BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048H13

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACF17656.1|  putative glutamine synthase 2                           389   7e-131   Capsicum annuum
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     384   6e-129   Nicotiana tomentosiformis
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     382   2e-128   Nicotiana sylvestris
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                381   3e-128   Erythranthe guttata [common monkey flower]
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           380   1e-127   Solanum tuberosum [potatoes]
ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    380   1e-127   Sesamum indicum [beniseed]
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     375   1e-125   
ref|XP_007034566.1|  Glutamine synthetase 2                             376   2e-124   
gb|KJB28233.1|  hypothetical protein B456_005G035800                    367   2e-122   Gossypium raimondii
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    367   2e-122   Populus euphratica
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  367   2e-122   Morus notabilis
ref|XP_002314425.1|  glutamine synthetase family protein                367   2e-122   Populus trichocarpa [western balsam poplar]
dbj|BAF62340.1|  glutamine synthetase                                   367   2e-122   Avicennia marina
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    366   3e-122   Sesamum indicum [beniseed]
emb|CDO98975.1|  unnamed protein product                                366   3e-122   Coffea canephora [robusta coffee]
emb|CAA47373.2|  glutamate--ammonia ligase                              366   5e-122   Nicotiana sylvestris
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        365   8e-122   Gossypium arboreum [tree cotton]
ref|XP_006380048.1|  hypothetical protein POPTR_0008s20460g             360   2e-121   
gb|KDO74876.1|  hypothetical protein CISIN_1g013478mg                   362   3e-121   Citrus sinensis [apfelsine]
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             363   4e-121   Citrus clementina [clementine]
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   363   4e-121   Citrus sinensis [apfelsine]
ref|XP_002312733.1|  glutamine synthetase family protein                363   5e-121   
gb|KJB37729.1|  hypothetical protein B456_006G218100                    361   4e-120   Gossypium raimondii
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    361   4e-120   Nelumbo nucifera [Indian lotus]
gb|ADK27329.1|  plastid glutamine synthetase                            359   1e-119   Vigna radiata [mung bean]
ref|XP_002516801.1|  glutamine synthetase plant, putative               358   7e-119   Ricinus communis
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    357   1e-118   Daucus carota [carrots]
ref|NP_001237784.1|  glutamine synthetase precursor                     357   2e-118   
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    356   2e-118   Glycine max [soybeans]
gb|ACU24520.1|  unknown                                                 356   3e-118   Glycine max [soybeans]
pir||S22527  glutamate-ammonia ligase (EC 6.3.1.2) - tobacco            356   4e-118
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    356   4e-118   Prunus mume [ume]
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    356   4e-118   Populus euphratica
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                355   7e-118   Juglans nigra
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    354   1e-117   Glycine max [soybeans]
gb|ACU18743.1|  unknown                                                 354   2e-117   Glycine max [soybeans]
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             353   3e-117   Prunus persica
gb|AAF17703.1|AF031082_1  glutamine synthetase                          353   4e-117   Canavalia lineata
ref|XP_011462784.1|  PREDICTED: glutamine synthetase leaf isozyme...    353   4e-117   Fragaria vesca subsp. vesca
gb|KDP40083.1|  hypothetical protein JCGZ_02081                         353   6e-117   Jatropha curcas
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    352   7e-117   Pisum sativum [garden pea]
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             352   1e-116   Phaseolus vulgaris [French bean]
prf||1601519A  Gln synthetase                                           352   2e-116
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   352   2e-116   Citrus sinensis [apfelsine]
gb|AJD14836.1|  plastid glutamine synthetase                            351   2e-116   Boehmeria nivea [Chinese silk-plant]
gb|KCW84320.1|  hypothetical protein EUGRSUZ_B01163                     347   4e-116   Eucalyptus grandis [rose gum]
gb|AJI44225.1|  plastid glutamine synthetase                            350   5e-116   Boehmeria nivea [Chinese silk-plant]
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   351   5e-116   Citrus sinensis [apfelsine]
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    350   5e-116   Eucalyptus grandis [rose gum]
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    350   5e-116   Eucalyptus grandis [rose gum]
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    350   6e-116   Eucalyptus grandis [rose gum]
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    349   1e-115   Cicer arietinum [garbanzo]
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    349   2e-115   Cucumis sativus [cucumbers]
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    349   2e-115   Cucumis melo [Oriental melon]
gb|AAN84538.1|  putative plastidic glutamine synthetase                 348   5e-115   Spiraea nipponica
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    348   7e-115   Pyrus x bretschneideri [bai li]
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    347   7e-115   Pyrus x bretschneideri [bai li]
ref|XP_008361978.1|  PREDICTED: glutamine synthetase leaf isozyme...    346   1e-114   
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    346   2e-114   Malus domestica [apple tree]
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    345   6e-114   
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    345   9e-114   Cucumis melo [Oriental melon]
gb|AAN84537.1|  putative plastidic glutamine synthetase                 344   2e-113   Crataegus crus-galli
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    343   2e-113   Medicago sativa [alfalfa]
gb|ACJ84875.1|  unknown                                                 340   2e-113   Medicago truncatula
gb|KEH36742.1|  glutamine synthetase domain protein                     341   5e-113   Medicago truncatula
gb|AAO37651.1|  glutamine synthetase                                    342   8e-113   Medicago truncatula
gb|AAN84563.1|  glutamine synthetase                                    342   9e-113   Lotus japonicus
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         342   1e-112   Lotus japonicus
gb|AAL67439.1|  glutamine synthetase precursor                          342   1e-112   Lotus japonicus
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    342   1e-112   Vitis vinifera
gb|AFH88076.1|  chloroplast glutamine synthetase protein                341   3e-112   Sesuvium portulacastrum [sea-purslane]
gb|AGV54414.1|  glutamine synthetase                                    340   7e-112   Phaseolus vulgaris [French bean]
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         338   2e-111   Lotus japonicus
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        338   3e-111   Medicago truncatula
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        338   4e-111   Glycine soja [wild soybean]
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    337   1e-110   Vitis vinifera
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    336   3e-110   Mesembryanthemum crystallinum
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    331   2e-108   Tarenaya hassleriana [spider flower]
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    330   5e-108   Tarenaya hassleriana [spider flower]
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    328   2e-107   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN61808.1|  hypothetical protein VITISV_014295                     327   6e-107   Vitis vinifera
gb|ABL89188.2|  plastid glutamine synthetase 2                          326   2e-106   Spinacia oleracea
ref|XP_003594092.1|  Glutamine synthetase                               344   3e-105   
ref|XP_006850815.1|  hypothetical protein AMTR_s00025p00120730          320   3e-104   Amborella trichopoda
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    319   1e-103   
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    318   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    317   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             316   2e-102   
ref|XP_008779349.1|  PREDICTED: glutamine synthetase leaf isozyme...    309   2e-102   
ref|NP_198413.1|  glutamine synthetase 2                                315   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004174085.1|  PREDICTED: glutamine synthetase, chloroplast...    305   1e-101   
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    311   9e-101   Elaeis guineensis
dbj|BAH56878.1|  AT5G35630                                              305   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     310   2e-100   Brassica rapa
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    310   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             309   6e-100   Capsella rubella
gb|ABY87178.1|  chloroplast glutamine synthetase                        309   8e-100   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    309   8e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             307   3e-99    Eutrema salsugineum [saltwater cress]
emb|CDY33684.1|  BnaC04g29670D                                          309   3e-99    Brassica napus [oilseed rape]
emb|CAB72423.1|  glutamine synthetase                                   307   4e-99    Brassica napus [oilseed rape]
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    306   6e-99    
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     305   3e-98    Brachypodium distachyon [annual false brome]
emb|CDY49365.1|  BnaA08g29950D                                          303   5e-98    Brassica napus [oilseed rape]
emb|CAA73062.1|  plastidic glutamine synthetase precursor               304   6e-98    Brassica napus [oilseed rape]
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    304   7e-98    Brassica rapa
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            298   2e-95    Secale cereale
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               297   3e-95    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    297   3e-95    Setaria italica
gb|ACT22500.1|  plastid glutamine synthetase 2                          297   3e-95    Triticum aestivum [Canadian hard winter wheat]
gb|ACT22496.1|  plastid glutamine synthetase 2                          296   1e-94    Triticum aestivum [Canadian hard winter wheat]
emb|CDX84116.1|  BnaC08g07930D                                          290   1e-94    
dbj|BAD12057.1|  plastidic glutamine synthetase                         294   6e-94    Phragmites australis
dbj|BAJ91545.1|  predicted protein                                      294   6e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAG88835.1|  unnamed protein product                                290   1e-93    Oryza sativa Japonica Group [Japonica rice]
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               293   1e-93    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001241708.1|  uncharacterized protein LOC100856886               291   2e-93    
gb|AAL87183.1|AF480497_11  putative precursor chloroplastic gluta...    293   2e-93    Oryza sativa Japonica Group [Japonica rice]
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               292   2e-93    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001054133.1|  Os04g0659100                                       292   3e-93    
dbj|BAJ95492.1|  predicted protein                                      292   4e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA34131.1|  unnamed protein product                                291   7e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    290   1e-92    
gb|EPS57543.1|  glutamine synthetase                                    283   2e-92    Genlisea aurea
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      290   2e-92    
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    291   7e-92    Zea mays [maize]
dbj|BAD12059.1|  plastidic glutamine synthetase                         288   7e-92    Phragmites australis
emb|CAA29057.1|  gluthamine synthetase                                  284   9e-91    Pisum sativum [garden pea]
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        288   2e-90    Triticum urartu
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    285   2e-90    Hordeum vulgare [barley]
prf||1804333B  Gln synthetase                                           285   2e-90 
ref|XP_006593065.1|  PREDICTED: glutamine synthetase leaf isozyme...    275   1e-89    Glycine max [soybeans]
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    281   3e-89    
gb|ACG35376.1|  glutamine synthetase                                    281   4e-89    Zea mays [maize]
prf||1804333C  Gln synthetase                                           278   7e-88 
gb|ACG31728.1|  hypothetical protein                                    276   8e-88    Zea mays [maize]
prf||1804333D  Gln synthetase                                           271   4e-85 
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1            269   3e-84    Lemna minor
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2            268   3e-84    Lemna minor
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg                256   5e-80    Erythranthe guttata [common monkey flower]
gb|AAT46062.1|  glutamine synthetase GS2                                248   1e-79    Apium graveolens Dulce Group [celery]
ref|XP_010492570.1|  PREDICTED: glutamine synthetase cytosolic is...    251   3e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010420355.1|  PREDICTED: glutamine synthetase cytosolic is...    253   5e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...    253   9e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...    252   1e-78    Camelina sativa [gold-of-pleasure]
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...    252   2e-78    Populus euphratica
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2              251   2e-78    Lemna minor
ref|XP_010419001.1|  PREDICTED: glutamine synthetase cytosolic is...    245   2e-78    
dbj|BAA04995.1|  glutamine synthetase                                   251   3e-78    Raphanus sativus
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...    251   3e-78    Camelina sativa [gold-of-pleasure]
gb|ACF42116.1|  cytosolic glutamine synthetase                          251   3e-78    Brassica oleracea var. italica [asparagus broccoli]
gb|KDP25795.1|  hypothetical protein JCGZ_22517                         251   4e-78    Jatropha curcas
ref|XP_010435596.1|  PREDICTED: glutamine synthetase cytosolic is...    248   4e-78    Camelina sativa [gold-of-pleasure]
emb|CAA73063.1|  cytosolic glutamine synthetase                         251   5e-78    Brassica napus [oilseed rape]
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...    251   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK93921.1|  unknown                                                 246   6e-78    Populus trichocarpa [western balsam poplar]
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like        250   7e-78    Cucumis sativus [cucumbers]
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...    250   8e-78    Camelina sativa [gold-of-pleasure]
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg             250   1e-77    
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...    249   1e-77    Camelina sativa [gold-of-pleasure]
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg             249   1e-77    Eutrema salsugineum [saltwater cress]
gb|ACN36710.1|  unknown                                                 244   1e-77    Zea mays [maize]
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...    249   2e-77    Pyrus x bretschneideri [bai li]
ref|XP_010470494.1|  PREDICTED: glutamine synthetase cytosolic is...    246   2e-77    Camelina sativa [gold-of-pleasure]
emb|CAA73064.1|  cytosolic glutamine synthetase                         249   2e-77    Brassica napus [oilseed rape]
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme                249   2e-77    Morus notabilis
ref|XP_006372556.1|  glutamate-ammonia ligase family protein            249   2e-77    Populus trichocarpa [western balsam poplar]
gb|ACD13217.1|  glutamine synthetase                                    249   2e-77    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010450519.1|  PREDICTED: glutamine synthetase cytosolic is...    246   2e-77    Camelina sativa [gold-of-pleasure]
emb|CAA54151.1|  glutamine                                              249   2e-77    Brassica napus [oilseed rape]
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1              249   3e-77    Lemna minor
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...    248   3e-77    Camelina sativa [gold-of-pleasure]
gb|AFK46766.1|  unknown                                                 244   3e-77    Medicago truncatula
emb|CDY01727.1|  BnaC04g30250D                                          248   4e-77    
ref|XP_002318305.1|  glutamine synthetase family protein                248   4e-77    
gb|AAB61597.1|  glutamine synthetase                                    248   5e-77    Hevea brasiliensis [jebe]
emb|CDY49656.1|  BnaC09g41340D                                          248   5e-77    Brassica napus [oilseed rape]
ref|XP_010415164.1|  PREDICTED: glutamine synthetase cytosolic is...    245   6e-77    Camelina sativa [gold-of-pleasure]
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg             248   6e-77    Capsella rubella
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg             248   6e-77    Prunus persica
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...    248   6e-77    Camelina sativa [gold-of-pleasure]
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...    248   6e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009127475.1|  PREDICTED: glutamine synthetase cytosolic is...    245   7e-77    
emb|CAA58118.1|  glutamate--ammonia ligase                              248   8e-77    Brassica napus [oilseed rape]
gb|ACU15915.1|  unknown                                                 243   8e-77    Glycine max [soybeans]
gb|AIK03054.1|  glutamine synthetase                                    247   9e-77    Eichhornia crassipes
ref|XP_006590378.1|  PREDICTED: glutamine synthetase cytosolic is...    244   9e-77    Glycine max [soybeans]
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1        247   9e-77    Glycine max [soybeans]
gb|AFW90613.1|  glutamine synthetase GS1                                244   9e-77    Solanum tuberosum [potatoes]
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450          247   9e-77    Sorghum bicolor [broomcorn]
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...    247   9e-77    Zea mays [maize]
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...    247   9e-77    Camelina sativa [gold-of-pleasure]
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg             247   9e-77    Capsella rubella
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...    247   1e-76    Medicago sativa [alfalfa]
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...    247   1e-76    
gb|AAW21274.1|  glutamine synthetase                                    247   1e-76    Saccharum officinarum [noble cane]
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                    247   1e-76    Arabis alpina [alpine rockcress]
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1         247   1e-76    Nicotiana sylvestris
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...    247   1e-76    Camelina sativa [gold-of-pleasure]
tpg|DAA44141.1|  TPA: glutamine synthetase6                             247   1e-76    
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...    247   2e-76    Brassica rapa
ref|XP_002873784.1|  GLN1_4                                             247   2e-76    
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2         246   2e-76    Nicotiana sylvestris
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme     246   2e-76    Elaeis guineensis
ref|XP_003600702.1|  Glutamine synthetase                               246   2e-76    Medicago truncatula
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...    246   2e-76    Brassica rapa
ref|NP_001105297.1|  glutamine synthetase root isozyme 5                246   2e-76    
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...    246   2e-76    Phoenix dactylifera
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozyme     246   2e-76    Fragaria vesca subsp. vesca
dbj|BAA04996.1|  glutamine synthetase                                   246   3e-76    Raphanus sativus
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...    246   3e-76    
gb|AFN42876.1|  glutamine synthetase                                    246   3e-76    Camellia sinensis [black tea]
ref|XP_002888488.1|  ATGSR2                                             246   4e-76    
ref|XP_009631593.1|  PREDICTED: glutamine synthetase isoform X2         243   4e-76    Nicotiana tomentosiformis
gb|AAP33167.1|  cytosolic glutamine synthetase                          246   4e-76    Securigera parviflora
ref|NP_001105538.1|  glutamine synthetase root isozyme 1                246   4e-76    Zea mays [maize]
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...    246   4e-76    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like               246   4e-76    Nicotiana sylvestris
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg                246   5e-76    Erythranthe guttata [common monkey flower]
ref|NP_198576.1|  glutamine synthetase 1;1                              245   5e-76    Arabidopsis thaliana [mouse-ear cress]
emb|CAA71317.1|  glutamine synthetase                                   245   5e-76    Medicago truncatula
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme     245   5e-76    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB10478.1|  hypothetical protein B456_001G203300                    242   6e-76    Gossypium raimondii
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme             245   6e-76    Cucumis melo [Oriental melon]
gb|KJB10479.1|  hypothetical protein B456_001G203300                    243   7e-76    Gossypium raimondii
dbj|BAH56851.1|  AT1G66200                                              242   7e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...    245   8e-76    
ref|XP_002870545.1|  ATGSR1                                             245   8e-76    Arabidopsis lyrata subsp. lyrata
ref|NP_001031240.1|  glutamine synthetase                               242   8e-76    Arabidopsis thaliana [mouse-ear cress]
emb|CCO25538.1|  glutamine synthetase                                   245   8e-76    Pinus pinaster [cluster pine]
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...    245   8e-76    Tarenaya hassleriana [spider flower]
