHIAKG
Sbjct  17   ETQPIKRRKKKSMVWEHFTIETVSPGCRRACCKGCKQSFAYSTGSKVAGTSHLKRHIAKG  76

Query  664  TCAA  675
            TC A
Sbjct  77   TCPA  80



>ref|XP_010541714.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E QP KRRKKKSMVWE FTIE V  GCRRACC  CKQSFAYS G KVAGTSHLKRHIAKG
Sbjct  17   ETQPSKRRKKKSMVWEHFTIETVSPGCRRACCNGCKQSFAYSNGSKVAGTSHLKRHIAKG  76

Query  664  TCAA  675
            TC A
Sbjct  77   TCPA  80



>ref|XP_010541713.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Tarenaya hassleriana]
Length=665

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E QP KRRKKKSMVWE FTIE V  GCRRACC  CKQSFAYS G KVAGTSHLKRHIAKG
Sbjct  34   ETQPSKRRKKKSMVWEHFTIETVSPGCRRACCNGCKQSFAYSNGSKVAGTSHLKRHIAKG  93

Query  664  TCAA  675
            TC A
Sbjct  94   TCPA  97



>ref|XP_002325201.2| hypothetical protein POPTR_0018s12680g [Populus trichocarpa]
 gb|EEF03766.2| hypothetical protein POPTR_0018s12680g [Populus trichocarpa]
Length=716

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +1

Query  445  MQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKV  624
            ++ENS  T  +G E QP KRRK+KSMVWE FTIE + + CRRA CKQC+QSFAYS G KV
Sbjct  55   LEENSRST--HGPETQPSKRRKRKSMVWEHFTIETLSSDCRRAFCKQCRQSFAYSMGSKV  112

Query  625  AGTSHLKRHIAKGTCAA  675
            +GTSHLKRHIAKGTC A
Sbjct  113  SGTSHLKRHIAKGTCLA  129



>gb|KHN24413.1| Putative AC transposase [Glycine soja]
Length=874

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 14/117 (12%)
 Frame = +1

Query  346  IDNNELVVHSEMM---ADHEILPDEMMLNNEIVPMEMQENSLGTPLNG----SEMQPKKR  504
            ++N E + H++++   A++E+   + + + EI+  E       TPLN      E QP KR
Sbjct  353  LENTETMHHNQIVNSQANYEMTFSDAIPSYEIINAE-------TPLNNEDCIPEAQPIKR  405

Query  505  RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            RKKKS+VWE FTIEAV   CRRA CKQC Q+FAYS G KVAGTSHLKRH+AKGTC+A
Sbjct  406  RKKKSIVWEHFTIEAVSPECRRARCKQCAQTFAYSTGSKVAGTSHLKRHVAKGTCSA  462



>ref|XP_002325202.1| hypothetical protein POPTR_0018s12690g [Populus trichocarpa]
 gb|EEF03767.1| hypothetical protein POPTR_0018s12690g [Populus trichocarpa]
Length=666

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  469  PLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
            P +  E QP KRRKKKS+VWE FTIE V  GCRRA C QCKQSFAYS G KVAGTSHLKR
Sbjct  14   PESTPETQPNKRRKKKSIVWEHFTIENVSPGCRRASCNQCKQSFAYSTGSKVAGTSHLKR  73

Query  649  HIAKGTCAA  675
            HIAKGTC A
Sbjct  74   HIAKGTCPA  82



>ref|XP_011017829.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=666

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  469  PLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
            P +  E QP KRRKKKS+VWE FTIE V  GCRRA C QCKQSFAYS G KVAGTSHLKR
Sbjct  14   PESTPETQPNKRRKKKSIVWEHFTIENVSPGCRRASCNQCKQSFAYSTGSKVAGTSHLKR  73

Query  649  HIAKGTCAA  675
            HIAKGTC A
Sbjct  74   HIAKGTCPA  82



>ref|XP_006384324.1| hypothetical protein POPTR_0004s12760g [Populus trichocarpa]
 gb|ERP62121.1| hypothetical protein POPTR_0004s12760g [Populus trichocarpa]
Length=842

 Score =   113 bits (282),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 63/120 (53%), Positives = 72/120 (60%), Gaps = 6/120 (5%)
 Frame = +1

Query  328  TTPETPI----DNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQP  495
            T PE  +    DNN L+   E         ++++   E      +EN+   P    E QP
Sbjct  141  TPPENQMATLEDNNHLITTPEYQLATLEENNQLITTPEYQMETFEENNHSMP--APETQP  198

Query  496  KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
             KRRK+KSMVWE FTIE V    RRA CKQCKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  199  NKRRKRKSMVWEHFTIETVSADSRRAFCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCLA  258



>gb|KHG07202.1| Putative AC transposase [Gossypium arboreum]
Length=480

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 67/122 (55%), Gaps = 37/122 (30%)
 Frame = +1

Query  304  KMASQFTPTTPETPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGS  483
            +M +   P TP TP DNN+LV                                      S
Sbjct  75   EMETAIIPVTPITPTDNNDLV-------------------------------------SS  97

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E+QP KRR+KKS+VW+ FT+E VG+GC RACC QCK+SFAY  G K+AGTSHLKRHIA G
Sbjct  98   EVQPNKRRRKKSIVWDHFTVETVGDGCIRACCNQCKKSFAYITGSKLAGTSHLKRHIALG  157

Query  664  TC  669
             C
Sbjct  158  IC  159



>ref|XP_011014817.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=813

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = +1

Query  349  DNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVW  528
            DNN L+   E         ++++   E      +EN+   P    E QP KRRK+KSMVW
Sbjct  123  DNNHLITTPEYQLATLEENNQLITTPEYQMETFEENNHSMP--APETQPNKRRKRKSMVW  180

Query  529  EFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            E FTIE V    RRA CKQCKQSFAYS G KVAGTSHLKRHIAKGTC A
Sbjct  181  EHFTIETVSAESRRAFCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCLA  229



>gb|EPS65666.1| hypothetical protein M569_09109, partial [Genlisea aurea]
Length=690

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 63/115 (55%), Positives = 75/115 (65%), Gaps = 13/115 (11%)
 Frame = +1

Query  346  IDNNELVVHSEMMA---DHEILPDEMML---NNEIVPMEMQENSLGTPLNGSEMQPKKRR  507
            I+N E  +  E++    D + L  EM+L   N+E+  M +    L  P      QPK RR
Sbjct  3    IENPEAAIGDELVPLEDDSQNLDTEMLLLEPNHEVDMMTLSTVDLQQP------QPK-RR  55

Query  508  KKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCA  672
            KKKS+VWE FTIE+V   CRRA C QCKQSFAYS G KVAGTSHLKRHIAKGTC+
Sbjct  56   KKKSIVWEHFTIESVSPDCRRAYCNQCKQSFAYSTGSKVAGTSHLKRHIAKGTCS  110



>gb|KJB66355.1| hypothetical protein B456_010G137500 [Gossypium raimondii]
Length=746

 Score =   111 bits (278),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 56/121 (46%), Positives = 66/121 (55%), Gaps = 37/121 (31%)
 Frame = +1

Query  307  MASQFTPTTPETPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSE  486
            M +   P TP TP DNN+LV                                      SE
Sbjct  1    METAIIPVTPITPTDNNDLV-------------------------------------SSE  23

Query  487  MQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGT  666
            +QP KRR+KKS+VW+ FT+E VG+GC RACC QCK+SFAY  G K+AGTSHLKRHIA G 
Sbjct  24   VQPNKRRRKKSIVWDHFTVETVGDGCIRACCNQCKKSFAYITGSKLAGTSHLKRHIALGI  83

Query  667  C  669
            C
Sbjct  84   C  84



>ref|XP_010425789.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Camelina sativa]
Length=654

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            T +   E QP KRRKKKSMVWE FTIE+V   CRRA CK CKQSFAYS G KVAGTSHLK
Sbjct  11   TEMKSPETQPIKRRKKKSMVWEHFTIESVEPNCRRAFCKGCKQSFAYSNGNKVAGTSHLK  70

Query  646  RHIAKGTCAA  675
            RHIAKGTC A
Sbjct  71   RHIAKGTCPA  80



>ref|XP_007023276.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
 gb|EOY25898.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
Length=764

 Score =   111 bits (278),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = +1

Query  421  NNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSF  600
            N  + P+   +NS   PLN SE+QP KRR+KKS+VW+ FT+E VG+GC RACC QCK+SF
Sbjct  11   NMPVTPITPTDNS--EPLN-SEVQPNKRRRKKSIVWDHFTVETVGDGCIRACCNQCKKSF  67

Query  601  AYSQGCKVAGTSHLKRHIAKGTC  669
            AY  G K+AGTSHLKRHIA G C
Sbjct  68   AYITGSKLAGTSHLKRHIALGIC  90



>ref|XP_006385302.1| hypothetical protein POPTR_0003s02610g [Populus trichocarpa]
 gb|ERP63099.1| hypothetical protein POPTR_0003s02610g [Populus trichocarpa]
Length=668

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +1

Query  406  DEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQ  585
            D M     I+P+    N+ G P   SE QP KRR+KKS+VWE FTIE VG GC RACCKQ
Sbjct  5    DPMSPTMAIIPVTPTNNN-GPP--TSEEQPNKRRRKKSIVWEHFTIETVGAGCMRACCKQ  61