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...    245   8e-76    Populus euphratica
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...    245   8e-76    Fragaria vesca subsp. vesca
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...    245   8e-76    Cucumis melo [Oriental melon]
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like               245   8e-76    Nicotiana tomentosiformis
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1         245   9e-76    Nicotiana tomentosiformis
emb|CDX69442.1|  BnaA10g17910D                                          244   1e-75    
gb|ABK94916.1|  unknown                                                 244   1e-75    Populus trichocarpa [western balsam poplar]
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                    244   1e-75    Arabis alpina [alpine rockcress]
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...    244   1e-75    Nelumbo nucifera [Indian lotus]
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1                244   1e-75    Gossypium arboreum [tree cotton]
ref|NP_176794.1|  glutamine synthetase                                  244   1e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ABW89461.1|  glutamine synthetase                                    244   2e-75    Gossypium hirsutum [American cotton]
ref|XP_004162638.1|  PREDICTED: glutamine synthetase nodule isozy...    244   2e-75    
gb|ABW89463.1|  glutamine synthetase                                    244   2e-75    Gossypium raimondii
gb|AAK49029.1|  cytosolic glutamine synthetase                          244   2e-75    Populus tremula x Populus alba [gray poplar]
dbj|BAD99525.1|  glutamine synthetase                                   244   2e-75    Camellia sinensis [black tea]
gb|ABW89460.1|  glutamine synthetase                                    244   2e-75    Gossypium herbaceum [Arabian cotton]
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...    244   2e-75    Lotus japonicus
gb|AAM63710.1|  glutamine synthetase, putative                          244   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ABW89464.1|  glutamine synthetase                                    244   2e-75    Gossypium hirsutum [American cotton]
emb|CDO98315.1|  unnamed protein product                                244   2e-75    Coffea canephora [robusta coffee]
gb|KGN51032.1|  Glutamine synthetase                                    244   2e-75    Cucumis sativus [cucumbers]
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...    244   2e-75    Phaseolus vulgaris [French bean]
gb|ABW89462.1|  glutamine synthetase                                    244   2e-75    Gossypium hirsutum [American cotton]
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme     244   2e-75    Populus euphratica
dbj|BAE98486.1|  glutamine synthetase like protein                      244   2e-75    Arabidopsis thaliana [mouse-ear cress]
emb|CAA63963.1|  glutamate synthetase                                   244   2e-75    Lotus japonicus
gb|AAR86718.1|  glutamine synthetase GS56                               244   2e-75    Nicotiana attenuata
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...    244   2e-75    Zea mays [maize]
ref|NP_001105296.1|  glutamine synthetase root isozyme 3                244   2e-75    Zea mays [maize]
ref|XP_006374208.1|  glutamine synthetase family protein                243   2e-75    
gb|AJD14835.1|  glutamine synthetase                                    244   2e-75    Boehmeria nivea [Chinese silk-plant]
gb|ACA50923.1|  glutamine synthetase                                    244   2e-75    Zea mays [maize]
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg             244   2e-75    Eutrema salsugineum [saltwater cress]
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...    244   2e-75    Elaeis guineensis
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...    244   3e-75    Pyrus x bretschneideri [bai li]
gb|ABK95973.1|  unknown                                                 243   3e-75    Populus trichocarpa [western balsam poplar]
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...    243   3e-75    Vigna aconitifolia [moth-bean]
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1           243   3e-75    Vitis vinifera
ref|XP_007036934.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    240   3e-75    
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2           243   3e-75    Vitis vinifera
emb|CAN68162.1|  hypothetical protein VITISV_015673                     243   3e-75    Vitis vinifera
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...    243   4e-75    Populus euphratica
ref|XP_004140309.1|  PREDICTED: glutamine synthetase nodule isozy...    243   4e-75    
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...    243   4e-75    Zea mays [maize]
emb|CAA73366.1|  glutamine synthetase                                   243   4e-75    Lotus japonicus
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...    243   4e-75    Brassica rapa
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...    243   4e-75    Setaria italica
gb|AAR29057.1|  glutamine synthetase 1                                  243   5e-75    
ref|NP_568335.1|  glutamine synthetase 1;4                              243   5e-75    
ref|NP_001048045.1|  Os02g0735200                                       243   5e-75    
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...    243   5e-75    
gb|ACG47508.1|  glutamine synthetase root isozyme 5                     243   6e-75    
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...    243   6e-75    
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...    243   7e-75    
gb|AAW21273.1|  glutamine synthetase                                    243   7e-75    
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...    243   7e-75    
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                    243   7e-75    
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...    242   8e-75    
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...    242   8e-75    
ref|XP_002305885.1|  glutamate-ammonia ligase family protein            242   9e-75    
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g             242   9e-75    
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg             242   1e-74    
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...    242   1e-74    
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    242   1e-74    
emb|CDY38104.1|  BnaC02g06690D                                          242   1e-74    
gb|AGC24239.1|  glutamine synthetase 1                                  242   1e-74    
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    242   1e-74    
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme     242   1e-74    
gb|KFK39112.1|  hypothetical protein AALP_AA3G202500                    241   1e-74    
gb|AID48673.1|  theanine synthetase                                     241   2e-74    
gb|KCW48620.1|  hypothetical protein EUGRSUZ_K02283                     238   2e-74    
ref|NP_001105444.1|  glutamine synthetase root isozyme 4                241   2e-74    
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...    241   2e-74    
gb|KCW48621.1|  hypothetical protein EUGRSUZ_K02283                     238   2e-74    
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...    241   2e-74    
gb|ACB06727.1|  glutamine synthetase                                    241   2e-74    
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g             241   2e-74    
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...    241   2e-74    
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...    241   2e-74    
emb|CBI33470.3|  unnamed protein product                                241   2e-74    
ref|XP_006406687.1|  hypothetical protein EUTSA_v10021026mg             241   3e-74    
gb|AGZ15411.1|  glutamine synthetase PR-2                               241   3e-74    
gb|KCW69393.1|  hypothetical protein EUGRSUZ_F02872                     238   3e-74    
ref|XP_002306385.1|  glutamine synthetase family protein                241   3e-74    
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g             241   3e-74    
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2               241   3e-74    
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...    241   3e-74    
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...    241   3e-74    
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...    241   3e-74    
ref|NP_001049424.1|  Os03g0223400                                       241   3e-74    
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...    241   3e-74    
emb|CDP01645.1|  unnamed protein product                                241   4e-74    
dbj|BAD11327.1|  glutamine synthetase                                   241   4e-74    
emb|CAA65173.1|  glutamine synthetase                                   241   4e-74    
dbj|BAM84282.1|  glutamine synthetase                                   240   4e-74    
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...    241   4e-74    
gb|KCW48619.1|  hypothetical protein EUGRSUZ_K02283                     240   4e-74    
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g             240   4e-74    
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...    240   4e-74    
ref|NP_001268104.1|  glutamine synthetase                               240   4e-74    
gb|ABU45501.1|  cytosolic glutamine synthetase                          240   5e-74    
ref|XP_010036983.1|  PREDICTED: glutamine synthetase cytosolic is...    240   5e-74    
gb|KJB43163.1|  hypothetical protein B456_007G187300                    240   5e-74    
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...    240   5e-74    
gb|AFP20991.1|  glutamine synthetase isozyme                            240   5e-74    
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme     240   6e-74    
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1         240   6e-74    
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...    240   6e-74    
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...    240   6e-74    
gb|ACU19484.1|  unknown                                                 240   6e-74    
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...    239   7e-74    
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...    240   7e-74    
ref|XP_007141924.1|  hypothetical protein PHAVU_008G237500g             240   8e-74    
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...    240   8e-74    
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme     239   9e-74    
gb|AGV54248.1|  glutamine synthetase                                    239   9e-74    
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...    239   9e-74    
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...    239   1e-73    
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...    239   1e-73    
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...    239   1e-73    
gb|AGC24238.1|  glutamine synthetase 1                                  239   1e-73    
gb|AGC24244.1|  glutamine synthetase 1                                  232   1e-73    
tpg|DAA44139.1|  TPA: glutamine synthetase6                             239   1e-73    
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                     239   1e-73    
ref|XP_002310666.1|  glutamine synthetase family protein                239   1e-73    
dbj|BAM84285.1|  glutamine synthetase                                   239   1e-73    
gb|AFW63835.1|  glutamine synthetase5                                   238   1e-73    
ref|XP_010465841.1|  PREDICTED: glutamine synthetase cytosolic is...    239   1e-73    
dbj|BAD99526.1|  glutamine synthetase                                   239   2e-73    
emb|CAA65174.1|  glutamine synthetase                                   239   2e-73    
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...    239   2e-73    
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...    239   2e-73    
gb|ABX79672.1|  glutamine synthetase                                    239   2e-73    
gb|ACF74298.1|  glutamine synthetase GS56                               232   2e-73    
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...    239   2e-73    
gb|ABK51388.1|  cytosolic glutamine synthetase                          239   2e-73    
ref|XP_003619869.1|  Glutamine synthetase                               239   2e-73    
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...    239   2e-73    
dbj|BAL14865.1|  putative cytosolic glutamine synthetase                238   2e-73    
gb|KHG00904.1|  Glutamine synthetase nodule isozyme                     238   3e-73    
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...    238   3e-73    
gb|ACR38147.1|  unknown                                                 238   3e-73    
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...    239   3e-73    
emb|CAL07995.1|  cytosolic glutamine synthetase                         235   3e-73    
ref|XP_007043312.1|  Glutamine synthetase 1,4                           238   3e-73    
gb|KDP24824.1|  hypothetical protein JCGZ_25308                         238   4e-73    
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...    238   4e-73    
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                    238   5e-73    
ref|XP_002883089.1|  ATGSKB6                                            238   5e-73    
gb|KDO50821.1|  hypothetical protein CISIN_1g018434mg                   234   5e-73    
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme     238   5e-73    
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like               238   5e-73    
gb|AGI78873.1|  glutamine synthetase                                    238   6e-73    
ref|XP_010505938.1|  PREDICTED: glutamine synthetase cytosolic is...    238   6e-73    
ref|XP_006298020.1|  hypothetical protein CARUB_v10014064mg             237   7e-73    
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...    237   7e-73    
gb|AAK08103.1|AF338444_1  glutamine synthetase                          237   8e-73    
gb|KDO50820.1|  hypothetical protein CISIN_1g018434mg                   236   8e-73    
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...    237   8e-73    
gb|KDO50819.1|  hypothetical protein CISIN_1g018434mg                   236   9e-73    
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg             237   9e-73    
gb|AGI78872.1|  glutamine synthetase                                    237   9e-73    
gb|ABK23723.1|  unknown                                                 237   1e-72    
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha               237   1e-72    
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2               237   1e-72    
gb|AFK48742.1|  unknown                                                 237   1e-72    
ref|NP_001241743.1|  glutamine synthetase root isozyme 3                237   1e-72    
emb|CAJ87510.1|  putative glutamine synthetase                          237   1e-72    
gb|AAD52008.1|  cytosolic glutamine synthetase                          236   1e-72    
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like               236   1e-72    
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...    236   2e-72    
gb|ABF06665.1|  glutamine synthetase                                    236   2e-72    
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...    236   2e-72    
ref|XP_010041423.1|  PREDICTED: glutamine synthetase leaf isozyme...    236   2e-72    
gb|AGG19203.1|  glutamine synthetase                                    236   2e-72    
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...    236   2e-72    
gb|AGV07415.1|  glutamine synthetase                                    236   2e-72    
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...    236   2e-72    
ref|XP_010066985.1|  PREDICTED: glutamine synthetase cytosolic is...    235   2e-72    
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...    236   3e-72    
ref|XP_006828438.1|  hypothetical protein AMTR_s00060p00109730          236   3e-72    
ref|NP_001185327.1|  glutamine synthetase                               236   3e-72    
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...    236   3e-72    
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg             238   4e-72    
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...    235   4e-72    
ref|NP_188409.1|  glutamine synthetase cytosolic isozyme 1-3            235   4e-72    
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...    235   5e-72    
gb|AAQ16554.1|  glufosinate-resistant glutamine synthetase              231   5e-72    
gb|AGC24234.1|  glutamine synthetase 1                                  235   5e-72    
ref|XP_002527139.1|  glutamine synthetase plant, putative               235   5e-72    
gb|AAG40237.2|  glutamine synthetase GS1                                235   5e-72    
ref|XP_009145973.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    235   6e-72    
ref|XP_006844043.1|  hypothetical protein AMTR_s00006p00241880          235   6e-72    
ref|XP_011083120.1|  PREDICTED: glutamine synthetase cytosolic is...    234   8e-72    
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg                234   1e-71    
gb|AFB69879.1|  glutamine synthetase isoform 1-1                        234   1e-71    
ref|XP_010250142.1|  PREDICTED: glutamine synthetase nodule isozyme     234   1e-71    
gb|AEH16645.1|  glutamine synthetase                                    234   2e-71    
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase                234   2e-71    
dbj|BAK01909.1|  predicted protein                                      234   2e-71    
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...    234   2e-71    
gb|KJB77351.1|  hypothetical protein B456_012G133400                    230   2e-71    
pir||S18603  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic (cl...    234   2e-71 
gb|ACN40288.1|  unknown                                                 233   3e-71    
gb|KCW52168.1|  hypothetical protein EUGRSUZ_J01606                     233   3e-71    
ref|XP_010089044.1|  Glutamine synthetase nodule isozyme                232   3e-71    
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...    233   4e-71    
gb|ACR45959.1|  glutamine synthetase 1a                                 233   4e-71    
gb|AAR84347.1|  glutamine synthetase isoform GSr1                       233   5e-71    
gb|AJD14834.1|  glutamine synthetase                                    233   5e-71    
gb|AAO42253.1|  putative glutamine synthetase                           233   5e-71    
gb|KCW52167.1|  hypothetical protein EUGRSUZ_J01606                     232   5e-71    
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg             233   5e-71    
ref|XP_010032725.1|  PREDICTED: glutamine synthetase nodule isozyme     232   6e-71    
gb|KHG29838.1|  Glutamine synthetase cytosolic isozyme 1-1              233   6e-71    
sp|P14636.1|GLNA3_LUPAN  RecName: Full=Glutamine synthetase nodul...    231   7e-71    
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2               232   7e-71    
gb|ACJ11724.1|  glutamine synthase                                      232   7e-71    
gb|KHG29839.1|  Glutamine synthetase cytosolic isozyme 1-1              232   7e-71    
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...    232   7e-71    
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                      232   8e-71    
gb|ACR45960.1|  glutamine synthetase 1b                                 232   1e-70    
gb|AFB69880.1|  glutamine synthetase isoform 1r                         231   1e-70    
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817             232   1e-70    
gb|EEC73954.1|  hypothetical protein OsI_08842                          232   1e-70    
ref|XP_010916212.1|  PREDICTED: glutamine synthetase nodule isozy...    231   1e-70    
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944             232   2e-70    
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...    231   2e-70    
ref|XP_001782920.1|  predicted protein                                  231   2e-70    
gb|AEM42902.1|  cytosolic glutamine synthetase isoform                  231   2e-70    
emb|CDX82343.1|  BnaA03g34780D                                          231   2e-70    
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...    231   2e-70    
gb|AAZ30058.1|  glutamine synthetase isoform GS1b                       231   2e-70    
gb|AAZ30057.1|  glutamine synthetase isoform GS1a                       231   2e-70    
gb|AAP33169.1|  cytosolic glutamine synthetase                          231   2e-70    
gb|KDP43303.1|  hypothetical protein JCGZ_24224                         231   2e-70    
gb|AAR84348.1|  glutamine synthetase isoform GSr2                       231   2e-70    
dbj|BAA04994.1|  glutamine synthetase                                   231   3e-70    
gb|AAK14401.1|AF343667_1  cytosolic glutamine synthetase                231   3e-70    
ref|XP_009135551.1|  PREDICTED: glutamine synthetase cytosolic is...    231   3e-70    
ref|XP_003616263.1|  Glutamine synthetase                               231   3e-70    
ref|XP_010688706.1|  PREDICTED: glutamine synthetase nodule isozyme     231   3e-70    
ref|XP_006651743.1|  PREDICTED: glutamine synthetase cytosolic is...    231   3e-70    
emb|CDY68590.1|  BnaAnng27730D                                          230   3e-70    
emb|CDX75942.1|  BnaC03g40250D                                          230   3e-70    
ref|XP_009113719.1|  PREDICTED: glutamine synthetase cytosolic is...    230   4e-70    
ref|XP_008351243.1|  PREDICTED: glutamine synthetase, chloroplast...    224   5e-70    
gb|EEC76061.1|  hypothetical protein OsI_13264                          230   6e-70    
ref|NP_001051067.1|  Os03g0712800                                       230   6e-70    
gb|AAZ30059.1|  glutamine synthetase isoform GS1c                       229   9e-70    
gb|EYU43846.1|  hypothetical protein MIMGU_mgv1a010285mg                228   1e-69    
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1           229   1e-69    
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                      229   1e-69    
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme     229   2e-69    
sp|Q06378.1|GLNA3_HORVU  RecName: Full=Glutamine synthetase; AltN...    229   2e-69    
ref|XP_001782914.1|  predicted protein                                  228   2e-69    
ref|XP_010314231.1|  PREDICTED: glutamine synthetase cytosolic is...    228   2e-69    
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...    228   3e-69    
emb|CAA06383.1|  glutamine synthetase                                   228   3e-69    
pir||S30569  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic - b...    228   3e-69 
gb|AAD28469.1|AF130882_1  glutamine synthetase                          221   8e-69    
gb|AET22435.1|  glutamine synthetase                                    221   8e-69    
ref|XP_004252277.1|  PREDICTED: glutamine synthetase cytosolic is...    226   1e-68    
gb|ACL54769.1|  unknown                                                 227   1e-68    
ref|NP_001105443.1|  glutamine synthetase root isozyme 2                226   2e-68    
ref|XP_009401139.1|  PREDICTED: glutamine synthetase nodule isozy...    226   2e-68    
gb|AEM42903.1|  cytosolic glutamine synthetase isoform                  226   2e-68    
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...    226   4e-68    



>gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum]
Length=432

 Score =   389 bits (998),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 198/207 (96%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQMR+ KSST+ASP+ SKMW SVV+K NK++AVKSSAKFRVFAL S+N+T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKKLAVKSSAKFRVFALQSDNAT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPVQH SELPKWNYDGSST
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVQHASELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAAQIFSDPKVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAQIFSDPKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  SEVPWFGIEQEYTLLQPNVKWPLGWPV  207



>ref|XP_009629915.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana tomentosiformis]
 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata]
Length=432

 Score =   384 bits (985),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 197/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQMR+ KSST+A+P+ SKMW SVV+K NKR+AVKSSAKFRVFAL S++ T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAAQIFSD KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAQIFSDSKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  SEVPWFGIEQEYTLLQQNVKWPLGWPV  207



>ref|XP_009773609.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana sylvestris]
Length=432

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 197/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQMR+ KSST+A+P+ SKMW SVV+K NKR+AVKSSAKFRVFAL S++ T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIP+NKR+KAAQIFSD KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPSNKRHKAAQIFSDSKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  SEVPWFGIEQEYTLLQQNVKWPLGWPV  207



>gb|EYU45601.1| hypothetical protein MIMGU_mgv1a007136mg [Erythranthe guttata]
Length=418

 Score =   381 bits (979),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 196/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQMRI K+ST+AS + SKMW S+VMK NK+ +V++SAKFRVFA+ SE+ T
Sbjct  1    MAQILAPSAQWQMRIGKNSTDASALNSKMWSSLVMKQNKKGSVRTSAKFRVFAVKSEDGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRMEQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTLSKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQ+FSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQVFSDPKVA  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  AEIPWYGIEQEYTLLQTNVKWPLGWPV  207



>ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum]
 gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum]
Length=432

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQMR+ KSST+ASP+ SKMW SVV+K NKR+AVKSSAKFRVFAL S+N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDNGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNRMEQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDGSST
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVKDASELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR+KAAQIFSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHKAAQIFSDPKVA  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            ++VPW+GIEQEYTLLQ NV WPLGWPV
Sbjct  181  SQVPWFGIEQEYTLLQPNVNWPLGWPV  207



>ref|XP_011090823.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090824.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090825.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090827.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
Length=432

 Score =   380 bits (975),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MA ILAPSAQWQMRIAK+ST+ASP+ SKMW S+V+K NK+ AVK+SAKFRV A+ SEN T
Sbjct  1    MAHILAPSAQWQMRIAKNSTDASPLTSKMWSSLVLKQNKKGAVKTSAKFRVLAVQSENGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRMEQ+LNLDV+P TDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEQMLNLDVSPITDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRY+AAQIFSDPKVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRYRAAQIFSDPKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NVKWPLGWP 
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPLGWPT  207



>ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
 ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
Length=432

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 193/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQMR+ KSST+ASP+ SKMW SVV+K NKR A+KSSAKFRVFAL S+N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRHALKSSAKFRVFALQSDNGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+EQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVKDASELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAAQIFSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAQIFSDPKVA  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            A+VPW+GIEQEYTLLQ NV WPLGWPV
Sbjct  181  AQVPWFGIEQEYTLLQPNVNWPLGWPV  207



>ref|XP_007034566.1| Glutamine synthetase 2 [Theobroma cacao]
 gb|EOY05492.1| Glutamine synthetase 2 [Theobroma cacao]
Length=549

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 198/219 (90%), Gaps = 1/219 (0%)
 Frame = +2

Query  17   HFPAFFSWE*VNMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAK  196
            HF A  SWE   MAQILAPS QWQMR+ K+ST  SP+A+KMW S+V+K NK+ A KS  K
Sbjct  106  HFQAVPSWEKRKMAQILAPSTQWQMRLPKTSTYGSPIATKMWNSLVLKQNKQGAAKSCGK  165

Query  197  FRVFAL-SENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPS  373
            FRVFAL SENSTVNR+E+LLN+D+TPYTDKIIAEYIWIGGSGID RSKS+TI+KPV+HPS
Sbjct  166  FRVFALQSENSTVNRLEKLLNMDITPYTDKIIAEYIWIGGSGIDLRSKSKTIAKPVEHPS  225

Query  374  ELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRY  553
            ELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+
Sbjct  226  ELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRH  285

Query  554  KAAQIFSDPKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +AA+IFS+ KVV +VPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  286  RAAEIFSNKKVVDKVPWFGIEQEYTLLQQNVKWPLGWPV  324



>gb|KJB28233.1| hypothetical protein B456_005G035800 [Gossypium raimondii]
Length=431

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            MAQ+LAPS QWQM + K+ST  SP+A+KMW S+V+K NK+ A KSS KF+V ALSENSTV
Sbjct  1    MAQLLAPSTQWQMTLPKTSTYGSPIATKMWSSLVLKQNKKGAAKSSGKFKVVALSENSTV  60

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            NR+E LLN+DVTPYTDKIIAEY+WIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  61   NRLENLLNMDVTPYTDKIIAEYVWIGGSGLDMRSKSRTISKPVKHPSELPKWNYDGSSTG  120

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR++AA+IFS+ KVV 
Sbjct  121  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEIFSNKKVVD  180

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  EVPWFGIEQEYTLLQQNVKWPLGWPV  206



>ref|XP_011006593.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Populus 
euphratica]
Length=432

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS+QWQMRIAK+S  A PM +KMW S+V+K NK+   KSSAKFRVFAL SENST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLD+TPYTDK IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKR++AA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPLGWPV  207



>ref|XP_010105702.1| Glutamine synthetase leaf isozyme [Morus notabilis]
 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis]
Length=433

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPN-KRVAVKSSAKFRVFAL-SENS  226
            MAQILAPS QWQMRI K+ST+ASPM SKMWGS+VMK N K+ A+KSS KFRVFAL S+N 
Sbjct  1    MAQILAPSTQWQMRITKASTDASPMTSKMWGSLVMKQNNKKGAMKSSTKFRVFALKSDNG  60

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            T+NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSK+RTISKPV+HPSELPKWN+DGSS
Sbjct  61   TINRLEDLLNLDVTPYTDKIIAEYIWIGGSGIDVRSKARTISKPVEHPSELPKWNFDGSS  120

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVI+YPQA+FKDPFRGGNNILVICD+YTPAGEPIPTNKR++AA+IFS+ KV
Sbjct  121  TGQAPGEDSEVIIYPQAVFKDPFRGGNNILVICDSYTPAGEPIPTNKRHRAAEIFSNKKV  180

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V EVPW+GIEQEYTLLQ NV+WPLGWPV
Sbjct  181  VNEVPWFGIEQEYTLLQPNVRWPLGWPV  208



>ref|XP_002314425.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEF00596.1| glutamine synthetase family protein [Populus trichocarpa]
Length=432

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS+QWQMRIAK+S  A PM +KMW S+V+K NK+   KSSAKFRVFAL SENST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLD+TPYTDK IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKR++AA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPLGWPV  207



>dbj|BAF62340.1| glutamine synthetase [Avicennia marina]
Length=432

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQMRIAK+S +ASP+++K W S+++K NK+ AVKS  KFRV A+ SENST
Sbjct  1    MAQILAPSAQWQMRIAKNSIDASPLSTKTWSSLILKQNKKEAVKSPGKFRVLAVKSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+EQ+LNLDVTPYTDKIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTIPKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV CDTYTP GEPIPTNKRY+AAQIFSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVTCDTYTPQGEPIPTNKRYRAAQIFSDPKVA  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            A++PW+GIEQEYTLLQ NV+WPLGWP 
Sbjct  181  ADIPWFGIEQEYTLLQPNVQWPLGWPA  207



>ref|XP_011071523.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Sesamum indicum]
Length=429

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 192/207 (93%), Gaps = 4/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPSAQWQM I+K  T+A+P+ +KMWGS+ +K   + +VKSSAKF VFA+ S+NST
Sbjct  1    MAQILAPSAQWQMGISKGLTDATPLTTKMWGSLALK---QGSVKSSAKFGVFAVKSDNST  57

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+EQ+LNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRY+AAQIFSDPKV 
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYRAAQIFSDPKVS  177

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ NVKWPLGWP 
Sbjct  178  AEIPWYGIEQEYTLLQTNVKWPLGWPA  204



>emb|CDO98975.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 192/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ K+  + SP+ SKMW S+V+K +K+ A+K+S+KF+V+AL SEN T
Sbjct  1    MAQILAPSPQWQMRVTKNLMDVSPLTSKMWSSLVLKQSKKGAIKTSSKFKVYALQSENGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+EQLLNLDVTPYTDKIIAEYIWIGGSG D RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGTDVRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRY+AAQIFS+PKV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYRAAQIFSNPKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPW+GIEQEYTLLQ NVKWPLGWP 
Sbjct  181  AEVPWFGIEQEYTLLQTNVKWPLGWPA  207



>emb|CAA47373.2| glutamate--ammonia ligase [Nicotiana sylvestris]
Length=432

 Score =   366 bits (939),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS +WQMR+ KSST+A+P+ SKMW SVV+K  K +AVKSSAKFR FAL S++ T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVLKIIKELAVKSSAKFRFFALESDSGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VN+ EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNQSEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIP+NKR+KAAQIFSD KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPSNKRHKAAQIFSDSKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +EVPW+ IEQEYTLLQQNVKWPLGWPV
Sbjct  181  SEVPWFEIEQEYTLLQQNVKWPLGWPV  207



>gb|KHG04493.1| Glutamine synthetase leaf isozyme, chloroplastic [Gossypium arboreum]
Length=432