Query  586  CKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            CK+SFAY  G K+AGTSHLKRHIA G C  
Sbjct  62   CKKSFAYITGTKLAGTSHLKRHIALGICPV  91



>ref|XP_006384329.1| hypothetical protein POPTR_0004s12810g [Populus trichocarpa]
 gb|ERP62126.1| hypothetical protein POPTR_0004s12810g [Populus trichocarpa]
Length=842

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  349  DNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVW  528
            DNN L+   E         ++++   E      +EN+   P    E QP KRRK+KSMVW
Sbjct  152  DNNHLITTPEYQLATLEENNQLITTPEYQMERFEENNHSMP--APETQPNKRRKRKSMVW  209

Query  529  EFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            E FTIE V    RRA CKQCKQ FAYS G KVAGTSHLKRHIAKGTC A
Sbjct  210  EHFTIETVSAESRRAFCKQCKQGFAYSTGSKVAGTSHLKRHIAKGTCLA  258



>ref|XP_010496529.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=655

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            T +   E QP KRRKKKSMVWE FTIE V   CRRA CK CKQSFAYS G KVAGTSHLK
Sbjct  12   TEMKSPETQPIKRRKKKSMVWEHFTIECVEPNCRRAFCKGCKQSFAYSNGNKVAGTSHLK  71

Query  646  RHIAKGTCAA  675
            RHIAKGTC A
Sbjct  72   RHIAKGTCPA  81



>ref|XP_010514702.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=655

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            T +   E QP KRRKKKSMVWE FTIE V   CRRA CK CKQSFAYS G KVAGTSHLK
Sbjct  12   TEMKSPETQPIKRRKKKSMVWEHFTIECVEPNCRRAFCKGCKQSFAYSNGNKVAGTSHLK  71

Query  646  RHIAKGTCAA  675
            RHIAKGTC A
Sbjct  72   RHIAKGTCPA  81



>ref|XP_002875576.1| hypothetical protein ARALYDRAFT_323059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51835.1| hypothetical protein ARALYDRAFT_323059 [Arabidopsis lyrata subsp. 
lyrata]
Length=654

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            T     E QP KRRKKKSMVWE FTIEAV   CRRA CK C QSFAYS G KVAGTSHLK
Sbjct  11   TETRSPETQPIKRRKKKSMVWEHFTIEAVEPNCRRAFCKGCNQSFAYSNGNKVAGTSHLK  70

Query  646  RHIAKGTCAA  675
            RHIAKGTC A
Sbjct  71   RHIAKGTCPA  80



>gb|ABA18109.1| hAT-like transposase [Arabidopsis arenosa]
Length=654

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            T     E QP KRRKKKSMVWE FTIEAV   CRRA CK C QSFAYS G KVAGTSHLK
Sbjct  11   TETRSPETQPIKRRKKKSMVWEHFTIEAVEPNCRRAFCKGCNQSFAYSNGNKVAGTSHLK  70

Query  646  RHIAKGTCAA  675
            RHIAKGTC A
Sbjct  71   RHIAKGTCPA  80



>ref|XP_010250193.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nelumbo nucifera]
Length=667

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  469  PLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
            P++    Q  KRR+KKS+VWE FTIE VG GC RACCKQCKQ+FAYS G K+AGTSHLKR
Sbjct  10   PISTEPTQSNKRRRKKSIVWEHFTIEPVGAGCTRACCKQCKQTFAYSTGTKLAGTSHLKR  69

Query  649  HIAKGTCAA  675
            HI  GTC A
Sbjct  70   HIMLGTCPA  78



>ref|XP_006279357.1| hypothetical protein CARUB_v10008021mg [Capsella rubella]
 gb|ABA18106.1| hAT-like transposase [Capsella rubella]
 gb|EOA12255.1| hypothetical protein CARUB_v10008021mg [Capsella rubella]
Length=665

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +1

Query  436  PMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQG  615
            P+E++  +  T     E QP KRRKKKSMVWE FTIE+V   CRRA CK C QSFAYS G
Sbjct  17   PLEVEVYN-DTETRSPETQPIKRRKKKSMVWEHFTIESVEPNCRRAFCKGCNQSFAYSNG  75

Query  616  CKVAGTSHLKRHIAKGTCAA  675
             KVAGTSHLKRHIAKGTC A
Sbjct  76   NKVAGTSHLKRHIAKGTCPA  95



>ref|XP_011044854.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Populus euphratica]
Length=843

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/88 (63%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +1

Query  406  DEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQ  585
            D M     I+P+    N+ G P   SE QP KRR+KKS+VWE FTIE VG GC RACCKQ
Sbjct  5    DPMSPTMAIIPVTPTINN-GPPT--SEEQPNKRRRKKSIVWEHFTIETVGAGCMRACCKQ  61

Query  586  CKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            CK+SFAY  G K+AGTSHLKRHIA G C
Sbjct  62   CKKSFAYITGTKLAGTSHLKRHIALGIC  89



>ref|XP_011044853.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Populus euphratica]
Length=851

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/88 (63%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +1

Query  406  DEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQ  585
            D M     I+P+    N+ G P   SE QP KRR+KKS+VWE FTIE VG GC RACCKQ
Sbjct  5    DPMSPTMAIIPVTPTINN-GPPT--SEEQPNKRRRKKSIVWEHFTIETVGAGCMRACCKQ  61

Query  586  CKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            CK+SFAY  G K+AGTSHLKRHIA G C
Sbjct  62   CKKSFAYITGTKLAGTSHLKRHIALGIC  89



>ref|XP_010063482.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Eucalyptus grandis]
 gb|KCW70722.1| hypothetical protein EUGRSUZ_F03885 [Eucalyptus grandis]
Length=789

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 77/130 (59%), Gaps = 20/130 (15%)
 Frame = +1

Query  325  PTTPETPIDNNELVVHSEMMADHEILPDEMMLNNEIVP-----------MEMQENSLGTP  471
            P T    I + EL +  E   DH  +P+    ++ ++P           M +   +  TP
Sbjct  55   PETELAIIPDTELAIIPE--TDHANIPET---DDALIPETDMDFAPDSDMAIVPATPATP  109

Query  472  LN----GSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSH  639
            L+    GSE QP KRR+KKS+VWE FT+E VG G  RACCKQCK+SFAY  G K+AGTSH
Sbjct  110  LDNEQPGSETQPNKRRRKKSIVWEHFTVETVGPGHTRACCKQCKKSFAYITGSKLAGTSH  169

Query  640  LKRHIAKGTC  669
            LKRHIA G C
Sbjct  170  LKRHIALGIC  179



>ref|XP_006369308.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65877.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
Length=1099

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTCAA  675
            G C  
Sbjct  87   GICPV  91



>ref|XP_008790202.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008790203.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=682

 Score =   108 bits (270),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  490  QPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            QP KRR+KKS+VWE FTIEAV  GC RACCK CKQ+FAYS G K+AGTSHLKRHIA G+C
Sbjct  17   QPSKRRRKKSLVWEHFTIEAVAGGCTRACCKLCKQTFAYSSGSKIAGTSHLKRHIALGSC  76



>ref|XP_011007705.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Populus euphratica]
Length=1024

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTCAA  675
            G C  
Sbjct  87   GICPV  91



>ref|XP_011007704.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Populus euphratica]
Length=1027

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTCAA  675
            G C  
Sbjct  87   GICPV  91



>ref|XP_011007700.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007701.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007702.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007703.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
Length=1042

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTCAA  675
            G C  
Sbjct  87   GICPV  91



>ref|XP_011007706.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X4 [Populus euphratica]
Length=1017

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTCAA  675
            G C  
Sbjct  87   GICPV  91



>ref|XP_011467072.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Fragaria vesca subsp. vesca]
Length=673

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = +1

Query  463  GTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHL  642
            G P  GSE QP KRR+KKS+VWE FTIE VG GC RACC QCK+SFAY  G K+AGTSHL
Sbjct  12   GVP--GSETQPSKRRRKKSVVWEHFTIETVGAGCTRACCNQCKRSFAYITGSKMAGTSHL  69

Query  643  KRHIAKGTC  669
            KRHI+ G C
Sbjct  70   KRHISLGIC  78



>ref|XP_011044850.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011044851.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011044852.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
Length=886

 Score =   108 bits (270),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 55/88 (63%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +1

Query  406  DEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQ  585
            D M     I+P+    N+ G P   SE QP KRR+KKS+VWE FTIE VG GC RACCKQ
Sbjct  5    DPMSPTMAIIPVTPTINN-GPPT--SEEQPNKRRRKKSIVWEHFTIETVGAGCMRACCKQ  61

Query  586  CKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            CK+SFAY  G K+AGTSHLKRHIA G C
Sbjct  62   CKKSFAYITGTKLAGTSHLKRHIALGIC  89



>ref|XP_008643805.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=764

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILP-DEMMLNNEIVPMEMQEN----SLGTPLNGSEMQPK--KR  504
            I   E+V  SEM+  H+++  ++++  NE+VP+    N    + G  L  S+M P+  +R
Sbjct  48   IRGTEMVEGSEMIHGHDMVQVNDLIHGNEMVPVHDMVNGDKIAHGNELVNSQMTPRISRR  107

Query  505  RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            RKKKS+VWE FTIE +  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  108  RKKKSLVWEHFTIELMPGGSSRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  162



>ref|XP_011007708.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X6 [Populus euphratica]
Length=902

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTCAA  675
            G C  
Sbjct  87   GICPV  91



>ref|XP_010241568.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241570.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241571.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241572.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241573.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=675