 Score =   365 bits (938),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ KSST  SP+A+KMW S+++K N + A KS+ KFRV AL SENST
Sbjct  1    MAQILAPSTQWQMRVPKSSTFGSPIATKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR E+LLN+D+TPYTDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQQNVKWPLGWPV  207



>ref|XP_006380048.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ERP57845.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=306

 Score =   360 bits (924),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS+QWQMRIAK+S  ASPM +KMW S+V+K NK+   KSSAKFRVFA+ SEN T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLD+TPYT+  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKR++AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPLGWPV  207



>gb|KDO74876.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=375

 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AA+IFS+ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  AEVPWFGIEQEYTLLQQNVKWPLGWPV  207



>ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
 ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
Length=432

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AA+IFS+ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  AEVPWFGIEQEYTLLQQNVKWPLGWPV  207



>gb|KDO74872.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74873.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74874.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=432

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AA+IFS+ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  AEVPWFGIEQEYTLLQQNVKWPLGWPV  207



>ref|XP_002312733.1| glutamine synthetase family protein [Populus trichocarpa]
 ref|XP_006380049.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ABK94955.1| unknown [Populus trichocarpa]
 gb|EEE90100.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP57846.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=432

 Score =   363 bits (932),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS+QWQMRIAK+S  ASPM +KMW S+V+K NK+   KSSAKFRVFA+ SEN T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLD+TPYT+  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKR++AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPLGWPV  207



>gb|KJB37729.1| hypothetical protein B456_006G218100 [Gossypium raimondii]
Length=432

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQIL PS QWQMR+ K ST  SP+ +KMW S+++K N + A KS+ KFRV AL SENST
Sbjct  1    MAQILVPSTQWQMRVPKCSTFGSPIVTKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR E+LLN+D+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQQNVKWPLGWPV  207



>ref|XP_010255852.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Nelumbo 
nucifera]
Length=432

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ+++ K+S+ A P+ +KMW S+++   ++ A K SAKFRVFAL SE+ST
Sbjct  1    MAQILAPSIQWQIKMTKNSSSARPITAKMWSSLLLNQKRKGAAKGSAKFRVFALQSESST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LL LD TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLKLDTTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKRY+AAQIFSDPKVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRYRAAQIFSDPKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ NVKWPLGWP+
Sbjct  181  QEVPWYGIEQEYTLLQTNVKWPLGWPI  207



>gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata]
Length=429

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 189/207 (91%), Gaps = 4/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRVTKSSLHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDNST  57

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKR++AA++FS+PKV+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHRAAEVFSNPKVI  177

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  178  AEVPWYGIEQEYTLLQTNVKWPLGWPV  204



>ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis]
Length=432

 Score =   358 bits (918),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ K+S  ASP+ +KMW S+++K NK+V  K+S + RVFAL SENST
Sbjct  1    MAQILAPSPQWQMRLPKNSMPASPLTTKMWSSLLLKQNKKVTAKNSGRLRVFALKSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TPYTD+IIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEDLLNLDITPYTDRIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKR +AA+IFS  KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRNRAAEIFSSKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQPNVKWPLGWPV  207



>sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Daucus carota]
 gb|AAB71693.1| glutamine synthetase [Daucus carota]
Length=432

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR  K+STE S M SKMWGS+ +K NK+   +SS K+R  A+ SE+ T
Sbjct  1    MAQILAPSVQWQMRFTKNSTEVSSMTSKMWGSLFLKQNKKAPARSSTKYRALAVKSEDGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLDVTPYTDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+KAAQIFSD KV+
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHKAAQIFSDAKVL  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTL+QQ+V WPLGW V
Sbjct  181  GEVPWFGIEQEYTLMQQDVNWPLGWNV  207



>ref|NP_001237784.1| glutamine synthetase precursor [Glycine max]
 gb|AAK43833.1|AF353620_1 glutamine synthetase precursor [Glycine max]
Length=432

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI+KSS  ASP+ S MW S++ K NK+V+  SSAKFRV A+ S+NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPLGWPV  207



>ref|XP_003546121.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597566.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN33081.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=432

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI+KSS  ASP+ S MW S++ K NK+V+  SSAKFRV A+ S+NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPLGWPV  207



>gb|ACU24520.1| unknown [Glycine max]
Length=432

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI+KSS  ASP+ S MW S++ K NK+V+  SSAKFRV A+ S+NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPLGWPV  207



>pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco
Length=432

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS +WQMR+ KSST+A+P+ SKMW SVV+K  K +AVKSSAKFRVFAL S++ T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVIKIIKELAVKSSAKFRVFALESDSGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VN+ EQLLNLDVTPYTD IIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNQSEQLLNLDVTPYTDLIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD Y PAGEPIP+N R+KAAQIFSD  VV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYWPAGEPIPSNLRHKAAQIFSDSLVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +EVPW+ IEQEYTLLQQNVKWPLGWPV
Sbjct  181  SEVPWFEIEQEYTLLQQNVKWPLGWPV  207



>ref|XP_008223033.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Prunus 
mume]
Length=432

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QWQMRI KSST ASPM +KMW S+++K NKR   KSSAKFRV A+ SE+ T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKMWSSLLLKQNKRGPTKSSAKFRVLAVKSEDYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF++ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFANQKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>ref|XP_011009035.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009036.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=432

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS+QWQMRI K+S  ASPM +KMW S+V+K NK+   KSSAKFRVFA+ SEN T
Sbjct  1    MAQILAPSSQWQMRIPKNSAPASPMTAKMWSSLVLKQNKKGIAKSSAKFRVFAVKSENGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TPYT+  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRVEDLLNLDLTPYTNSFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIP NKR++AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPKNKRHRAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPLGWPV  207



>gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra]
Length=432

 Score =   355 bits (911),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MA IL P+ +WQMRI K+S  ASPM +KMWGS+++K NK+ + KSSAKFRVFA  SENST
Sbjct  1    MAHILTPTTRWQMRITKNSANASPMTAKMWGSLLLKQNKKGSSKSSAKFRVFATKSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E+LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRIEKLLNLDLTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AA+IF++ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFTNKKVA  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQQNVKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQQNVKWPLGWPV  207



>ref|XP_006593484.1| PREDICTED: glutamine synthetase precursor isoform X1 [Glycine 
max]
Length=432

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI+KSS  A+P+ S MW S++ K NK+V+  SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPLGWPV  207



>gb|ACU18743.1| unknown [Glycine max]
Length=420

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI+KSS  A+P+ S MW S++ K NK+V+  SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPLGWPV  207



>ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
 gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
Length=432

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QWQMRI KSST ASPM +K+W S+++K NKR   KSSAKFRV A+ SE  T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKVWSSLLLKQNKRGPTKSSAKFRVLAVKSEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF++ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFANQKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata]
Length=430

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 186/207 (90%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI K+S  ASP+ S MW S++MK NK+    SSAKFRV A+ SEN T
Sbjct  1    MAQILAPSTQWQMRITKTSPNASPVTSNMWSSLLMKQNKKAT--SSAKFRVLAIKSENGT  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LL+LD+TPYTDKIIAEYIW+GG+GID RSKSRTI++PV+HPSELPKWNYDGSST
Sbjct  59   INRLENLLDLDITPYTDKIIAEYIWVGGTGIDVRSKSRTIARPVEHPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR++AA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEIFSNPKVQ  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ NV WPLGWPV
Sbjct  179  AEVPWYGIEQEYTLLQTNVNWPLGWPV  205



>ref|XP_011462784.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 188/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALS-ENST  229
            MAQILAP++QWQMRI KSS  +SPM  KMW S+V+K NK+ A+KSS KFRVFA   E+ T
Sbjct  1    MAQILAPTSQWQMRITKSSIPSSPMTGKMWSSLVLKQNKKGAIKSS-KFRVFASKYEDYT  59

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  60   INRVEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  119

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKR++AAQ+FS+ KV+
Sbjct  120  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAQVFSNQKVI  179

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  180  DEVPWYGIEQEYTLLQSSVKWPLGWPV  206



>gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas]
Length=432

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI K+ST  SP+ +KM+ S+ +K NK+   +++A+ RVFA+ S+NST
Sbjct  1    MAQILAPSTQWQMRIQKNSTPMSPLTAKMFNSLFLKQNKKGTARNTARLRVFAMKSDNST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  61   INRLEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVGHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTP+GEPIPTNKR++AAQIFS  KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPSGEPIPTNKRHRAAQIFSKQKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQPNVKWPLGWPV  207



>sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Pisum sativum]
 gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum]
Length=430

 Score =   352 bits (904),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 186/207 (90%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI K+S  A+P+ SKMW S+VMK  K+VA   SAKFRV A+ SEN T
Sbjct  1    MAQILAPSTQWQMRITKTSPCATPITSKMWSSLVMKQTKKVA--HSAKFRVMAVNSENGT  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDGSST
Sbjct  59   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD YTPAGEPIPTNKR++AA+IFS+PKV 
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVVCDAYTPAGEPIPTNKRHRAAEIFSNPKVE  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  179  AEIPWYGIEQEYTLLQTNVKWPLGWPV  205



>ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme 
delta; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
Length=429

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 185/207 (89%), Gaps = 4/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR  KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR++AA++FS+P+V+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEVFSNPRVI  177

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPW+GIEQEYTLLQ NV WPLGWPV
Sbjct  178  AEVPWFGIEQEYTLLQTNVNWPLGWPV  204



>prf||1601519A Gln synthetase
Length=429

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 185/207 (89%), Gaps = 4/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR  KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR++AA++FS+P+V+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEVFSNPRVI  177

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPW+GIEQEYTLLQ NV WPLGWPV
Sbjct  178  AEVPWFGIEQEYTLLQTNVNWPLGWPV  204



>gb|KDO74871.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=428

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 186/207 (90%), Gaps = 5/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSKS    KPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKS----KPVEHPSELPKWNYDGSST  116

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  176

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  177  AEVPWFGIEQEYTLLQQNVKWPLGWPV  203



>gb|AJD14836.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 189/207 (91%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS Q QMRI K+S+  SP+ SKMW S+V+K +KRV  K S+K++V  + SE+ T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD+YTPAGEPIPTNKR++AA+IFS+PKVV
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDSYTPAGEPIPTNKRHRAAEIFSNPKVV  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  179  SEVPWFGIEQEYTLLQTNVKWPLGWPV  205



>gb|KCW84320.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=322

 Score =   347 bits (890),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQI+AP+ Q QMRI K+S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  126

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV+
Sbjct  127  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  186

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTL+Q NV+WPLGWPV
Sbjct  187  NEVPWYGIEQEYTLMQTNVRWPLGWPV  213



>gb|AJI44225.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 189/207 (91%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS Q QMRI K+S+  SP+ SKMW S+V+K +KRV  K S+K++V  + SE+ T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD+YTPAGEPIPTNKR++AA+IFS+PKVV
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDSYTPAGEPIPTNKRHRAAEIFSNPKVV  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  179  SEVPWFGIEQEYTLLQPNVKWPLGWPV  205



>gb|KDO74875.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=442

 Score =   351 bits (900),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 190/217 (88%), Gaps = 11/217 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYI--------W--IGGSGIDTRSKSRTISKPVQHPSEL  379
            VNR+E LLNLD+TPYTDKIIAEYI        W  IGG+GID RSKS+TISKPV+HPSEL
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYICQNNTISCWNRIGGTGIDMRSKSKTISKPVEHPSEL  120

Query  380  PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKA  559
            PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++A
Sbjct  121  PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRA  180

Query  560  AQIFSDPKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            A+IFS+ KV AEVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  AEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPLGWPV  217



>ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=432

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQI+AP+ Q QMRI K S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  1    MAQIMAPTTQCQMRITKHSLNASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTL+Q NV+WPLGWPV
Sbjct  181  NEVPWYGIEQEYTLMQTNVQWPLGWPV  207



>ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=432

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQI+AP+ Q QMRI K+S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  1    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTL+Q NV+WPLGWPV
Sbjct  181  NEVPWYGIEQEYTLMQTNVRWPLGWPV  207



>ref|XP_010035896.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW84319.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=438

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQI+AP+ Q QMRI K+S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  126

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV+
Sbjct  127  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  186

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTL+Q NV+WPLGWPV
Sbjct  187  NEVPWYGIEQEYTLMQTNVRWPLGWPV  213



>ref|XP_004486102.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cicer arietinum]
Length=430

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 187/207 (90%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALS-ENST  229
            MAQILAPS QWQMRI K+S   +P+ SKMW S+V+K NK+VA   SAKFRV A+  +NST
Sbjct  1    MAQILAPSTQWQMRITKTSPCVTPITSKMWSSLVVKQNKKVA--RSAKFRVMAIKPDNST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR++AA+IFS+PKV 
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEIFSNPKVQ  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPLGWPV  205



>ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57036.1| Glutamine synthetase [Cucumis sativus]
Length=432

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ+R   +   +SP+  KMW S+++K NK+ AVKSS+K+RV ++ SE  T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAG PIPTNKR++AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEIPWYGIEQEYTLLQTNVKWPLGWPV  207



>ref|XP_008438737.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
melo]
Length=432

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ+R   +S  +SP+  KMW S+++K NK+ AVKSS+K+RV ++ S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAG PIPTNKR++AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEIPWYGIEQEYTLLQTNVKWPLGWPV  207



>gb|AAN84538.1| putative plastidic glutamine synthetase [Spiraea nipponica]
Length=429

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MA ILAP+ QWQ RI K++T ASPM +KMWGS+++K NK+   K+S KFRV A+ SE  T
Sbjct  1    MAHILAPTTQWQTRITKNATSASPMTAKMWGSLLLKQNKKGPTKTSTKFRVLAVKSEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR KAA+IF+  KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRAKAAEIFAKQKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>ref|XP_009339932.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Pyrus 
x bretschneideri]
Length=432

 Score =   348 bits (892),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 183/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QWQM++ KSS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSGID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>ref|XP_009352136.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=432

 Score =   347 bits (891),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QWQM+I KSST ASPM +KMWGS+V+K NK+   +SS KFRV A  +E  T
Sbjct  1    MAQILAPTSQWQMKITKSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>ref|XP_008361978.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=396

 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QWQM++ KSS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>ref|XP_008390805.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QWQM+I +SST ASPM +KMWGS+V+K NK+   +SS KFRV A  +E  T
Sbjct  1    MAQILAPNSQWQMKITRSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>ref|XP_008353244.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QWQM++ KSS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPV  207



>ref|NP_001284439.1| glutamine synthetase leaf isozyme, chloroplastic [Cucumis melo]
 gb|AAX35343.1| glutamine synthetase [Cucumis melo]
Length=432

 Score =   345 bits (884),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 183/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ+R   +S  +SP+  KMW S+++K NK+ AVKSS+K+RV ++ S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAG PIPTNKR++AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PWYGIEQEYTLLQ NVKWPLG PV
Sbjct  181  DEIPWYGIEQEYTLLQTNVKWPLGXPV  207



>gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli]
Length=432

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 183/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAP++QW+M++ +SS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWRMKVTRSSATASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKSEGYT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPWYGIEQEYTLLQ +VKWPLGWP+
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPLGWPI  207



>sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Medicago sativa]
 gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa]
Length=428

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 185/206 (90%), Gaps = 3/206 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            MAQILAPS Q Q RI K+S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSIQCQTRITKTSPLATPISSKMWSSLVMKQNKKVA--RSAKFRVMAIN-SGTI  57

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR+KAA+IFS+PKV A
Sbjct  118  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVEA  177

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            E+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  178  EIPWYGIEQEYTLLQTDVKWPLGWPV  203



>gb|ACJ84875.1| unknown [Medicago truncatula]
Length=321

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 184/206 (89%), Gaps = 3/206 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR+KAA+IFS+PKV A
Sbjct  118  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVEA  177

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            E+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  178  EIPWYGIEQEYTLLQTDVKWPLGWPV  203



>gb|KEH36742.1| glutamine synthetase domain protein [Medicago truncatula]
Length=393

 Score =   341 bits (875),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 184/206 (89%), Gaps = 3/206 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR+KAA+IFS+PKV A
Sbjct  118  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVEA  177

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            E+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  178  EIPWYGIEQEYTLLQTDVKWPLGWPV  203



>gb|AAO37651.1| glutamine synthetase [Medicago truncatula]
 gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   342 bits (877),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 184/206 (89%), Gaps = 3/206 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR+KAA+IFS+PKV A
Sbjct  118  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVEA  177

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            E+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  178  EIPWYGIEQEYTLLQTDVKWPLGWPV  203



>gb|AAN84563.1| glutamine synthetase [Lotus japonicus]
Length=430

 Score =   342 bits (877),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDK IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPLGWPV  205



>gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus]
Length=430

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDK IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPLGWPV  205



>gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus]
Length=430

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDK IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPLGWPV  205



>ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI26165.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFA-LSENST  229
            MAQILAPS QWQMR+ K+   ASP  +KMWGS+ +K   +   K S KFRV A  SE+ST
Sbjct  1    MAQILAPSTQWQMRMTKNPANASPFTTKMWGSLFLKQKTKGTAKFSTKFRVCASKSESST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR++ LLN+D+ PYTDKIIAEY+WIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLDDLLNMDIRPYTDKIIAEYVWIGGTGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKR++AA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHRAAEIFGNKKVI  180

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  181  DEVPWFGIEQEYTLLQPNVKWPLGWPV  207



>gb|AFH88076.1| chloroplast glutamine synthetase protein, partial [Sesuvium portulacastrum]
Length=433

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SENS  226
            MAQILAPS Q QM I KSS  A+ +    W SVV+K +++ ++K+S KF+V A   SE+S
Sbjct  1    MAQILAPSMQLQMGIPKSSVLANSVMPNKWTSVVLKQSRKGSIKNSTKFKVCATFKSEDS  60

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            TVNR+EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSS
Sbjct  61   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSS  120

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+KAA+IFS+PKV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHKAAEIFSNPKV  180

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             AEVPW+GIEQEYTLLQ NV WPLGWPV
Sbjct  181  SAEVPWFGIEQEYTLLQPNVSWPLGWPV  208



>gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris]
Length=429

 Score =   340 bits (871),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 181/207 (87%), Gaps = 4/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMR  KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQMRFTKSSHHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR++AA++FS+P+V+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEVFSNPRVI  177

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE    GI+QEYTLLQ NV WPLGWPV
Sbjct  178  AEFHGLGIKQEYTLLQTNVNWPLGWPV  204



>gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus]
Length=430

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLDVTPYTDK IAEYIWI G+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIRGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKR++AA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPLGWPV  205



>gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula]
 gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula]
 gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            MAQILAPS Q Q RI K+S  A+P++SKMW S+VMK NK+VA   SA FR  A++ + T+
Sbjct  1    MAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAIN-SGTI  57

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGED+EVILYPQAIFKDPFRGGNNILVICD YT  GEPIPTNKRYKAAQIF +PKV A
Sbjct  118  QAPGEDTEVILYPQAIFKDPFRGGNNILVICDAYTTQGEPIPTNKRYKAAQIFRNPKVEA  177

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            E+PW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  178  EIPWFGIEQEYTLLQTNVKWPLGWPV  203



>gb|KHN37551.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=434

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 185/209 (89%), Gaps = 3/209 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI+KSS  A+P+ S MW S++ K NK+V++ SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNIL--VICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            GQAPG+DSEVILYPQAIFKDPFRG       VICD+YTP GEPIPTNKR++AA+IFS+PK
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGDIFCFAKVICDSYTPQGEPIPTNKRHRAAEIFSNPK  180

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V AEVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  VQAEVPWYGIEQEYTLLQTNVKWPLGWPV  209



>ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI32325.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 181/208 (87%), Gaps = 2/208 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  226
            MA I APS Q Q+R+   SS  A PM +K+W S+++   K+   +SSA+FRV AL SE+S
Sbjct  1    MAHITAPSVQCQVRVVPTSSFTARPMTAKLWNSLLLNQRKKGTSRSSARFRVLALQSESS  60

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            TVNR++ LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSS
Sbjct  61   TVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDGSS  120

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKR+ AA+IFS  KV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHGAAEIFSSQKV  180

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            + EVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  INEVPWYGIEQEYTLLQTNVKWPLGWPV  208



>gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum 
crystallinum]
Length=433

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 183/208 (88%), Gaps = 2/208 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFA--LSENS  226
            MAQILAPS Q +M I KSST AS M    W SVV+K +++ ++K+S KF+V A    + S
Sbjct  1    MAQILAPSLQVKMSITKSSTPASSMLPNTWTSVVLKQSRKGSIKNSTKFKVCASIKPDVS  60

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
              NR+EQLLNLDVTP+TDKIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSS
Sbjct  61   VQNRVEQLLNLDVTPFTDKIIAEYIWIGGAGIDLRSKSRTLSKPVEHPSELPKWNYDGSS  120

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAA+IFS+PKV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNPKV  180

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V+EVPWYGIEQEYTL+Q NVKWPLGWPV
Sbjct  181  VSEVPWYGIEQEYTLMQPNVKWPLGWPV  208



>ref|XP_010557680.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=434

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMAS-KMWGSVVMKPNKRVA-VKSSAKFRVFAL-SEN  223
            MAQILAPS + QM + K S  +SP AS K+W SVV++ NK+   +  S KFRV AL S++
Sbjct  1    MAQILAPSPKCQMGVPKHSVISSPAASSKLWSSVVLRQNKQSGKLNCSNKFRVLALQSDD  60

Query  224  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
            STVNR+E LLNLD  PYTDKIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGS
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDGS  120

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIF+DPFRGGNNILVICD YTPAGEPIPTNKR +AA+IFSD K
Sbjct  121  STGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDCYTPAGEPIPTNKRARAAEIFSDKK  180

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            VV ++PW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  VVDDIPWFGIEQEYTLLQQNVKWPLGWPV  209



>ref|XP_010542001.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010542002.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=434

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMAS-KMWGSVVMKPNKRVA-VKSSAKFRVFAL-SEN  223
            MAQILAPS + QM   K S   SP AS ++W SVV+K NK+   +K S+KFRV A+ S++
Sbjct  1    MAQILAPSPKCQMGAPKHSFITSPAASSRLWSSVVLKQNKQSGKLKYSSKFRVLAVQSDD  60

Query  224  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
            STVNR+E LLNLD  PYTDKIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGS
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDGS  120

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIF+DPFRGGNNILVICD YTPAGEPIPTNKR +AA+IF D K
Sbjct  121  STGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDCYTPAGEPIPTNKRARAAEIFGDKK  180

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            VV E+PW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  181  VVGEIPWFGIEQEYTLLQQNVKWPLGWPV  209



>ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris]
 gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris]
Length=431

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 183/208 (88%), Gaps = 4/208 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SENS  226
            MAQILAP+ Q QM+++KS T +  M    W S+++K +++ ++K S KF+V A   +E+ 
Sbjct  1    MAQILAPNMQCQMKLSKSLTNS--MIPNSWTSILLKGSQKGSIKCSTKFKVCAALKTEHG  58

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            TVNRMEQLLNLDVTP+TDKIIAEYIWIGGSGID RSKSRT+S+PV+ PSELPKWNYDGSS
Sbjct  59   TVNRMEQLLNLDVTPFTDKIIAEYIWIGGSGIDLRSKSRTLSRPVEDPSELPKWNYDGSS  118

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAA+IFS+PKV
Sbjct  119  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNPKV  178

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             +EVPW+GIEQEYTLLQ NV+WPLGWPV
Sbjct  179  ASEVPWFGIEQEYTLLQPNVQWPLGWPV  206



>emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera]
Length=433

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  226
            MA I APS Q Q+R+   SS  A  M +K+W S++    K+   +SSA+ RV AL SE+ 
Sbjct  1    MAHIXAPSVQCQVRVVPTSSFTARXMTAKLWNSLLXNQRKKGTSRSSARXRVLALQSESX  60

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            TVNR++ LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSS
Sbjct  61   TVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDGSS  120

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKR+ AA+IFS  KV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHGAAEIFSSQKV  180

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            + EVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  INEVPWYGIEQEYTLLQTNVKWPLGWPV  208



>gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea]
Length=431

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 180/208 (87%), Gaps = 4/208 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFA--LSENS  226
            MAQILAPS Q QM+++K  T  S M    W S+++K  ++ ++K S KFRV A   S++ 
Sbjct  1    MAQILAPSMQCQMKLSKGLT--SSMTPSPWTSILLKQGQKGSIKCSTKFRVCASLQSDHG  58

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            TVNR+EQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSS
Sbjct  59   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDLRSKSRTLSKPVEHPSELPKWNYDGSS  118

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPG+DSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+KAA+IF++ KV
Sbjct  119  TGQAPGQDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFNNQKV  178

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             +EVPW+GIEQEYTLLQ NV WPLGWPV
Sbjct  179  ASEVPWFGIEQEYTLLQPNVSWPLGWPV  206



>ref|XP_003594092.1| Glutamine synthetase [Medicago truncatula]
Length=1639

 Score =   344 bits (882),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 184/206 (89%), Gaps = 3/206 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR+KAA+IFS+PKV A
Sbjct  118  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVEA  177

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            E+PWYGIEQEYTLLQ +VKWPLGWPV
Sbjct  178  EIPWYGIEQEYTLLQTDVKWPLGWPV  203


 Score =   342 bits (877),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  50    NMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
             NMAQILAPS Q Q RI K+S  A+P++SKMW S+VMK NK+VA   SA FR  A++ + T
Sbjct  1211  NMAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAIN-SGT  1267

Query  230   VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
             +NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  1268  INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  1327

Query  410   GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
             GQAPGED+EVILYPQAIFKDPFRGGNNILVICD YT  GEPIPTNKRYKAAQIF +PKV 
Sbjct  1328  GQAPGEDTEVILYPQAIFKDPFRGGNNILVICDAYTTQGEPIPTNKRYKAAQIFRNPKVE  1387

Query  590   AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             AE+PW+GIEQEYTLLQ NVKWPLGWPV
Sbjct  1388  AEIPWFGIEQEYTLLQTNVKWPLGWPV  1414



>ref|XP_006850815.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
 gb|ERN12396.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
Length=433

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 176/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVM--KPNKRVAVKSSAKFRVF---ALS  217
            MAQILAPS Q QM  AK S +A P+ +KMW S+V+  + + R + KS++KFR F   A S
Sbjct  1    MAQILAPSMQCQMGSAKISIKAGPVTAKMWNSLVLNHRLSGRNSFKSASKFRAFSVKAAS  60

Query  218  ENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  397
            +N  VNR+E LL LD+TP TDKIIAEYIWIGGSG D RSKSRTIS+PV+    LPKWNYD
Sbjct  61   DNGVVNRLEDLLKLDLTPITDKIIAEYIWIGGSGTDLRSKSRTISRPVESALGLPKWNYD  120

Query  398  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSD  577
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEP+PTNKRY+AAQIFS+
Sbjct  121  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPLPTNKRYRAAQIFSE  180

Query  578  PKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             KV+ EVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  KKVIDEVPWYGIEQEYTLLQPNVKWPLGWPV  211



>ref|XP_010435447.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010435448.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
 ref|XP_010435454.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X7 [Camelina sativa]
 ref|XP_010440747.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=441

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 178/207 (86%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+ +S + +K+W SVV+K  K+ + K    FRVFAL S+NST
Sbjct  12   MAQILAASPTCQMRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  69

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  70   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  129

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  130  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVT  189

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  190  GEVPWFGIEQEYTLLQQNVKWPLGWPV  216



>ref|XP_010435449.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
 ref|XP_010435451.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X4 [Camelina sativa]
 ref|XP_010440748.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=430

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 178/207 (86%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+ +S + +K+W SVV+K  K+ + K    FRVFAL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVT  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  179  GEVPWFGIEQEYTLLQQNVKWPLGWPV  205



>ref|XP_010450396.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
 ref|XP_010450397.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=430

 Score =   317 bits (811),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+ +S + +K+W SVV+K  K+ + K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVLALQSDNST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVT  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  179  GEVPWFGIEQEYTLLQQNVKWPLGWPV  205



>ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 175/207 (85%), Gaps = 4/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIA--SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  57

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD  PYTD+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  58   VNRVETLLNLDTKPYTDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  117

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR KAA+IFS+ KV 
Sbjct  118  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAKAAEIFSNKKVT  177

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  178  NEVPWFGIEQEYTLLQQNVKWPLGWPV  204



>ref|XP_008779349.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, 
partial [Phoenix dactylifera]
Length=259

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 171/209 (82%), Gaps = 3/209 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASP-MASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SEN  223
            MA +L PS Q +M I  +S +A P M +K W S++    +    KS++ F+V AL    N
Sbjct  1    MAHMLVPSMQCRMGITSNSIQARPIMTAKTWNSLLSNARRPKTKKSTSTFKVLALKSDNN  60

Query  224  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              V+R+E LLNLD+TP+TDKIIAEYIWIGG+GID RSK+RT+ +PV+HPSELPKWNYDGS
Sbjct  61   GAVSRLENLLNLDITPFTDKIIAEYIWIGGTGIDIRSKARTVPRPVEHPSELPKWNYDGS  120

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQA F+DPFRGGNNILVICD YTP+GEPIPTNKRY+AAQIFS+ K
Sbjct  121  STGQAPGEDSEVILYPQAFFRDPFRGGNNILVICDCYTPSGEPIPTNKRYRAAQIFSEKK  180

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V+ E PWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  VINETPWYGIEQEYTLLQPNVKWPLGWPV  209



>ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana]
 sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana]
 dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana]
 dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
(clone lambdaAtgsl1) [Arabidopsis thaliana]
 gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana]
 gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
[Arabidopsis thaliana]
 gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana]
 gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana]
 prf||1804333A Gln synthetase
Length=430

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 175/207 (85%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIAS-SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR KAA+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAKAAEIFSNKKVS  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  179  GEVPWFGIEQEYTLLQQNVKWPLGWPV  205