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +1

Query  484  EMQPK-KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            + QP  KRR+KKS+VWE FTIEAVG GC RACCKQCKQ+FAYS G K+AGTSHLKRHI  
Sbjct  20   QAQPNNKRRRKKSIVWEHFTIEAVGAGCTRACCKQCKQTFAYSTGSKLAGTSHLKRHIML  79

Query  661  GTCAA  675
            GTC A
Sbjct  80   GTCPA  84



>ref|XP_011007707.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X5 [Populus euphratica]
Length=920

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTCAA  675
            G C  
Sbjct  87   GICPV  91



>gb|ABA18094.1| hAT-like transposase [Olimarabidopsis pumila]
Length=672

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = +1

Query  451  ENSLGTPLNGSEMQPK-KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVA  627
            E  +G+P    E QP  KRRKKKSMVWE FTIEAV   CRRA CK C QSFAYS G KVA
Sbjct  23   ETEMGSP----ETQPPIKRRKKKSMVWEHFTIEAVEPNCRRAFCKGCNQSFAYSNGNKVA  78

Query  628  GTSHLKRHIAKGTCAA  675
            GTSHLKRHIAKGTC A
Sbjct  79   GTSHLKRHIAKGTCPA  94



>ref|XP_008776870.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776871.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776872.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776873.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=679

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  490  QPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            QP +RR+KKS+VWE FTIEAV  GC RACCK CKQ+FAYS G K+AGTSHLKRHIA G+C
Sbjct  18   QPSRRRRKKSLVWEHFTIEAVSGGCTRACCKLCKQTFAYSSGSKIAGTSHLKRHIALGSC  77



>gb|KHN27849.1| Putative AC transposase [Glycine soja]
Length=767

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 14/117 (12%)
 Frame = +1

Query  346  IDNNELVVHSEMM---ADHEILPDEMMLNNEIVPMEMQENSLGTPLNGS----EMQPKKR  504
            ++N E + H++++   A++E+   + + + EI+  E       TPLN      E QP KR
Sbjct  322  LENTETMHHNQIVNSQANYEMTFSDAIPSCEIINAE-------TPLNNEDCVPETQPIKR  374

Query  505  RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTCAA  675
            RKK+S+VWE FTIEAV   CRRA CK+C Q+FAYS G KVAGTSHLK H+AKG C+A
Sbjct  375  RKKRSIVWEHFTIEAVSPECRRARCKRCAQTFAYSTGSKVAGTSHLKSHVAKGICSA  431



>ref|NP_189803.1| BED zinc finger and hAT dimerization domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9M2N5.1|DSLE_ARATH RecName: Full=Zinc finger BED domain-containing protein DAYSLEEPER; 
AltName: Full=Transposase-like protein DAYSLEEPER [Arabidopsis 
thaliana]
 emb|CAB68118.1| putative transposase [Arabidopsis thaliana]
 gb|AAO24589.1| At3g42170 [Arabidopsis thaliana]
 dbj|BAE99632.1| putative transposase [Arabidopsis thaliana]
 gb|AEE77728.1| BED zinc finger and hAT dimerization domain-containing protein 
[Arabidopsis thaliana]
Length=696

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            T +   E QP KRRKKKSMVWE FTIEAV   CRRA CK C QSFAYS G KVAGTSHLK
Sbjct  51   TEMVSPETQPIKRRKKKSMVWEHFTIEAVEPNCRRAFCKGCNQSFAYSNGNKVAGTSHLK  110

Query  646  RHIAKGTCAA  675
            RHI KGTC A
Sbjct  111  RHIFKGTCPA  120



>gb|AAW28145.1| hAT-like transposase [Arabidopsis thaliana]
Length=696

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  TPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            T +   E QP KRRKKKSMVWE FTIEAV   CRRA CK C QSFAYS G KVAGTSHLK
Sbjct  51   TEMVSPETQPIKRRKKKSMVWEHFTIEAVEPNCRRAFCKGCNQSFAYSNGNKVAGTSHLK  110

Query  646  RHIAKGTCAA  675
            RHI KGTC A
Sbjct  111  RHIFKGTCPA  120



>ref|NP_001151544.1| transposon protein [Zea mays]
 gb|ACG43259.1| transposon protein [Zea mays]
Length=764

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILP-DEMMLNNEIVPMEMQEN----SLGTPLNGSEMQPK--KR  504
            I   E+V  SEM+  H+++  ++++  NE+VP+    N    + G  L  ++M P+  +R
Sbjct  48   IRGTEMVEGSEMIHGHDMVQVNDLIHGNEMVPVHDMVNGDKIAHGNELVNAQMTPRISRR  107

Query  505  RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            RKKKS+VWE FTIE +  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  108  RKKKSLVWEHFTIELMPGGSSRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  162



>ref|XP_008675089.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008675096.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=768

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILP-DEMMLNNEIVPMEMQENSLGTP----LNGSEMQPKKRRK  510
            I   E+V  SEM+  HE++  ++++  NE+V + +  N    P       +E+ P++RRK
Sbjct  54   IHGTEMVEGSEMIHGHEMVQVNDLIHGNEMVAVNVMVNGDEMPHVNEFINTEVTPRRRRK  113

Query  511  KKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            KKS+VWE FTIE +  G  RACC  CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  114  KKSLVWEHFTIEPMPGGNSRACCNLCKQTFAYSSGSKIAGTSHLKRHITLGSC  166



>ref|NP_001147988.1| transposon protein [Zea mays]
 gb|ACG29330.1| transposon protein [Zea mays]
Length=768

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILP-DEMMLNNEIVPMEMQENSLGTP----LNGSEMQPKKRRK  510
            I   E+V  SEM+  HE++  ++++  NE+V + +  N    P       +E+ P++RRK
Sbjct  54   IHGTEMVEGSEMIHGHEMVQVNDLIHGNEMVAVNVMVNGDEMPHVNEFINTEVTPRRRRK  113

Query  511  KKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            KKS+VWE FTIE +  G  RACC  CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  114  KKSLVWEHFTIEPMPGGNSRACCNLCKQTFAYSSGSKIAGTSHLKRHITLGSC  166



>ref|XP_002461238.1| hypothetical protein SORBIDRAFT_02g043380 [Sorghum bicolor]
 gb|EER97759.1| hypothetical protein SORBIDRAFT_02g043380 [Sorghum bicolor]
Length=414

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 11/104 (11%)
 Frame = +1

Query  364  VVHSEMMADHEILP--DEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFF  537
            ++  E +A  E LP  D+++  NE+V  E+       P  G+     +RR+KKS+VWE F
Sbjct  35   LIQGEELAHGEELPQGDDLVQGNELVVSEVAT----PPTTGT-----RRRRKKSLVWEHF  85

Query  538  TIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            TIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  86   TIEAVAGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  129



>ref|XP_009379895.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009379896.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=685

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 9/88 (10%)
 Frame = +1

Query  424  NEIVPMEMQENSLGTPLN----GSEMQPK--KRRKKKSMVWEFFTIEAVGNGCRRACCKQ  585
            N +  ME+ ++    PLN     +E  P   +RR+KKSMVWE FT+E V +GC RACCK 
Sbjct  3    NSVCTMEVSDSE---PLNTEPLDTETAPSTTRRRRKKSMVWEHFTVEVVSDGCTRACCKL  59

Query  586  CKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            CKQ+FAYS G KVAGTSHLKRHIA G+C
Sbjct  60   CKQTFAYSNGSKVAGTSHLKRHIALGSC  87



>ref|XP_002463929.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
 gb|EER90927.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
Length=770

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 73/110 (66%), Gaps = 9/110 (8%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPK--KRRKKKS  519
            I  +E+V  ++++  HE++P   M+N +       E + G  L  +EM P+  +RRKKKS
Sbjct  66   IHGHEMVQVNDLINGHEMVPVNDMVNGD-------EMAHGNELVNAEMTPRTSRRRKKKS  118

Query  520  MVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            +VWE FTIEA+  G  RACC  CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  119  LVWEHFTIEAMPGGNSRACCNLCKQTFAYSSGSKIAGTSHLKRHITLGSC  168



>gb|EAY97185.1| hypothetical protein OsI_19106 [Oryza sativa Indica Group]
Length=409

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 6/111 (5%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQ---PKKRRKKK  516
            +  NE+V  +      E+  DE++L  +++     +   G  L  +EM      +RR+KK
Sbjct  12   VQGNEIVPSNGEALAEEVQGDELVLAEDLI---QGDEVQGNELVSAEMSIPPTSRRRRKK  68

Query  517  SMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            S+VWE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  69   SLVWEHFTIEAVSGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  119



>ref|XP_010654811.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Vitis vinifera]
Length=689

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = +1

Query  466  TPLN---GSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTS  636
            TP N    SE+Q  KRR+KKS+VWE FT+E V  GC RACCKQCK+SFAY  G K+AGTS
Sbjct  6    TPNNEQANSEIQLNKRRRKKSIVWEHFTVETVSAGCTRACCKQCKKSFAYITGSKLAGTS  65

Query  637  HLKRHIAKGTC  669
            HLKRHIA G C
Sbjct  66   HLKRHIALGIC  76



>gb|EAY91763.1| hypothetical protein OsI_13406 [Oryza sativa Indica Group]
Length=409

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 6/108 (6%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMV  525
            + +NE     E+  D  +L +++   +E+    +    + TP         +RR+KKS+V
Sbjct  18   VPSNEEAHAEEVQGDELVLAEDLAQGDEVQVNRLVSAEMSTPPTS------RRRRKKSLV  71

Query  526  WEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            WE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  72   WEHFTIEAVSGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  119



>gb|EEE64835.1| hypothetical protein OsJ_19692 [Oryza sativa Japonica Group]
Length=722

 Score =   104 bits (260),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 10/115 (9%)
 Frame = +1

Query  349  DNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPK--------KR  504
            ++N++V  +E++  +E    E +  +E+VP E  + + G  + G+E+           +R
Sbjct  7    NDNQVVQGNEIVPSNEEAQAEEVQGDELVPAE--DLTQGDEVQGNELVSAEISTPPTLRR  64

Query  505  RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            R+KKS+VWE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  65   RRKKSLVWEHFTIEAVSGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  119



>ref|XP_006369306.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 ref|XP_006369307.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65875.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65876.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
Length=1024

 Score =   105 bits (261),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP KRR+KKS+VWE FTIE VG GC RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  27   SEEQPSKRRRKKSIVWEHFTIETVGAGCMRACCKQCKKSFAYITGSKLAGTSHLKRHIAL  86

Query  661  GTC  669
            G C
Sbjct  87   GIC  89



>ref|NP_001147437.1| LOC100281046 [Zea mays]
 gb|ACG27513.1| transposon protein [Zea mays]
Length=719

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 17/113 (15%)
 Frame = +1

Query  352  NNELVVHSEMMADHEIL-------PDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRK  510
            +NE+ + +E +   E++        D+++  NE+V  E+   ++GT          +RR+
Sbjct  14   DNEIALSNEAIQGDELVHVEELSQGDDLVQGNELVVSEVTTPTIGT----------RRRR  63

Query  511  KKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            KKS+VWE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  64   KKSLVWEHFTIEAVAGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  116



>ref|XP_008643588.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643589.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643590.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
Length=719

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 17/113 (15%)
 Frame = +1

Query  352  NNELVVHSEMMADHEIL-------PDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRK  510
            +NE+ + +E +   E++        D+++  NE+V  E+   ++GT          +RR+
Sbjct  14   DNEIALSNEAIQGDELVHVEELSQGDDLVQGNELVVSEVTTPTIGT----------RRRR  63

Query  511  KKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            KKS+VWE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  64   KKSLVWEHFTIEAVAGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  116



>emb|CAN81954.1| hypothetical protein VITISV_014020 [Vitis vinifera]
Length=1045

 Score =   105 bits (261),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = +1

Query  466  TPLN---GSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTS  636
            TP N    SE+Q  KRR+KKS+VWE FT+E V  GC RACCKQCK+SFAY  G K+AGTS
Sbjct  362  TPNNEQANSEIQLNKRRRKKSIVWEHFTVETVSAGCTRACCKQCKKSFAYITGSKLAGTS  421

Query  637  HLKRHIAKGTC  669
            HLKRHIA G C
Sbjct  422  HLKRHIALGIC  432



>gb|EEC79762.1| hypothetical protein OsI_21153 [Oryza sativa Indica Group]
Length=722

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 10/115 (9%)
 Frame = +1

Query  349  DNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPK--------KR  504
            ++N++V  +E++  +E    E +  +E+VP E  + + G  + G+E+           +R
Sbjct  7    NDNQVVQGNEIVQSNEEAQAEEVQGDELVPAE--DLTQGDEVQGNELVSAEISTPPTLRR  64

Query  505  RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            R+KKS+VWE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  65   RRKKSLVWEHFTIEAVSGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  119



>ref|XP_009379897.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379898.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379899.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=678

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +1

Query  451  ENSLGTPLN----GSEMQPK--KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQ  612
            E S   PLN     +E  P   +RR+KKSMVWE FT+E V +GC RACCK CKQ+FAYS 
Sbjct  2    EVSDSEPLNTEPLDTETAPSTTRRRRKKSMVWEHFTVEVVSDGCTRACCKLCKQTFAYSN  61

Query  613  GCKVAGTSHLKRHIAKGTC  669
            G KVAGTSHLKRHIA G+C
Sbjct  62   GSKVAGTSHLKRHIALGSC  80



>ref|XP_009336302.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Pyrus x bretschneideri]
Length=679

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +1

Query  436  PMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQG  615
            P+   +N+ G P   SE QP KRR+KKS+VWE FTIE +G G  RACCKQCK+ FAY  G
Sbjct  4    PLTPTDNN-GIP--SSETQPNKRRRKKSIVWEHFTIETIGVGNTRACCKQCKKYFAYITG  60

Query  616  CKVAGTSHLKRHIAKGTC  669
             K+AGTSHLKRHIA G C
Sbjct  61   SKLAGTSHLKRHIALGIC  78



>gb|KDO48633.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
 gb|KDO48634.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
 gb|KDO48635.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
Length=694

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 64/111 (58%), Gaps = 22/111 (20%)
 Frame = +1

Query  337  ETPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKK  516
            +TPI        + +M D  I P     N E++ +E Q              P KRR+KK
Sbjct  2    DTPI--------ATVMPDTPITPSSPSGNRELMNLETQ--------------PNKRRRKK  39

Query  517  SMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            S+VW++FT+E V  GC RACC QCK+SFAY  G K+AGTSHLKRHI  G C
Sbjct  40   SIVWDYFTVETVDAGCTRACCNQCKKSFAYITGSKLAGTSHLKRHITMGIC  90



>ref|XP_006427320.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 ref|XP_006427321.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 gb|ESR40560.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 gb|ESR40561.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
Length=699

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 64/111 (58%), Gaps = 22/111 (20%)
 Frame = +1

Query  337  ETPIDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKK  516
            +TPI        + +M D  I P     N E++ +E Q              P KRR+KK
Sbjct  2    DTPI--------ATVMPDTPITPSSPSGNRELMNLETQ--------------PNKRRRKK  39

Query  517  SMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            S+VW++FT+E V  GC RACC QCK+SFAY  G K+AGTSHLKRHI  G C
Sbjct  40   SIVWDYFTVETVDAGCTRACCNQCKKSFAYITGSKLAGTSHLKRHITMGIC  90



>ref|XP_009594303.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
 ref|XP_009594304.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
 ref|XP_009594305.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=675

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  LNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRH  651
            +  SE QP KRR+KKS+VWE FTIE +   C RACCKQCK+SFAY  G K+AGTSHLKRH
Sbjct  10   IADSEAQPNKRRRKKSIVWEHFTIETIDADCTRACCKQCKKSFAYISGSKLAGTSHLKRH  69

Query  652  IAKGTC  669
            IA G C
Sbjct  70   IALGIC  75



>ref|XP_010906913.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  499  KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            KRR+KKS+VWE FTIEAV  GC RACCK CKQ+FAYS G K+AGTSHLKRHIA G+C
Sbjct  21   KRRRKKSLVWEHFTIEAVSGGCTRACCKLCKQTFAYSSGSKIAGTSHLKRHIALGSC  77



>ref|NP_001174288.1| Os05g0239150 [Oryza sativa Japonica Group]
 sp|B9FJG3.1|RSLE1_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
1; AltName: Full=Transposase-like protein RICESLEEPER 
1 [Oryza sativa Japonica Group]
 gb|EEE62941.1| hypothetical protein OsJ_17746 [Oryza sativa Japonica Group]
 dbj|BAH93016.1| Os05g0239150 [Oryza sativa Japonica Group]
Length=722

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 72/119 (61%), Gaps = 11/119 (9%)
 Frame = +1

Query  337  ETPIDN-----NELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQ---  492
            ET  DN     NE+V  +      E+  DE++L  +++     +   G  L  +EM    
Sbjct  4    ETSNDNLVVQGNEIVPSNGEALAEEVQGDELVLAEDLI---QGDEVQGNELVSAEMSIPP  60

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
              +RR+KKS+VWE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  61   TSRRRRKKSLVWEHFTIEAVSGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  119



>ref|XP_011457838.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Fragaria vesca subsp. vesca]
Length=735

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 75/136 (55%), Gaps = 24/136 (18%)
 Frame = +1

Query  340  TPIDNNELVVHSEMMADHE---ILPDEMMLNNEIVPMEMQEN--SLGTPLNGS-------  483
            +PI  N   V    ++DHE   I+  +    +   P    EN  ++  P NG+       
Sbjct  54   SPIQQNPDEVQKMAISDHEEKIIIQTQTHYEDPETPFPEFENNKAISYPNNGAASYPNSG  113

Query  484  ------------EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVA  627
                        E QP KRRK+KS VWE FTI+    GCRRA C QCK+S+AYS+G KV+
Sbjct  114  ADSNPNNEETNHETQPNKRRKRKSTVWEHFTIQTESAGCRRAYCNQCKRSYAYSKGSKVS  173

Query  628  GTSHLKRHIAKGTCAA  675
            GTSHL+RH+ KG+CAA
Sbjct  174  GTSHLRRHVEKGSCAA  189



>ref|XP_010906914.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  499  KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            +RR+KKS+VWE FTIEAV  GC RACCK CKQ+FAYS G K+AGTSHLKRHIA G+C
Sbjct  21   RRRRKKSLVWEHFTIEAVSGGCTRACCKLCKQTFAYSSGSKIAGTSHLKRHIALGSC  77