>ref|XP_004174085.1| PREDICTED: glutamine synthetase, chloroplastic-like, partial 
[Cucumis sativus]
Length=196

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQ+R   +   +SP+  KMW S+++K NK+ AVKSS+K+RV ++ SE  T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAG PIPTNKR++AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  590  AEVPW  604
             E+PW
Sbjct  181  DEIPW  185



>ref|XP_010938796.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Elaeis 
guineensis]
Length=434

 Score =   311 bits (798),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 3/209 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPM-ASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SEN  223
            MA++L PS Q QM +  +S +A P+  +K W S+++   +    KS++ F+V AL    N
Sbjct  1    MARMLVPSMQCQMGMTSNSIQARPIITTKSWNSLLLNSQRPKTKKSTSTFKVLALKYDNN  60

Query  224  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
             TV+R+E LLN+D+TP+TDKIIAEYIWIGG+GID RSK RTI +PV+HPSELPKWNYDGS
Sbjct  61   GTVSRLENLLNMDITPFTDKIIAEYIWIGGTGIDIRSKPRTIPRPVEHPSELPKWNYDGS  120

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIF+DPFRGGNNILVICD YTP+G PIPTNKRY+AAQIFS+ K
Sbjct  121  STGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDCYTPSGAPIPTNKRYRAAQIFSEKK  180

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V+ EVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  VIDEVPWYGIEQEYTLLQPNVKWPLGWPV  209



>dbj|BAH56878.1| AT5G35630 [Arabidopsis thaliana]
Length=278

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 174/207 (84%), Gaps = 4/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIA-SSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR K A+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAK-AEIFSNKKVS  177

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             EVPW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  178  GEVPWFGIEQEYTLLQQNVKWPLGWPV  204



>ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa]
 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Brassica napus]
 emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus]
 emb|CDX74644.1| BnaA04g07450D [Brassica napus]
Length=428

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 175/207 (85%), Gaps = 5/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+ AS   SK+W SVV+K  K+ + K  + F+V AL S+NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSKVRS-FKVMALQSDNST  56

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPLGWPV  203



>ref|XP_009391592.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391594.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 172/208 (83%), Gaps = 2/208 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPM-ASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  226
            MA+++    Q QM    +S +  PM  SKMW S+++   +    +  + F+V A+ SEN 
Sbjct  1    MAKMMVSPMQCQMGFPSNSLQGRPMITSKMWNSLLLNAQRPKTRRGISAFKVLAVKSENG  60

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
             V+R+E LLNLD TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+H SELPKWNYDGSS
Sbjct  61   VVSRLEDLLNLDTTPFTDKIIAEYIWIGGTGIDIRSKSRTISKPVEHASELPKWNYDGSS  120

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTP+GEPIPTNKR++A+QIFSD KV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPSGEPIPTNKRHRASQIFSDQKV  180

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            + EVPWYGIEQEYTLLQ NV+WPLGWPV
Sbjct  181  IDEVPWYGIEQEYTLLQTNVQWPLGWPV  208



>ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
 gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
Length=429

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 175/208 (84%), Gaps = 6/208 (3%)
 Frame = +2

Query  53   MAQILAPS-AQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  226
            MAQILA S    QMR+ K S   S + +K+W SVV+K  K+ + K    FRV AL S+NS
Sbjct  1    MAQILAASPTTCQMRVPKHS---SVITNKLWSSVVLKQKKQSSNKHRG-FRVLALQSDNS  56

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            TVNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSS
Sbjct  57   TVNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSS  116

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV
Sbjct  117  TGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNQKV  176

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
              E+PW+GIEQEYTLLQQNVKWPLGWPV
Sbjct  177  TDELPWFGIEQEYTLLQQNVKWPLGWPV  204



>gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis]
Length=428

 Score =   309 bits (791),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 175/207 (85%), Gaps = 5/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+ AS   SK+W SVV+K  ++ + K  + F+V AL S+NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKEQSSSKVRS-FKVMALQSDNST  56

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPLGWPV  203



>ref|XP_009417914.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417915.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   309 bits (791),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 173/208 (83%), Gaps = 2/208 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPM-ASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  226
            MAQ++    Q Q+R    S +  PM  SKMW S+++   +    +S + F+V A+ S+N 
Sbjct  1    MAQMMVSPMQCQIRFPSKSLQGKPMITSKMWNSLLLNAQRFKTKRSVSAFKVLAVKSDNG  60

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
             V+R+E LL LD+ P+TDKIIAEYIWIGG+GID RSKSRTI++PV++PSELPKWNYDGSS
Sbjct  61   VVSRLEDLLKLDMAPFTDKIIAEYIWIGGTGIDIRSKSRTITRPVEYPSELPKWNYDGSS  120

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQA+FKDPFRGGNNILVICD+YTP+GEPIPTNKRY+AAQIFS+ KV
Sbjct  121  TGQAPGEDSEVILYPQAVFKDPFRGGNNILVICDSYTPSGEPIPTNKRYRAAQIFSEQKV  180

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            + EVPWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  181  IDEVPWYGIEQEYTLLQTNVKWPLGWPV  208



>ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
Length=426

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 173/207 (84%), Gaps = 7/207 (3%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+ AS   SK+W SV++K  K+     S  FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVTKPSSIAS---SKLWSSVMLKQKKQ---SRSTSFRVMALQSDNST  54

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  55   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  114

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  115  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVN  174

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  175  EELPWFGIEQEYTLLQPNVNWPLGWPV  201



>emb|CDY33684.1| BnaC04g29670D [Brassica napus]
Length=489

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 177/215 (82%), Gaps = 6/215 (3%)
 Frame = +2

Query  29   FFSWE*VNMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVF  208
            +F W  + MAQILA S   QMR+ K S+ AS   SK+W SVV+K  K+ +      F+V 
Sbjct  55   YFLW--IKMAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSSKVRSFKVM  109

Query  209  AL-SENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPK  385
            AL S+NST+NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPK
Sbjct  110  ALQSDNSTINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPK  169

Query  386  WNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQ  565
            WNYDGSSTGQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR +AA+
Sbjct  170  WNYDGSSTGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAE  229

Query  566  IFSDPKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            IFS+ KV  E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  230  IFSNKKVNEEIPWFGIEQEYTLLQPNVNWPLGWPV  264



>emb|CAB72423.1| glutamine synthetase [Brassica napus]
Length=428

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 174/207 (84%), Gaps = 5/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+ AS   SK+W SVV+K  K+ + K  + F+V A+ S+NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSKVRS-FKVMAIQSDNST  56

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD  P+TD+IIAEYIW GGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWYGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPLGWPV  203



>ref|XP_010435452.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X5 [Camelina sativa]
 ref|XP_010435453.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X6 [Camelina sativa]
 ref|XP_010440749.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
Length=418

 Score =   306 bits (784),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 170/195 (87%), Gaps = 3/195 (2%)
 Frame = +2

Query  89   MRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENSTVNRMEQLLNLDV  265
            MR+ K S+ +S + +K+W SVV+K  K+ + K    FRVFAL S+NSTVNR+E LLNLD 
Sbjct  1    MRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNSTVNRVETLLNLDT  58

Query  266  TPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVIL  445
             PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSSTGQAPGEDSEVIL
Sbjct  59   KPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSSTGQAPGEDSEVIL  118

Query  446  YPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEVPWYGIEQEY  625
            YPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV  EVPW+GIEQEY
Sbjct  119  YPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVTGEVPWFGIEQEY  178

Query  626  TLLQQNVKWPLGWPV  670
            TLLQQNVKWPLGWPV
Sbjct  179  TLLQQNVKWPLGWPV  193



>ref|XP_003580719.1| PREDICTED: glutamine synthetase, chloroplastic [Brachypodium 
distachyon]
Length=430

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 172/211 (82%), Gaps = 11/211 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQM-RIAKSSTEASPMAS--KMWGSVVMKPNKRVAVKSSAKFRVFALSEN  223
            MAQ + P+ Q QM  + KS+  A P A+  ++WG       +R   + ++ F+V AL   
Sbjct  1    MAQAVVPAMQCQMGALGKSAVRARPAAAGGRVWGV------RRSGARGTSGFKVLALGTE  54

Query  224  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  397
            +T  V R+EQLLN+D  PY+DKIIAEYIW+GGSGID RSKSRTISKPV  PSELPKWNYD
Sbjct  55   TTGVVPRLEQLLNMDTKPYSDKIIAEYIWVGGSGIDIRSKSRTISKPVADPSELPKWNYD  114

Query  398  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSD  577
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR++AAQIFSD
Sbjct  115  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVVCDTYTPAGEPIPTNKRHRAAQIFSD  174

Query  578  PKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            PKV ++VPWYGIEQEYTLLQ++V WPLGWPV
Sbjct  175  PKVASQVPWYGIEQEYTLLQRDVNWPLGWPV  205



>emb|CDY49365.1| BnaA08g29950D [Brassica napus]
Length=394

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 174/207 (84%), Gaps = 5/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QM++ K S  AS   SK+W SV++K  K+ + K  + F+V AL S+NST
Sbjct  1    MAQILAASPTCQMKLTKPSPIAS---SKLWSSVMLKQKKQNSSKLRS-FKVMALQSDNST  56

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGG+NILVICDTYTPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGDNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPLGWPV  203



>emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus]
Length=428

 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 173/207 (84%), Gaps = 5/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QM++ K S  AS   SK+W SV++K  K+ + K  + F+  AL S+NST
Sbjct  1    MAQILAASPTCQMKLTKPSPIAS---SKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNST  56

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPLGWPV  203



>ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica 
rapa]
Length=428

 Score =   304 bits (778),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 173/207 (84%), Gaps = 5/207 (2%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QM++ K S  AS   SK+W SV++K  K+ + K    F+V AL S+NST
Sbjct  1    MAQILAASPTCQMKLTKPSPIAS---SKLWSSVMLKQKKQNSSKLRG-FKVMALQSDNST  56

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFRGG+NILVICDTYTPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGDNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E+PW+GIEQEYTLLQ NV WPLGWPV
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPLGWPV  203



>gb|AFB69878.1| chloroplast glutamine synthetase isoform 2-1 [Secale cereale]
Length=427

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 170/209 (81%), Gaps = 10/209 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRLWGV-------RRTARATSGFKVLALGPETT  53

Query  230  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V A+VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPLGWPV  202



>gb|AAZ30062.1| plastid glutamine synthetase isoform GS2c [Triticum aestivum]
 gb|AAZ80474.1| GS2 [Triticum aestivum]
 gb|ACT22493.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22495.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22498.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|AEH16638.1| glutamine synthetase [Triticum aestivum]
 gb|AEM42904.1| plastid glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|EMT11272.1| Glutamine synthetase leaf isozyme, chloroplastic [Aegilops tauschii]
Length=427

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 170/209 (81%), Gaps = 10/209 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  230  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V A+VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPLGWPV  202



>ref|XP_004960149.1| PREDICTED: glutamine synthetase, chloroplastic-like [Setaria 
italica]
Length=428

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 171/211 (81%), Gaps = 13/211 (6%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMAS---KMWGSVVMKPNKRVAVKSSAKFRVFALSEN  223
            MAQ + P+ Q Q+  AK++  A P A    ++WG        R   + ++ F+V A+S  
Sbjct  1    MAQAVVPAMQCQVG-AKAAVRARPAAGAGGRVWGV-------RRTGRGTSGFKVMAISTA  52

Query  224  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  397
            ST  V R+EQ+LNLD  PYTDKIIAEYIW+GGSGID RSKSRTI KPV+ PSELPKWNYD
Sbjct  53   STGVVPRLEQMLNLDTKPYTDKIIAEYIWVGGSGIDLRSKSRTIEKPVEDPSELPKWNYD  112

Query  398  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSD  577
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR++AAQIFSD
Sbjct  113  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRHRAAQIFSD  172

Query  578  PKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            P+VV +VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  173  PRVVEQVPWFGIEQEYTLLQRDVNWPLGWPV  203



>gb|ACT22500.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 170/209 (81%), Gaps = 10/209 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  230  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V A+VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPLGWPV  202



>gb|ACT22496.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22497.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 170/209 (81%), Gaps = 10/209 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  230  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V ++VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  174  VTSQVPWFGIEQEYTLMQRDVNWPLGWPV  202



>emb|CDX84116.1| BnaC08g07930D [Brassica napus]
Length=247

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = +2

Query  110  TEASPMAS-KMWGSVVMKPNKRVAVKSSAKFRVFAL-SENSTVNRMEQLLNLDVTPYTDK  283
            T+ SP+AS K+W SV++K  K+ + K  + F+  AL S+NST+NR+E LLNLD  P+TD+
Sbjct  4    TKPSPIASSKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNSTINRVESLLNLDTKPFTDR  62

Query  284  IIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIF  463
            IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAIF
Sbjct  63   IIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIF  122

Query  464  KDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEVPWYGIEQEYTLLQQN  643
            +DPFRGGNNILVICDTYTPAGEPIPTNKR +AA+IFS+ KV  E+PW+GIEQEYTLLQ N
Sbjct  123  RDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVNEEIPWFGIEQEYTLLQPN  182

Query  644  VKWPLGWPV  670
            V WPLGWPV
Sbjct  183  VNWPLGWPV  191



>dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis]
 dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 171/211 (81%), Gaps = 12/211 (6%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI-AKSSTEASPMAS--KMWGSVVMKPNKRVAVKSSAKFRVFALSEN  223
            MAQ + P+ Q Q+    K++  A P  +  ++WG       KR   + ++ F+V A+S  
Sbjct  1    MAQPVVPAMQCQVGARGKAAVRARPAGAGGRVWGV------KRSG-RGTSGFKVMAVSTE  53

Query  224  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  397
            ST  V R+EQLLN+D  P+TDKIIAEYIW+GGSGID RSKSRT+SKPV+ PSELPKWNYD
Sbjct  54   STGVVPRLEQLLNMDTKPFTDKIIAEYIWVGGSGIDLRSKSRTLSKPVEDPSELPKWNYD  113

Query  398  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSD  577
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AAQIFSD
Sbjct  114  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  173

Query  578  PKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            PKVV +VPW+GIEQEYTLLQ +V WPLGWPV
Sbjct  174  PKVVDQVPWFGIEQEYTLLQTDVNWPLGWPV  204



>dbj|BAJ91545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 170/211 (81%), Gaps = 10/211 (5%)
 Frame = +2

Query  47   VNMAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSEN  223
              MAQ +  + Q Q+ +  +++  A   A ++WG        R A ++++ F+V AL   
Sbjct  7    TTMAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGPE  59

Query  224  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  397
            +T  + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYD
Sbjct  60   TTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYD  119

Query  398  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSD  577
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSD
Sbjct  120  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSD  179

Query  578  PKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            PKV ++VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  180  PKVTSQVPWFGIEQEYTLMQRDVNWPLGWPV  210



>dbj|BAG88835.1| unnamed protein product [Oryza sativa Japonica Group]
Length=322

 Score =   290 bits (741),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 170/210 (81%), Gaps = 11/210 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKM--WGSVVMKPNKRVAVKSSAKFRVFALSENS  226
            MAQ + P+ Q Q+   ++   A+  A+    WG        R   + ++ FRV A+S  +
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  227  T--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  400
            T  V RMEQLLN+D TP+TDKIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  401  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDP  580
            SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR +AAQ+FSDP
Sbjct  114  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRNRAAQVFSDP  173

Query  581  KVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            KVV++VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  174  KVVSQVPWFGIEQEYTLLQRDVNWPLGWPV  203



>gb|AAZ30060.1| plastid glutamine synthetase isoform GS2a [Triticum aestivum]
Length=427

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 168/209 (80%), Gaps = 10/209 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFEVLALGPETT  53

Query  230  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQ PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEP+PTNKR+ AAQIFSDPK
Sbjct  114  STGQPPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPVPTNKRHMAAQIFSDPK  173

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V A+VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPLGWPV  202



>ref|NP_001241708.1| uncharacterized protein LOC100856886 [Zea mays]
 gb|ACF85271.1| unknown [Zea mays]
 gb|AFW59722.1| glutamine synthetase1 [Zea mays]
Length=380

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 167/208 (80%), Gaps = 12/208 (6%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  229
            MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST 
Sbjct  1    MAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  230  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
             V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKR++AAQIFSDPKV
Sbjct  111  TGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPKV  170

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
              +VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  171  AEQVPWFGIEQEYTLLQKDVNWPLGWPV  198



>gb|AAL87183.1|AF480497_11 putative precursor chloroplastic glutamine synthetase [Oryza 
sativa Japonica Group]
Length=451

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 170/210 (81%), Gaps = 11/210 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKM--WGSVVMKPNKRVAVKSSAKFRVFALSENS  226
            MAQ + P+ Q Q+   ++   A+  A+    WG        R   + ++ FRV A+S  +
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  227  T--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  400
            T  V RMEQLLN+D TP+TDKIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  401  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDP  580
            SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR +AAQ+FSDP
Sbjct  114  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRNRAAQVFSDP  173

Query  581  KVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            KVV++VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  174  KVVSQVPWFGIEQEYTLLQRDVNWPLGWPV  203



>gb|AAZ30061.1| plastid glutamine synthetase isoform GS2b [Triticum aestivum]
Length=427

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 169/209 (81%), Gaps = 10/209 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  230  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVIC TYTP GEPIPTNKR+ AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICVTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V ++VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  174  VTSQVPWFGIEQEYTLMQRDVNWPLGWPV  202



>ref|NP_001054133.1| Os04g0659100 [Oryza sativa Japonica Group]
 sp|P14655.1|GLNA2_ORYSJ RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=Glutamate--ammonia 
ligase; AltName: Full=OsGS2; Short=GS2; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAA32462.1| unnamed protein product [Oryza sativa]
 emb|CAE02885.2| OSJNBa0015K02.2 [Oryza sativa Japonica Group]
 emb|CAE54574.1| OSJNBa0011F23.15 [Oryza sativa Japonica Group]
 dbj|BAF16047.1| Os04g0659100 [Oryza sativa Japonica Group]
 emb|CAH67797.1| OSIGBa0132E09-OSIGBa0108L24.11 [Oryza sativa Indica Group]
 gb|EEC78171.1| hypothetical protein OsI_17756 [Oryza sativa Indica Group]
 gb|EEE61834.1| hypothetical protein OsJ_16481 [Oryza sativa Japonica Group]
Length=428

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 170/210 (81%), Gaps = 11/210 (5%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKM--WGSVVMKPNKRVAVKSSAKFRVFALSENS  226
            MAQ + P+ Q Q+   ++   A+  A+    WG        R   + ++ FRV A+S  +
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  227  T--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  400
            T  V RMEQLLN+D TP+TDKIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  401  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDP  580
            SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR +AAQ+FSDP
Sbjct  114  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRNRAAQVFSDP  173

Query  581  KVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            KVV++VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  174  KVVSQVPWFGIEQEYTLLQRDVNWPLGWPV  203



>dbj|BAJ95492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   292 bits (747),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 169/211 (80%), Gaps = 10/211 (5%)
 Frame = +2

Query  47   VNMAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSEN  223
              MAQ +  + Q Q+ +  +++  A   A ++WG        R A ++++ F+V AL   
Sbjct  7    TTMAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGPE  59

Query  224  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  397
            +T  + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYD
Sbjct  60   TTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYD  119

Query  398  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSD  577
            GSSTGQAPGEDSEVILYPQA FKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSD
Sbjct  120  GSSTGQAPGEDSEVILYPQATFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSD  179

Query  578  PKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            PKV ++VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  180  PKVTSQVPWFGIEQEYTLMQRDVNWPLGWPV  210



>emb|CAA34131.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   291 bits (745),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 169/208 (81%), Gaps = 10/208 (5%)
 Frame = +2

Query  56   AQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  229
            AQ +  + Q Q+ +  +++  A   A ++WG        R A ++++ F+V AL   +T 
Sbjct  1    AQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGPETTG  53

Query  230  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
             + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  54   VIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGSS  113

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSDPKV
Sbjct  114  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPKV  173

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             ++VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  174  TSQVPWFGIEQEYTLMQRDVNWPLGWPV  201



>ref|XP_008662331.1| PREDICTED: glutamine synthetase, chloroplastic isoform X1 [Zea 
mays]
 gb|ACF83467.1| unknown [Zea mays]
 gb|ACN27769.1| unknown [Zea mays]
 gb|ACF86733.2| unknown [Zea mays]
 gb|AFW59720.1| glutamine synthetase1 isoform 1 [Zea mays]
 gb|AFW59721.1| glutamine synthetase1 isoform 2 [Zea mays]
Length=423

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 167/208 (80%), Gaps = 12/208 (6%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  229
            MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST 
Sbjct  1    MAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  230  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
             V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKR++AAQIFSDPKV
Sbjct  111  TGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPKV  170

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
              +VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  171  AEQVPWFGIEQEYTLLQKDVNWPLGWPV  198



>gb|EPS57543.1| glutamine synthetase, partial [Genlisea aurea]
Length=222

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            VNR+++LLN D+TPYTD IIAEYIWIGGSGID RSKSRTISKPVQHPSELPKWNYDGSST
Sbjct  1    VNRLDKLLNSDLTPYTDNIIAEYIWIGGSGIDIRSKSRTISKPVQHPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAG+PIPTNKR++AAQIFSDPKVV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRVGNNILVICDTYTPAGDPIPTNKRHRAAQIFSDPKVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            +E+PWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  121  SEIPWYGIEQEYTLLQNNVKWPLGWPV  147



>ref|NP_001105725.1| glutamine synthetase, chloroplastic precursor [Zea mays]
 sp|P25462.1|GLNAC_MAIZE RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Zea mays]
 emb|CAA46724.1| glutamine synthetase [Zea mays]
Length=423

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 167/208 (80%), Gaps = 12/208 (6%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  229
            MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST 
Sbjct  1    MAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  230  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
             V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKR++AAQIFSDPKV
Sbjct  111  TGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPKV  170

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
              +VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  171  GEQVPWFGIEQEYTLLQKDVNWPLGWPV  198



>ref|XP_008662330.1| PREDICTED: glutamine synthetase, chloroplastic isoform X2 [Zea 
mays]
Length=512

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 167/209 (80%), Gaps = 12/209 (6%)
 Frame = +2

Query  50   NMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  229
             MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST
Sbjct  89   GMAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGST  138

Query  230  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  403
              V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  139  GVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGS  198

Query  404  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPK  583
            STGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKR++AAQIFSDPK
Sbjct  199  STGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPK  258

Query  584  VVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            V  +VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  259  VAEQVPWFGIEQEYTLLQKDVNWPLGWPV  287



>dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 169/211 (80%), Gaps = 12/211 (6%)
 Frame = +2

Query  53   MAQILAPSAQWQMRI---AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL--S  217
            MAQ + P+ Q Q+ +    ++   A+    ++WG        R + + ++ F+V A+  S
Sbjct  1    MAQAVVPAMQCQVGVKAAVRARPAAAGAGGRVWGV-------RRSGRGTSGFKVMAMGMS  53

Query  218  ENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  397
             +  V R+EQLLN+D  PYTD IIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYD
Sbjct  54   TSGVVPRLEQLLNMDTKPYTDNIIAEYIWVGGSGIDVRSKSRTISKPVEDPSELPKWNYD  113

Query  398  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSD  577
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AAQIFSD
Sbjct  114  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  173

Query  578  PKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            PKVV++VPW+GIEQEYTLLQ +V WPLGWPV
Sbjct  174  PKVVSQVPWFGIEQEYTLLQTDVNWPLGWPV  204



>emb|CAA29057.1| gluthamine synthetase [Pisum sativum]
Length=373

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  227  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  406
            T+NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDGSS
Sbjct  1    TINRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDGSS  60

Query  407  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKV  586
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD YTPAGEPIPTNKR++AA+IFS+PKV
Sbjct  61   TGQAPGEDSEVILYPQAIFKDPFRGGNNILVVCDAYTPAGEPIPTNKRHRAAEIFSNPKV  120

Query  587  VAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             AE+PWYGIEQEYTLLQ NVKWPLGWPV
Sbjct  121  EAEIPWYGIEQEYTLLQTNVKWPLGWPV  148



>gb|EMS53309.1| Glutamine synthetase leaf isozyme, chloroplastic [Triticum urartu]
Length=535

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 159/193 (82%), Gaps = 9/193 (5%)
 Frame = +2

Query  98   AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST--VNRMEQLLNLDVTP  271
              S+  A   A ++WG        R   ++++ F+V AL   +T  + RM+QLL++D TP
Sbjct  9    GSSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETTGVIQRMQQLLDMDTTP  61

Query  272  YTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYP  451
            +TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSSTGQAPGEDSEVILYP
Sbjct  62   FTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYP  121

Query  452  QAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEVPWYGIEQEYTL  631
            QAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+ AAQIFSDPKV A+VPW+GIEQEYTL
Sbjct  122  QAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPKVTAQVPWFGIEQEYTL  181

Query  632  LQQNVKWPLGWPV  670
            +Q++V WPLGWPV
Sbjct  182  MQRDVNWPLGWPV  194



>sp|P13564.2|GLNA2_HORVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA37643.1| unnamed protein product [Hordeum vulgare]
Length=434

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 151/167 (90%), Gaps = 2/167 (1%)
 Frame = +2

Query  176  AVKSSAKFRVFALSENST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTI  349
            A ++++ F+V AL   +T  + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTI
Sbjct  43   AARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTI  102

Query  350  SKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGE  529
            SKPV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GE
Sbjct  103  SKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGE  162

Query  530  PIPTNKRYKAAQIFSDPKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            PIPTNKR+ AAQIFSDPKV ++VPW+GIEQEYTL+Q++V WPLGWPV
Sbjct  163  PIPTNKRHMAAQIFSDPKVTSQVPWFGIEQEYTLMQRDVNWPLGWPV  209



>prf||1804333B Gln synthetase
Length=430

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 167/207 (81%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+N +
Sbjct  1    MAQILAASPTCQMRVPKHSSVIAS-SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNMS  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +N  E LLNL  + Y D+IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LNSDEILLNLSDSTYKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS+P V 
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVA  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  179  AEVPWYGIEQEYTLLQKDVKWPVGWPI  205



>ref|XP_006593065.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Glycine max]
Length=198

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 163/197 (83%), Gaps = 12/197 (6%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILAPS QWQMRI+KSS  A+P+ S MWGS++ K NK+V++ SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWGSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIW-----------IGGSGIDTRSKSRTISKPVQHPSE  376
            +NR+E LLNLD+TP+TDKIIAEYIW           + G GID RSKSRTISKPV+ PS+
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWYLKLIFFFETGLRGIGIDVRSKSRTISKPVEDPSK  120

Query  377  LPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYK  556
            LP+WNYDGSSTGQA G++SEVILYPQAIFKDP+RGGNNILVI D+YTP GEPIP++ + +
Sbjct  121  LPRWNYDGSSTGQAQGDNSEVILYPQAIFKDPYRGGNNILVIYDSYTPQGEPIPSSLQTR  180

Query  557  AAQIFSDPKVVAEVPWY  607
              +IFS+PKV AEVPWY
Sbjct  181  DTEIFSNPKVQAEVPWY  197



>ref|XP_006653841.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase, chloroplastic-like 
[Oryza brachyantha]
Length=410

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = +2

Query  152  VMKPNKRVAVKSSAKFRVFALSENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTR  331
            V +P +R A     +    +      V R+EQLLN+D  PYTDKIIAEYIW+GGSGID R
Sbjct  14   VGRPEER-ARHVGVQGDGVSTESTGVVTRLEQLLNMDTKPYTDKIIAEYIWVGGSGIDLR  72

Query  332  SKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDT  511
            SKSRTISKPV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDT
Sbjct  73   SKSRTISKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDT  132

Query  512  YTPAGEPIPTNKRYKAAQIFSDPKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            YTPAGEPIPTNKR++AAQIFSDPKV ++VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  133  YTPAGEPIPTNKRHRAAQIFSDPKVASQVPWFGIEQEYTLLQRDVNWPLGWPV  185



>gb|ACG35376.1| glutamine synthetase [Zea mays]
Length=427

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  191  AKFRVFALSENST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQ  364
            A  +   LS  ST  V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+
Sbjct  41   AGVQGHGLSTGSTGVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVE  100

Query  365  HPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTN  544
             PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTN
Sbjct  101  DPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTN  160

Query  545  KRYKAAQIFSDPKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            KR++AAQIFSDPKV A+VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  161  KRHRAAQIFSDPKVAAQVPWFGIEQEYTLLQKDVNWPLGWPV  202



>prf||1804333C Gln synthetase
Length=430

 Score =   278 bits (712),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 165/207 (80%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+N +
Sbjct  1    MAQILAASPTCQMRVPKHSSVIAS-SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNMS  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +   E LLN+   P  D+IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LLADEVLLNISDNPEKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IF++P V+
Sbjct  119  GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVI  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++V WPLGWP+
Sbjct  179  AEVPWYGIEQEYTLLQKDVNWPLGWPI  205



>gb|ACG31728.1| hypothetical protein [Zea mays]
Length=382

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 144/157 (92%), Gaps = 2/157 (1%)
 Frame = +2

Query  206  FALSENST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSEL  379
             A+S  ST  V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSEL
Sbjct  1    MAVSTGSTGXVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSEL  60

Query  380  PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKA  559
            PKWNYDGSSTGQAP EDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKR++A
Sbjct  61   PKWNYDGSSTGQAPVEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRA  120

Query  560  AQIFSDPKVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AQIFSDPKV A+VPW+GIEQEYTLLQ++V WPLGWPV
Sbjct  121  AQIFSDPKVAAQVPWFGIEQEYTLLQKDVNWPLGWPV  157



>prf||1804333D Gln synthetase
Length=430

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 160/207 (77%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  229
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIAS-SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            +   E LLNL      D+IIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LLSDEVLLNLTDATGKDRIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSST  118