>ref|NP_001051173.1| Os03g0733400 [Oryza sativa Japonica Group]
 sp|Q6AVI0.1|RSLE2_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
2; AltName: Full=Transposase-like protein RICESLEEPER 
2 [Oryza sativa Japonica Group]
 gb|AAT77879.1| putative hAT family dimerisation domain containing protein [Oryza 
sativa Japonica Group]
 gb|AAT78789.1| putative transposases [Oryza sativa Japonica Group]
 gb|ABF98716.1| hAT family dimerisation domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13087.1| Os03g0733400 [Oryza sativa Japonica Group]
 gb|EAZ28483.1| hypothetical protein OsJ_12466 [Oryza sativa Japonica Group]
 dbj|BAH00332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=722

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 6/108 (6%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMV  525
            + +NE     E+  D  +L +++   +E+    +    + TP         +RR+KKS+V
Sbjct  18   VPSNEEAHAEEVQGDELVLAEDLAQGDEVQVNGLVSAEMSTP------PTSRRRRKKSLV  71

Query  526  WEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            WE FTIEAV  G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  72   WEHFTIEAVSGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  119



>ref|XP_009757855.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009757861.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Nicotiana sylvestris]
Length=697

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            S+ QP KRR+KKS+VWE FTIE +   C RACCKQCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  35   SQAQPNKRRRKKSIVWEHFTIETIDADCTRACCKQCKKSFAYISGSKLAGTSHLKRHIAL  94

Query  661  GTC  669
            G C
Sbjct  95   GIC  97



>ref|XP_011081945.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Sesamum indicum]
Length=679

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            S+ QP KRR+KKSMVWE FTIE V   C RACC QCK+SFAY  G K+AGTSHLKRHIA 
Sbjct  16   SDAQPNKRRRKKSMVWEHFTIETVDADCIRACCNQCKKSFAYISGSKLAGTSHLKRHIAL  75

Query  661  GTC  669
            G C
Sbjct  76   GIC  78



>ref|XP_009390780.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390781.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390782.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=673

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = +1

Query  451  ENSLGTPLNGSEMQP--KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKV  624
            E S   P+N +E+ P   +RR+KKSMVWE FTIE +   C RACCK CKQ+FAYS G KV
Sbjct  2    EASDAEPMN-TEITPPTSRRRRKKSMVWEHFTIETISGSCTRACCKLCKQTFAYSNGSKV  60

Query  625  AGTSHLKRHIAKGTC  669
            AGTSHLKRHIA G+C
Sbjct  61   AGTSHLKRHIALGSC  75



>ref|XP_010097200.1| Putative AC transposase [Morus notabilis]
 gb|EXB67267.1| Putative AC transposase [Morus notabilis]
Length=682

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 6/80 (8%)
 Frame = +1

Query  430  IVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYS  609
            IVP+E  E ++      +E+QP KRR+KKS+VW++FT+E V   C +ACCKQCK++F+Y 
Sbjct  6    IVPIENSEVTI------AEIQPNKRRRKKSVVWQYFTVEKVSPDCVKACCKQCKKTFSYI  59

Query  610  QGCKVAGTSHLKRHIAKGTC  669
             G KVAGTSHLKRHI  G C
Sbjct  60   TGSKVAGTSHLKRHIDLGIC  79



>ref|XP_009757867.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Nicotiana sylvestris]
Length=675

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  LNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRH  651
            +  S+ QP KRR+KKS+VWE FTIE +   C RACCKQCK+SFAY  G K+AGTSHLKRH
Sbjct  10   IADSQAQPNKRRRKKSIVWEHFTIETIDADCTRACCKQCKKSFAYISGSKLAGTSHLKRH  69

Query  652  IAKGTC  669
            IA G C
Sbjct  70   IALGIC  75



>ref|XP_010319094.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Solanum lycopersicum]
Length=392

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            SE QP K R+KKS+VWE FTIE +G  C RACCK+CK+SFAY  G K+AGTSHLKRHIA 
Sbjct  13   SEAQPNKFRRKKSIVWEHFTIERIGADCTRACCKKCKKSFAYISGSKLAGTSHLKRHIAL  72

Query  661  GTC  669
            G C
Sbjct  73   GIC  75



>ref|XP_006419173.1| hypothetical protein EUTSA_v10002435mg [Eutrema salsugineum]
 gb|ESQ37609.1| hypothetical protein EUTSA_v10002435mg [Eutrema salsugineum]
Length=657

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  LNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRH  651
            +   E QP KRRKKKS VWE FTI+    GCRRA CK C QSFAYS G KVAGTSHLKRH
Sbjct  13   MRSPETQPIKRRKKKSKVWENFTIKNTEPGCRRAFCKGCNQSFAYSSGTKVAGTSHLKRH  72

Query  652  IAKGTCAA  675
            I KGTC A
Sbjct  73   IDKGTCPA  80



>ref|XP_009147901.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=659

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E+QP KRRKK+S VWE FTI+    GCRRA CK C QSF+YS G KVAGTSHLKRHI KG
Sbjct  17   EIQPIKRRKKQSKVWEHFTIQFTQPGCRRAFCKGCNQSFSYSNGSKVAGTSHLKRHIDKG  76

Query  664  TCAA  675
            TC A
Sbjct  77   TCPA  80



>emb|CDY48867.1| BnaA06g03150D [Brassica napus]
Length=659

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E+QP KRRKK+S VWE FTI+    GCRRA CK C QSF+YS G KVAGTSHLKRHI KG
Sbjct  17   EIQPIKRRKKQSKVWEHFTIQFTQPGCRRAFCKGCNQSFSYSNGSKVAGTSHLKRHIDKG  76

Query  664  TCAA  675
            TC A
Sbjct  77   TCPA  80



>emb|CDO98171.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 2/69 (3%)
 Frame = +1

Query  463  GTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHL  642
            GTP   S+ QP KRR+KKS+VWE FT+E +   C RA CKQCK+SFAY  G K+AGTSHL
Sbjct  9    GTP--NSDAQPNKRRRKKSVVWEHFTVENIDADCTRAFCKQCKKSFAYITGSKLAGTSHL  66

Query  643  KRHIAKGTC  669
            KRHIA G C
Sbjct  67   KRHIALGIC  75



>ref|XP_007215012.1| hypothetical protein PRUPE_ppa002495mg [Prunus persica]
 gb|EMJ16211.1| hypothetical protein PRUPE_ppa002495mg [Prunus persica]
Length=666

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  LNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRH  651
            L  SE Q  +RR+KKS+VWE+FTIE VG G  +A CKQCK+SFAY  G K+AGTSHLKRH
Sbjct  13   LPSSETQTNRRRRKKSIVWEYFTIETVGAGSTKAFCKQCKRSFAYITGSKLAGTSHLKRH  72

Query  652  IAKGTC  669
            IA G C
Sbjct  73   IALGIC  78



>ref|XP_009415017.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009415018.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=669

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  499  KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            +RR+KKS VWE FTIE V  GC RACCK CKQ+FAYS G K+AGTSHLKRHIA G+C
Sbjct  22   RRRRKKSSVWEHFTIEEVSGGCTRACCKLCKQTFAYSSGSKIAGTSHLKRHIALGSC  78



>ref|XP_010691104.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Beta vulgaris subsp. vulgaris]
Length=719

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E+QP KRR+KKS+VWE+FT E V  GC RACCKQC +SFAY  G K +GTSHLKRHI+ G
Sbjct  57   EVQPNKRRRKKSIVWEYFTTETVTPGCIRACCKQCNKSFAYITGKKQSGTSHLKRHISLG  116

Query  664  TC  669
             C
Sbjct  117  IC  118



>ref|XP_010229494.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
Length=378

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEILPDEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMV  525
            + ++ELV   E+    E+   E +L       EM    + TP      +  +RR+KKS+V
Sbjct  32   VHDDELVQADELTQGEELTHGEELLEGH----EMVVAEVTTP------KTARRRRKKSLV  81

Query  526  WEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            WE FTIE    G  RACCK CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  82   WEHFTIEDAPGGATRACCKLCKQTFAYSSGSKIAGTSHLKRHITLGSC  129



>ref|XP_009139828.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=647

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  475  NGSEMQ--PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
            N  EM   P KRRKKKS VWE FTI     GCRRA CK C QSFAYS G KVAGTSHLKR
Sbjct  9    NDVEMSTPPIKRRKKKSKVWEHFTIGVTEPGCRRAFCKGCNQSFAYSSGTKVAGTSHLKR  68

Query  649  HIAKGTCAA  675
            HI KGTC A
Sbjct  69   HIDKGTCPA  77



>emb|CDY60307.1| BnaUnng00680D [Brassica napus]
Length=663

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            E QP KRRKK+S VWE FTI+    GCRRA C  C QSFAYS G KVAGTSHLKRHI KG
Sbjct  17   ETQPIKRRKKQSKVWEHFTIQFTQPGCRRAFCIGCNQSFAYSNGSKVAGTSHLKRHIDKG  76

Query  664  TCAA  675
            TC A
Sbjct  77   TCPA  80



>emb|CDX74476.1| BnaA04g09130D [Brassica napus]
Length=732

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  475  NGSEMQ--PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
            N  EM   P KRRKKKS VWE FTI     GCRRA CK C QSFAYS G KVAGTSHLKR
Sbjct  94   NDVEMSTPPIKRRKKKSKVWEHFTIGVTEPGCRRAFCKGCNQSFAYSSGTKVAGTSHLKR  153

Query  649  HIAKGTCAA  675
            HI KGTC A
Sbjct  154  HIDKGTCPA  162



>emb|CDY37871.1| BnaC04g31350D [Brassica napus]
Length=647

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  475  NGSEMQ--PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKR  648
            N  EM   P KRRKKKS VWE FTI     GCRRA CK C QSFAYS G KVAGTSHLKR
Sbjct  9    NDVEMTTPPIKRRKKKSKVWEHFTIGVTEPGCRRAFCKGCNQSFAYSSGTKVAGTSHLKR  68

Query  649  HIAKGTCAA  675
            HI KGTC A
Sbjct  69   HIDKGTCPA  77



>ref|XP_010521534.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
 ref|XP_010521535.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=1202

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 68/115 (59%), Gaps = 7/115 (6%)
 Frame = +1

Query  346  IDNNELVV----HSEMMADHEILPDEMMLNNEIV---PMEMQENSLGTPLNGSEMQPKKR  504
            +DNN L++     S  M DH  +  E   NN +    P     ++  + L   + QP KR
Sbjct  1    MDNNSLMLIDNDGSFEMDDHAHMDVEATENNAMTVFNPTTPVADADDSALLEPDTQPSKR  60

Query  505  RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            R+KKSMVWE FTIE V  G  +A CK CK+SFAY  G K+AGTSHLKRHIA G C
Sbjct  61   RRKKSMVWEHFTIETVSPGSTKASCKHCKKSFAYITGSKLAGTSHLKRHIALGIC  115



>ref|XP_009392578.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=671

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +1

Query  469  PLNGSEMQPKKRR-KKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLK  645
            P+      P  RR +KKS VWE FTIE V  GC RACCK CKQ+FAYS G K+AGTSHLK
Sbjct  11   PVKTETTPPTSRRGRKKSSVWEHFTIEEVSGGCTRACCKLCKQTFAYSSGSKIAGTSHLK  70

Query  646  RHIAKGTC  669
            RHIA G+C
Sbjct  71   RHIALGSC  78



>gb|KHN37997.1| hypothetical protein glysoja_007039 [Glycine soja]
Length=364

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  LNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRH  651
            ++ SE QP K  +KKSMVW++FT+E VG GC RA CKQCK+SF+Y    K+ GTSHLKRH
Sbjct  39   ISDSETQPNKWMRKKSMVWDYFTVETVGAGCTRAYCKQCKKSFSYITDSKLTGTSHLKRH  98

Query  652  IAKGTC  669
            I+ G C
Sbjct  99   ISLGIC  104



>dbj|BAK01733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=727

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 56/88 (64%), Gaps = 11/88 (13%)
 Frame = +1

Query  406  DEMMLNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQ  585
            DE++  NE+   E     + TP         +RR+KKS+VWE FTIE    G  RACCK 
Sbjct  52   DELLQGNEMAITE-----VATP------PTTRRRRKKSLVWEHFTIEDAAGGATRACCKL  100

Query  586  CKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            CKQ+FAYS G K+AGTSHLKRHI  G+C
Sbjct  101  CKQTFAYSSGSKIAGTSHLKRHITLGSC  128



>ref|XP_007135765.1| hypothetical protein PHAVU_010G156900g [Phaseolus vulgaris]
 gb|ESW07759.1| hypothetical protein PHAVU_010G156900g [Phaseolus vulgaris]
Length=658

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 13/84 (15%)
 Frame = +1

Query  418  LNNEIVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQS  597
            +NN+++P              S  QP KR +KKSMVW++FT+EA+G GC RA C QCK+S
Sbjct  7    VNNDVIPY-------------SGTQPNKRMRKKSMVWDYFTVEALGAGCTRAYCNQCKKS  53

Query  598  FAYSQGCKVAGTSHLKRHIAKGTC  669
            F+Y    K AGTSHLKRHI+ G C
Sbjct  54   FSYITDSKQAGTSHLKRHISLGIC  77



>gb|KHN01319.1| Putative AC transposase, partial [Glycine soja]
Length=647

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  LNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRH  651
            ++ S  QP K+ +KKSMVW++FT+E VG GC RA CKQCK+SF+Y    K++GTSHLKRH
Sbjct  5    ISDSGTQPNKQMRKKSMVWDYFTVETVGAGCTRAYCKQCKKSFSYITDSKLSGTSHLKRH  64

Query  652  IAKGTC  669
            I+ G C
Sbjct  65   ISLGIC  70



>ref|XP_009379900.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=648

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  520  MVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            MVWE FT+E V +GC RACCK CKQ+FAYS G KVAGTSHLKRHIA G+C
Sbjct  1    MVWEHFTVEVVSDGCTRACCKLCKQTFAYSNGSKVAGTSHLKRHIALGSC  50



>ref|XP_010472999.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Camelina sativa]
Length=1176

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            P KRR+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  62   PAKRRRKKSMVWEHFTIETSSPGSTKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGIC  120



>ref|XP_010520572.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=641

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = +1

Query  475  NGSEMQPKKR----RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHL  642
            N   + P+ R    RK+KS VWE FTIE  G GCR ACCK CK+ F+YS G KV GTSHL
Sbjct  10   NDGTVTPETRGGKPRKRKSTVWEHFTIEDAGPGCRMACCKGCKRRFSYSNGFKVLGTSHL  69

Query  643  KRHIAKGTCAA  675
            +RHI  GTC A
Sbjct  70   RRHIYNGTCPA  80



>ref|XP_010472998.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Camelina sativa]
Length=1204

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            P KRR+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  62   PAKRRRKKSMVWEHFTIETSSPGSTKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGIC  120



>ref|XP_010417759.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Camelina sativa]
Length=1203

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            P KRR+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  63   PAKRRRKKSMVWEHFTIETSSPGSTKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGIC  121



>ref|XP_010417758.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Camelina sativa]
Length=1203

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            P KRR+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  63   PAKRRRKKSMVWEHFTIETSSPGSTKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGIC  121



>ref|NP_001056445.1| Os05g0583200 [Oryza sativa Japonica Group]
 sp|Q75HY5.1|RSLE3_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
3; AltName: Full=Transposase-like protein RICESLEEPER 
3 [Oryza sativa Japonica Group]
 gb|AAS16892.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF18359.1| Os05g0583200 [Oryza sativa Japonica Group]
 dbj|BAG95453.1| unnamed protein product [Oryza sativa Japonica Group]
Length=752

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 76/136 (56%), Gaps = 28/136 (21%)
 Frame = +1

Query  346  IDNNELVVHSEMMAD-HEILPD--------------EMMLNNEIVPME--MQENSL----  462
            I  NE+VVH  +M D +E++ +              EM+ NNEI+ +   +Q N +    
Sbjct  24   IHGNEMVVHDSVMIDGNEMVQENVMVHGSGEMVQGSEMVHNNEIIQVNDMIQVNEMVNGD  83

Query  463  ----GTPLNGSEMQ---PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCK  621
                G  L G E+      +RR+KKS+VWE FTIE +  G  RA C  CKQ+FAYS G K
Sbjct  84   KMAHGHELVGVELTTPTASRRRRKKSVVWEHFTIEEMPGGVSRASCNLCKQTFAYSCGSK  143

Query  622  VAGTSHLKRHIAKGTC  669
            ++GTSHLKRHI   +C
Sbjct  144  ISGTSHLKRHITLASC  159



>ref|XP_010497099.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like, 
partial [Camelina sativa]
Length=858

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            P KRR+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  63   PAKRRRKKSMVWEHFTIETSSPGSTKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGIC  121



>gb|EEE64837.1| hypothetical protein OsJ_19694 [Oryza sativa Japonica Group]
Length=879

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 76/136 (56%), Gaps = 28/136 (21%)
 Frame = +1

Query  346  IDNNELVVHSEMMAD-HEILPD--------------EMMLNNEIVPME--MQENSL----  462
            I  NE+VVH  +M D +E++ +              EM+ NNEI+ +   +Q N +    
Sbjct  151  IHGNEMVVHDSVMIDGNEMVQENVMVHGSGEMVQGSEMVHNNEIIQVNDMIQVNEMVNGD  210

Query  463  ----GTPLNGSEMQ---PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCK  621
                G  L G E+      +RR+KKS+VWE FTIE +  G  RA C  CKQ+FAYS G K
Sbjct  211  KMAHGHELVGVELTTPTASRRRRKKSVVWEHFTIEEMPGGVSRASCNLCKQTFAYSCGSK  270

Query  622  VAGTSHLKRHIAKGTC  669
            ++GTSHLKRHI   +C
Sbjct  271  ISGTSHLKRHITLASC  286



>gb|EYU24629.1| hypothetical protein MIMGU_mgv1a023531mg [Erythranthe guttata]
Length=691

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +1

Query  439  MEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGC  618
            + + +N+   P    + +P KRR+KKSMVWE FTIE V   C +A C  CK+SFAY  G 
Sbjct  3    ISINQNAFPDP----DPKPNKRRRKKSMVWEHFTIETVNADCVKANCNLCKKSFAYISGS  58

Query  619  KVAGTSHLKRHIAKGTC  669
            K+AGTSHLKRHI+ G C
Sbjct  59   KLAGTSHLKRHISMGIC  75



>dbj|BAJ96825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = +1

Query  337  ETPIDNNELVVHSEMMADHEILP-DEMMLNNEIVPMEMQEN----SLGTPLNGSEMQP--  495
            E  I  NE+V  SEM+  +E++  ++M+ +N++  +    N    + G  L  +++ P  
Sbjct  64   EMVISGNEMVHGSEMIHGNEMVQVNDMIRSNDMDRVNNMVNGDEMAHGNALVSADLSPPT  123

Query  496  -KKRRKKKSMVWEFFTIEAVGNG--CRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGT  666
              +RRKKKS VWE FTI+ V     CR ACC  CK +FAYS G K+AGTSHLKRHI +G+
Sbjct  124  SSRRRKKKSPVWEHFTIQHVPGDKRCRIACCNLCKGTFAYSSGGKIAGTSHLKRHILQGS  183

Query  667  C  669
            C
Sbjct  184  C  184



>dbj|BAJ88673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = +1

Query  337  ETPIDNNELVVHSEMMADHEILP-DEMMLNNEIVPMEMQEN----SLGTPLNGSEMQP--  495
            E  I  NE+V  SEM+  +E++  ++M+ +N++  +    N    + G  L  +++ P  
Sbjct  48   EMVISGNEMVHGSEMIHGNEMVQVNDMIRSNDMDRVNNMVNGDEMAHGNALVSADLSPPT  107

Query  496  -KKRRKKKSMVWEFFTIEAVGNG--CRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGT  666
              +RRKKKS VWE FTI+ V     CR ACC  CK +FAYS G K+AGTSHLKRHI +G+
Sbjct  108  SSRRRKKKSPVWEHFTIQHVPGDKRCRIACCNLCKGTFAYSSGGKIAGTSHLKRHILQGS  167

Query  667  C  669
            C
Sbjct  168  C  168



>ref|XP_006300389.1| hypothetical protein CARUB_v10019720mg [Capsella rubella]
 gb|EOA33287.1| hypothetical protein CARUB_v10019720mg [Capsella rubella]
Length=984

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  490  QPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            +P KRR+KKSMVWE FTIE    G  +ACCK CK+SFAY  G K+AGTSHLKRHI  G C
Sbjct  41   EPAKRRRKKSMVWEHFTIETCSPGSTKACCKHCKKSFAYITGQKLAGTSHLKRHIQLGIC  100



>ref|XP_006409564.1| hypothetical protein EUTSA_v10022530mg [Eutrema salsugineum]
 gb|ESQ51017.1| hypothetical protein EUTSA_v10022530mg [Eutrema salsugineum]
Length=962

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  490  QPKKR-RKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGT  666
            QP KR R+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G 
Sbjct  56   QPGKRGRRKKSMVWEHFTIETASPGSTKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGI  115

Query  667  C  669
            C
Sbjct  116  C  116



>ref|XP_009138908.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=1013

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  499  KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            +RR+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  58   RRRRKKSMVWEHFTIEPTSPGSSKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGIC  114



>gb|AAD55482.1|AC009322_22 Hypothetical protein [Arabidopsis thaliana]
 gb|AAG52234.1|AC011717_2 hypothetical protein; 281-3511 [Arabidopsis thaliana]
Length=1076

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  493  PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            P KRR+KKS VW  FT+E V  G  +ACC  C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  37   PTKRRRKKSDVWNHFTVETVSPGSAKACCNHCRKSFAYINGQKLAGTSHLKRHIQLGIC  95



>gb|KCW78838.1| hypothetical protein EUGRSUZ_C00272 [Eucalyptus grandis]
Length=84

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSH  639
            E QP K R KKS++WE FTIE V  GCRR CCKQCKQSFAY  G KV  TS 
Sbjct  14   ETQPNKWRNKKSIIWEHFTIEIVSPGCRRVCCKQCKQSFAYGTGSKVTNTSQ  65



>gb|KHN44191.1| Putative AC transposase [Glycine soja]
Length=656

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  478  GSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIA  657
             SE+Q   RR+KKS VWE FT++  G GC RA CK+C++SFAY +  K +GTSHLKRHI 
Sbjct  7    DSEIQQNSRRRKKSTVWEHFTVKMDGPGCARAYCKRCQKSFAYLKDSKQSGTSHLKRHIT  66

Query  658  KGTC  669
             G C
Sbjct  67   LGIC  70



>ref|XP_011081954.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Sesamum indicum]
Length=651

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  520  MVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            MVWE FTIE V   C RACC QCK+SFAY  G K+AGTSHLKRHIA G C
Sbjct  1    MVWEHFTIETVDADCIRACCNQCKKSFAYISGSKLAGTSHLKRHIALGIC  50



>gb|EPS64824.1| hypothetical protein M569_09955 [Genlisea aurea]
Length=692

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            S+ QP KRRKK SMVW+ FT E VG    RA C  CK+SF+Y  G K AGTSHLKRHI  
Sbjct  13   SDAQPSKRRKK-SMVWDHFTTETVGKNDVRATCNGCKKSFSYISGAKQAGTSHLKRHIKL  71

Query  661  GTCAA  675
            G C A
Sbjct  72   GICPA  76



>emb|CDY00623.1| BnaC04g23020D [Brassica napus]
Length=1270

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  490  QPK-KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHI  654
            QP  +RR+KKSMVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI
Sbjct  106  QPGIRRRRKKSMVWEHFTIETTSPGSSKACCKHCRKSFAYITGQKLAGTSHLKRHI  161



>ref|XP_007150768.1| hypothetical protein PHAVU_005G179200g [Phaseolus vulgaris]
 gb|ESW22762.1| hypothetical protein PHAVU_005G179200g [Phaseolus vulgaris]
Length=657

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  LNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRH  651
            ++G E     RR+KKS VWE FT++  G GC RA CK+C++SFAY +  K +GTSHLKRH
Sbjct  4    VSGHETHQNNRRRKKSTVWEHFTVKTDGPGCARAYCKRCQKSFAYLKHSKQSGTSHLKRH  63

Query  652  IAKGTC  669
            IA G C
Sbjct  64   IALGIC  69



>ref|XP_002442948.1| hypothetical protein SORBIDRAFT_08g005330 [Sorghum bicolor]
 gb|EES16786.1| hypothetical protein SORBIDRAFT_08g005330 [Sorghum bicolor]
Length=762

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +1

Query  499  KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            KRR+K SMVWE FT E    GC RACCK C   FAYS G K++GTSHLKRHI +G C
Sbjct  118  KRRRKTSMVWEHFTTED-SEGCTRACCKHCNGIFAYSSGSKMSGTSHLKRHITQGHC  173



>ref|XP_010230399.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
 ref|XP_010230403.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
 ref|XP_010230404.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 52/114 (46%), Positives = 74/114 (65%), Gaps = 9/114 (8%)
 Frame = +1

Query  346  IDNNELVVHSEMMADHEIL-PDEMMLNNEIVPMEMQENSLGTPLNGSEMQP---KKRRKK  513
            +D NE+V  ++M+  H+++  D+M+  N++V  +  E   G  L  SE+ P    +RR+K
Sbjct  54   MDGNEMVHGNDMIQVHDLIHGDDMVQVNDMVNGD--EMVHGNELV-SEVTPPALSRRRRK  110

Query  514  KSMVWEFFTIEAV--GNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            +S+VWE FTIE V     C+RACC  C  +FAYS G K+AGTSHLKRHI  G+C
Sbjct  111  RSLVWEHFTIEPVPGEKACQRACCNLCNATFAYSSGTKIAGTSHLKRHITLGSC  164



>gb|KCW78851.1| hypothetical protein EUGRSUZ_C00290 [Eucalyptus grandis]
Length=102

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTS  636
            E QP K R KKS++WE FTIE V  GCRR CCKQCKQSFA+  G KV   S
Sbjct  14   ETQPNKWRNKKSIIWEHFTIEIVSPGCRRVCCKQCKQSFAHGTGSKVTNAS  64



>emb|CDY36545.1| BnaA06g09980D [Brassica napus]
Length=766

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            S+    KRRK+KS+VW+ FT EA  +   +A CK C +S+AY  G K +GTSHLKRHI  
Sbjct  89   SQQPAAKRRKRKSLVWDHFTTEATNSDTTKALCKHCNKSYAYINGAKASGTSHLKRHIEL  148

Query  661  GTCA  672
            G C+
Sbjct  149  GICS  152



>ref|XP_009148917.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=724

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  481  SEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            S+    KRRK+KS+VW+ FT EA  +    A CK C +S+AY  G K +GTSHLKRHI  
Sbjct  13   SQQPAAKRRKRKSLVWDHFTTEATNSDTTTALCKHCNKSYAYINGAKASGTSHLKRHIEL  72

Query  661  GTCA  672
            G C+
Sbjct  73   GICS  76



>gb|KCW78871.1| hypothetical protein EUGRSUZ_C00312 [Eucalyptus grandis]
Length=136

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSH  639
            E QP K R KKS++WE FTIE    GCRR CCKQCKQSFA   G KV  TS 
Sbjct  49   ETQPNKWRNKKSIIWEHFTIEIASPGCRRVCCKQCKQSFACGTGSKVTNTSQ  100



>gb|KCW79083.1| hypothetical protein EUGRSUZ_C00524 [Eucalyptus grandis]
Length=70

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSH  639
            E QP KRR KKS++WE FTIE +  G  RACCKQCKQSFA   G KV  TS 
Sbjct  14   ETQPDKRRNKKSIIWEHFTIEIMSPGRIRACCKQCKQSFANGTGSKVISTSQ  65



>gb|KCW78865.1| hypothetical protein EUGRSUZ_C00306 [Eucalyptus grandis]
Length=98

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSH  639
            E +P K R +KS++WE FTIE V  GCRR C KQCKQSFAY  G KV  TS 
Sbjct  14   ETEPSKWRNEKSIIWEHFTIEIVSPGCRRVCRKQCKQSFAYGTGSKVTNTSQ  65



>emb|CDX83987.1| BnaC08g16580D [Brassica napus]
Length=760

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query  442  EMQENSLGTPLNGSEMQP-KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGC  618
            E+ +N +   +  S+ QP K+RRK+KSMVW+ FT E   +G  +A CK C +S+AY  G 
Sbjct  59   ELVDNKVNVEIESSDTQPIKRRRKRKSMVWDHFTTETTTSGTTKAFCKHCNKSYAYMSGG  118

Query  619  KVAGTSHLKRHIAKGTC  669
            K +GTSHLKRHI  G C
Sbjct  119  KASGTSHLKRHIELGIC  135



>ref|XP_006416924.1| hypothetical protein EUTSA_v10009614mg, partial [Eutrema salsugineum]
 gb|ESQ35277.1| hypothetical protein EUTSA_v10009614mg, partial [Eutrema salsugineum]
Length=745

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  451  ENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAG  630
            +N++   ++ S+ QP   RK+KSMVW  F  +    G  +A CK C +S+AY  G K +G
Sbjct  10   DNNVSLEMDSSDTQPPNGRKRKSMVWNHFITKTDSPGTTKAFCKHCNKSYAYITGTKASG  69

Query  631  TSHLKRHIAKGTC  669
            TSHLKRHI  G C
Sbjct  70   TSHLKRHIELGIC  82



>sp|Q0JMB2.3|RSLE4_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
4; AltName: Full=Transposase-like protein RICESLEEPER 
4 [Oryza sativa Japonica Group]
 gb|EAZ12126.1| hypothetical protein OsJ_02008 [Oryza sativa Japonica Group]
Length=684

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 12/94 (13%)
 Frame = +1

Query  406  DEMMLNNEIVPMEMQENSLGTPLNGSEMQ---------PKKRRKKKSMVWEFFTIEAVGN  558
            +EMM  +    M    N +   LNG+E+            + +K+KS +WE FT+  V +
Sbjct  14   NEMMHGHGYTTMVHGNNEI---LNGNELAVHAEVIPSASTRGQKRKSAIWEHFTLVDVSD  70

Query  559  GCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            GC+RA C  C QS AYS G K +GTSHL RHIA+
Sbjct  71   GCKRASCIHCNQSLAYSSGSKNSGTSHLTRHIAE  104



>ref|NP_001043202.2| Os01g0518400 [Oryza sativa Japonica Group]
 dbj|BAF05116.2| Os01g0518400, partial [Oryza sativa Japonica Group]
Length=688

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 12/94 (13%)
 Frame = +1

Query  406  DEMMLNNEIVPMEMQENSLGTPLNGSEMQ---------PKKRRKKKSMVWEFFTIEAVGN  558
            +EMM  +    M    N +   LNG+E+            + +K+KS +WE FT+  V +
Sbjct  18   NEMMHGHGYTTMVHGNNEI---LNGNELAVHAEVIPSASTRGQKRKSAIWEHFTLVDVSD  74

Query  559  GCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAK  660
            GC+RA C  C QS AYS G K +GTSHL RHIA+
Sbjct  75   GCKRASCIHCNQSLAYSSGSKNSGTSHLTRHIAE  108



>emb|CDX89026.1| BnaA04g01600D [Brassica napus]
Length=628

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  520  MVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            MVWE FTIE    G  +ACCK C++SFAY  G K+AGTSHLKRHI  G C
Sbjct  1    MVWEHFTIEPTSPGSSKACCKHCRKSFAYITGQKLAGTSHLKRHIQLGIC  50



>ref|XP_010497000.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=758

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +1

Query  436  PMEMQENSLGTPLNG-SEMQP--KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAY  606
            P EM +  +   ++  ++ QP  K+RR+KKS VW+ F  E V    ++A C  C +SFAY
Sbjct  6    PTEMVDVDVALEMDSDTQTQPIVKRRRQKKSEVWDHFITEVVSPDTKKARCMHCNKSFAY  65

Query  607  SQGCKVAGTSHLKRHIAKGTCA  672
              G K +GTSHLKRHI  G CA
Sbjct  66   INGTKASGTSHLKRHIDLGICA  87



>emb|CDY39631.1| BnaC05g11600D [Brassica napus]
Length=688

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = +1

Query  466  TPLNGSEMQPK-KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHL  642
            T ++    QP  +RRK+KS+VW+ FT EA  +   +A CK C +S+AY  G K +GTSHL
Sbjct  52   TSVSSDSQQPAARRRKRKSLVWDHFTTEATSSDTTKALCKHCNKSYAYINGAKASGTSHL  111

Query  643  KRHI  654
            KRHI
Sbjct  112  KRHI  115



>ref|XP_004968803.1| PREDICTED: uncharacterized protein LOC101784870 isoform X1 [Setaria 
italica]
 ref|XP_004968804.1| PREDICTED: uncharacterized protein LOC101784870 isoform X2 [Setaria 
italica]
Length=784

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +1

Query  499  KRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            +RR+K S++WE FT E   +GC RACC  CK+ FA S   K AGTSHLKRHI  G+C
Sbjct  607  RRRRKNSIIWEHFTTETDSDGCTRACCNYCKRIFACS---KTAGTSHLKRHITLGSC  660



>ref|XP_009110492.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=709

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  442  EMQENSLGTPLNGSEMQP-KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGC  618
            E+ +N +   +  S+ QP K+RRK+KSMVW+ FT E   +G  +A CK C +S+AY  G 
Sbjct  8    ELVDNKVNLEIESSDTQPIKRRRKRKSMVWDHFTTETTTSGTTKAFCKHCNKSYAYMSGV  67

Query  619  KVAGTSHLKRHIAKGTC  669
            K + TSHLKRHI  G C
Sbjct  68   KASYTSHLKRHIELGIC  84



>gb|EEC70768.1| hypothetical protein OsI_02196 [Oryza sativa Indica Group]
Length=392

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 9/72 (13%)
 Frame = +1

Query  472  LNGSEMQ---------PKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKV  624
            LNG+E+            + +K+KS +WE FT+  V +GC+RA C  C QS AYS G K 
Sbjct  33   LNGNELAVHAEVIPSASTRGQKRKSAIWEHFTLVDVSDGCKRASCIHCNQSLAYSSGSKN  92

Query  625  AGTSHLKRHIAK  660
            +GTSHL RHIA+
Sbjct  93   SGTSHLTRHIAE  104



>gb|KGN52935.1| hypothetical protein Csa_4G006420 [Cucumis sativus]
Length=692

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  523  VWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKGTC  669
            VW++FT++   +GC +A C QC ++FAY  G K+AGTSHLKRHIA G C
Sbjct  45   VWDYFTVQTAEDGCIKAYCNQCNKAFAYINGSKLAGTSHLKRHIALGIC  93



>ref|XP_006851229.1| hypothetical protein AMTR_s00180p00017340 [Amborella trichopoda]
 gb|ERN12810.1| hypothetical protein AMTR_s00180p00017340 [Amborella trichopoda]
Length=841

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = +1

Query  457  SLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTS  636
            +LGT  + S     KRRK  S+VWE FT+E    GCR+A CK C  +FA+  G K  GTS
Sbjct  9    TLGTQQSSSS----KRRKTTSIVWEHFTMETFIGGCRKARCKYCLHTFAFGNGAKQLGTS  64

Query  637  HLKRHIAKGTC  669
            HLKRH+  G C
Sbjct  65   HLKRHL--GIC  73



>ref|XP_010462713.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=1021

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +1

Query  490  QP--KKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            QP  K+RR+KKS VW+ F  E V    ++A C  C +SFAY  G K +GTSHLKRHI  G
Sbjct  29   QPIGKRRRQKKSEVWDHFITEVVSPDTKKARCMHCNKSFAYINGTKASGTSHLKRHIDLG  88

Query  664  TCA  672
             CA
Sbjct  89   ICA  91



>ref|XP_006305940.1| hypothetical protein CARUB_v10011179mg [Capsella rubella]
 gb|EOA38838.1| hypothetical protein CARUB_v10011179mg [Capsella rubella]
Length=905

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +1

Query  484  EMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCKQSFAYSQGCKVAGTSHLKRHIAKG  663
            + Q   RRKKKS VW  F  E V    ++A C  C +SFA+    K +GTSHLKRHI  G
Sbjct  23   DTQTNTRRKKKSDVWNHFVTEVVSPDTKKARCMHCNKSFAFMTATKASGTSHLKRHIELG  82

Query  664  TC  669
             C
Sbjct  83   IC  84



>ref|XP_010108145.1| hypothetical protein L484_023234 [Morus notabilis]
 gb|EXC17877.1| hypothetical protein L484_023234 [Morus notabilis]
Length=74

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 6/54 (11%)
 Frame = +1

Query  430  IVPMEMQENSLGTPLNGSEMQPKKRRKKKSMVWEFFTIEAVGNGCRRACCKQCK  591
            IVP+E +E ++       E+QP KRR+KKS+VW++FT+E V   C +A CKQCK
Sbjct  6    IVPIENREVTIA------EIQPNKRRRKKSVVWQYFTVEKVSPECVKAYCKQCK  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420