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQA GEDSEVILYPQAIFKDPFR GNNILV+CD YTPAG+PIPTNKR+ AA+IFS P V 
Sbjct  119  GQAAGEDSEVILYPQAIFKDPFRKGNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPDVA  178

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             E PWYGIEQEYTL+Q++V WP+GWPV
Sbjct  179  KEEPWYGIEQEYTLMQKDVNWPIGWPV  205



>gb|AHJ10961.1| chloroplast glutamine synthetase 2 isoform 1 [Lemna minor]
Length=424

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 2/206 (1%)
 Frame = +2

Query  56   AQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            AQI APS + +  IA + S   +P+     GS   +    V  +  +  R    + N+ V
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRGFS-VRAVLGNRNNAV  61

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            +R+E LLNLD+ P+T+KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDGSSTG
Sbjct  62   SRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDGSSTG  121

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILV+CD Y P GEPIPTNKRY+AAQIFSDPKVVA
Sbjct  122  QAPGEDSEVILYPQAIFKDPFRGGNNILVMCDAYKPNGEPIPTNKRYRAAQIFSDPKVVA  181

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            EVPW+GIEQEYTLLQ NV WPLGWP+
Sbjct  182  EVPWFGIEQEYTLLQPNVNWPLGWPI  207



>gb|AHJ10962.1| chloroplast glutamine synthetase 2 isoform 2 [Lemna minor]
Length=424

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 2/206 (1%)
 Frame = +2

Query  56   AQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  232
            AQI APS + +  IA + S   +P+     GS   +    V  +  +  R    + N+ V
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRGFS-VRAVLGNRNNAV  61

Query  233  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  412
            +R+E LLNLD+ P+T+KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDGSSTG
Sbjct  62   SRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDGSSTG  121

Query  413  QAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVA  592
            QAPGEDSEVILYPQAIFKDPFRGGNNILV+CD Y P GEPIPTNKRY+AAQIFSDPKVVA
Sbjct  122  QAPGEDSEVILYPQAIFKDPFRGGNNILVMCDAYKPNGEPIPTNKRYRAAQIFSDPKVVA  181

Query  593  EVPWYGIEQEYTLLQQNVKWPLGWPV  670
            EVPW+GIEQEYTLLQ NV WPLGWP+
Sbjct  182  EVPWFGIEQEYTLLQPNVNWPLGWPI  207



>gb|EYU24513.1| hypothetical protein MIMGU_mgv1a008973mg [Erythranthe guttata]
Length=356

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+K IAEYIWIGGSG+D RSK+RT S P++HPSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDTTEKTIAEYIWIGGSGMDLRSKARTFSGPIKHPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF DPFR GN+ILV+CDTYTPAGEPIPTNKRY AAQIFS+P+V AEV
Sbjct  64   PGEDSEVILYPQAIFPDPFRRGNHILVMCDTYTPAGEPIPTNKRYGAAQIFSNPEVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>gb|AAT46062.1| glutamine synthetase GS2 [Apium graveolens Dulce Group]
Length=150

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  284  IIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIF  463
             IAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDGSSTGQAPG+DSEVILYPQAIF
Sbjct  5    FIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGDDSEVILYPQAIF  64

Query  464  KDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEVPWYGIEQEYTLLQQN  643
            KDPFRGGNNILVICDTYTP GEPIPTNKR+KAAQIFSD KV+ EVPW+GIEQEYTL+QQN
Sbjct  65   KDPFRGGNNILVICDTYTPQGEPIPTNKRHKAAQIFSDAKVLGEVPWFGIEQEYTLMQQN  124

Query  644  VKWPLGWPV  670
            V WPLGWPV
Sbjct  125  VNWPLGWPV  133



>ref|XP_010492570.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X2 [Camelina sativa]
Length=272

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEV WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_010420355.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X2 [Camelina sativa]
Length=355

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEV WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   253 bits (645),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEV WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEV WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDSTEKIIAEYIWVGGSGMDIRSKGRTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAGEPIPTNKR KAA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRCKAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PW+G+EQEYTLLQ++VKWPLGWP+
Sbjct  124  PWFGLEQEYTLLQKDVKWPLGWPI  147



>gb|AHJ10960.1| cytosolic glutamine synthetase 1 isoform 2 [Lemna minor]
Length=356

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L NL++T  T+KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDGSSTGQA
Sbjct  4    LTDLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNNILV+CD YTPAGEPIPTNKRY+A+QIFSDP VVAE 
Sbjct  64   PGEDSEVILYPQAIFRDPFRKGNNILVMCDCYTPAGEPIPTNKRYRASQIFSDPAVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
             WYG+EQEYTLLQ++VKWPLGWP+
Sbjct  124  TWYGLEQEYTLLQKDVKWPLGWPL  147



>ref|XP_010419001.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like, partial 
[Camelina sativa]
Length=163

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVIL+PQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VV
Sbjct  61   GQAPGQDSEVILFPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++V WPLGWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPLGWPI  147



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GN+ILV+CDTYTPAGEPIPTNKR+ AAQIFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNHILVMCDTYTPAGEPIPTNKRHAAAQIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_010453820.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Camelina 
sativa]
Length=356

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIF+DPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFQDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEV WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPVGWPV  147



>gb|ACF42116.1| cytosolic glutamine synthetase [Brassica oleracea var. italica]
Length=356

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKR+ AAQIFS+P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>gb|KDP25795.1| hypothetical protein JCGZ_22517 [Jatropha curcas]
Length=356

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKR+ AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++KWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDIKWPIGWPI  147



>ref|XP_010435596.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X2 [Camelina sativa]
Length=276

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+C+ YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCNAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPVGWPI  147



>emb|CAA73063.1| cytosolic glutamine synthetase [Brassica napus]
 gb|ACF42115.1| cytosolic glutamine synthetase [Brassica oleracea var. botrytis]
 emb|CDY52941.1| BnaCnng23850D [Brassica napus]
Length=356

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKR+ AAQIFS+P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_009385541.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRY AA++FS P VVAE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKVFSHPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>gb|ABK93921.1| unknown [Populus trichocarpa]
Length=218

 Score =   246 bits (627),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  TDKIIAEYIWIGGSG+D RSK+RT++  V  P +LPKWNYDGSST
Sbjct  1    MSLLSDLINLDLSDTTDKIIAEYIWIGGSGMDLRSKARTLNGVVSDPHKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRY AA+IFS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEVPWYGIEQEYTLLQKDLKWPIGWPV  147



>ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus]
 gb|AEZ56958.1| glutamine synthetase [Cucumis sativus]
 gb|KGN57792.1| hypothetical protein Csa_3G304140 [Cucumis sativus]
Length=356

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNNILV+CDTYTPAGEPIPTNKR+ AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVVCDTYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPIGWPI  147



>ref|XP_010440874.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Camelina 
sativa]
Length=356

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR G+NILV+CD YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VVAE 
Sbjct  64   PGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
             WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  124  TWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_010435595.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+C+ YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCNAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=356

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDSTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AAQIFS+P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRHAAAQIFSNPAVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>gb|ACN36710.1| unknown [Zea mays]
Length=217

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GN+ILV+CD YTP GEPIPTNKRY AA++FS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNHILVMCDCYTPQGEPIPTNKRYSAAKVFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVSWPLGWPV  147



>ref|XP_009370554.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X1 
[Pyrus x bretschneideri]
Length=356

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSESTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTP GEPIPTNKR  AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPGGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>ref|XP_010470494.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=275

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VV
Sbjct  61   GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++V WPLGWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPLGWPI  147



>emb|CAA73064.1| cytosolic glutamine synthetase [Brassica napus]
Length=349

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  251  LNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGED  430
            +NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQAPGED
Sbjct  1    VNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQAPGED  60

Query  431  SEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEVPWYG  610
            SEVILYPQAIFKDPFRGGNNILV+CD YTPAGEPIPTNKR+ AA++FS P VVAEVPWYG
Sbjct  61   SEVILYPQAIFKDPFRGGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYG  120

Query  611  IEQEYTLLQQNVKWPLGWPV  670
            IEQEYTLLQ++VKWP+GWP+
Sbjct  121  IEQEYTLLQKDVKWPVGWPI  140



>ref|XP_010103463.1| Glutamine synthetase nodule isozyme [Morus notabilis]
 gb|EXB95908.1| Glutamine synthetase nodule isozyme [Morus notabilis]
Length=356

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLSDTTEKIIAEYIWIGGSGLDVRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKR+ AA+IFS P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHAAAKIFSHPDVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>ref|XP_006372556.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|ABK94934.1| unknown [Populus trichocarpa]
 gb|ABK95264.1| unknown [Populus trichocarpa]
 gb|ERP50353.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTEKIIAEYIWVGGSGMDIRSKGRTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAGEPIPTNKR KAA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRCKAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYG+EQEYTLLQ++VKWPLGWP+
Sbjct  124  PWYGLEQEYTLLQKDVKWPLGWPI  147



>gb|ACD13217.1| glutamine synthetase [Brassica rapa subsp. chinensis]
Length=356

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKR+ AAQIFS+P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPVGWPI  147



>ref|XP_010450519.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X2 [Camelina sativa]
Length=276

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S  V+ PS+LPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGSVKDPSDLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPVGWPI  147



>emb|CAA54151.1| glutamine [Brassica napus]
 gb|AAX35342.1| glutamine synthetase [Brassica rapa subsp. pekinensis]
 emb|CDY16439.1| BnaA02g12430D [Brassica napus]
Length=356

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKR+ AAQIFS+P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPVGWPI  147



>gb|AHJ10959.1| cytosolic glutamine synthetase 1 isoform 1 [Lemna minor]
Length=356

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L NL++T  T+KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDGSSTGQA
Sbjct  4    LADLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNNILV+CD YTPAGEPIPTNKRY+A+QIFS P VVAE 
Sbjct  64   PGEDSEVILYPQAIFRDPFRKGNNILVMCDCYTPAGEPIPTNKRYRASQIFSGPAVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
             WYG+EQEYTLLQ++VKWPLGWP+
Sbjct  124  TWYGLEQEYTLLQKDVKWPLGWPL  147



>ref|XP_010470493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VVAEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



>gb|AFK46766.1| unknown [Medicago truncatula]
Length=211

 Score =   244 bits (622),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ+++ WPLGWPV
Sbjct  121  AEVPWYGIEQEYTLLQKDINWPLGWPV  147



>emb|CDY01727.1| BnaC04g30250D [Brassica napus]
Length=349

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_002318305.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE96525.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TDKIIAEYIWIGGSG+D RSK+RT++  V  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDTTDKIIAEYIWIGGSGMDLRSKARTLNGVVSDPHKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRY AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++KWP+GWPV
Sbjct  124  PWYGIEQEYTLLQKDLKWPIGWPV  147



>gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis]
Length=356

 Score =   248 bits (633),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTDKIIAEYIWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P VVAE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQRDVKWPIGWPL  147



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score =   248 bits (633),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++ YT+KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDYTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP V 
Sbjct  61   GQAPGSDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVA  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE  WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEETWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_010415164.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X3 [Camelina sativa]
Length=276

 Score =   245 bits (626),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVIL+PQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VV
Sbjct  61   GQAPGQDSEVILFPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++V WPLGWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPLGWPI  147



>ref|XP_006284008.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
 gb|EOA16906.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
Length=356

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSST
Sbjct  1    MSNLSDLINLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ+ VKWP+GWP+
Sbjct  121  AEVPWYGIEQEYTLLQKEVKWPVGWPI  147



>ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
Length=356

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+K+IAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDSTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKR  AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVHWPLGWPV  147



>ref|XP_010450518.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S  V+ PS+LPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGSVKDPSDLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_009391413.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TD IIAEYIWIGGSG+D RSK+RT++ PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSNTTDNIIAEYIWIGGSGMDMRSKARTLTGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRFNAAKIFSHPAVTAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>ref|XP_009127475.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 isoform 
X2 [Brassica rapa]
Length=272

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  T+KIIAEYIW GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLTDLVNLDLSDNTEKIIAEYIWGGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKR+ AAQIFS+P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++V WP+GWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPVGWPI  147



>emb|CAA58118.1| glutamate--ammonia ligase [Brassica napus]
 emb|CDX74573.1| BnaA04g08160D [Brassica napus]
Length=356

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



>gb|ACU15915.1| unknown [Glycine max]
Length=234

 Score =   243 bits (621),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++   +K+IAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSST
Sbjct  1    MSLLSDLINLNLSDTIEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++++WPLGWPV
Sbjct  121  AEVPWYGIEQEYTLLQKDIQWPLGWPV  147



>gb|AIK03054.1| glutamine synthetase [Eichhornia crassipes]
Length=356

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+K+IAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDTTEKVIAEYIWIGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTN RY AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNNRYNAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>ref|XP_006590378.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 isoform X2 
[Glycine max]
Length=272

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  T+K+IAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSST
Sbjct  1    MSLLSDLINLNLSDTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKR+ AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++++WPLGWPV
Sbjct  121  AEVPWYGIEQEYTLLQKDIQWPLGWPV  147



>gb|AAG24873.1|AF301590_1 cytosolic glutamine synthetase GSbeta1 [Glycine max]
 gb|ACU23091.1| unknown [Glycine max]
 gb|KHN17957.1| Glutamine synthetase cytosolic isozyme 1 [Glycine soja]
Length=356

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+K+IAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++++WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDIQWPLGWPV  147



>gb|AFW90613.1| glutamine synthetase GS1 [Solanum tuberosum]
Length=256

 Score =   244 bits (623),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  236  RMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  415
             +  L+NL+++  +DKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSSDKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  416  APGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAE  595
            APGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKR+ AA+IFS+P VV E
Sbjct  63   APGEDSEVILYPQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSNPDVVVE  122

Query  596  VPWYGIEQEYTLLQQNVKWPLGWPV  670
             PWYG+EQEYTLLQ+ + WPLGWP+
Sbjct  123  EPWYGLEQEYTLLQKEINWPLGWPI  147



>ref|XP_002465624.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
 emb|CAQ86599.1| glutamine synthetase [Sorghum bicolor]
 gb|EER92622.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
Length=357

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TDKIIAEYIWIGGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR G+NILV+CD YTP GEPIPTNKRY AA++FS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGDNILVMCDCYTPQGEPIPTNKRYNAAKVFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPV  147



>sp|P38563.2|GLNA5_MAIZE RecName: Full=Glutamine synthetase root isozyme 5; AltName: Full=GS117; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
Length=357

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TDKIIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTP GEPIP+NKRYKAA +FS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNNILVMCDCYTPQGEPIPSNKRYKAATVFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDLSWPLGWPV  147



>ref|XP_010415162.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
 ref|XP_010415163.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=356

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVIL+PQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VVAEV
Sbjct  64   PGQDSEVILFPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



>ref|XP_006300523.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
 gb|EOA33421.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
Length=356

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IF++P VVAEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFNNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



>sp|P04078.1|GLNA1_MEDSA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=Glutamate--ammonia ligase [Medicago sativa]
 emb|CAA27570.1| glutamine synthetase [Medicago sativa]
 prf||1211328A synthetase,Gln
Length=356

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P VVAEV
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDINWPLGWPV  147



>ref|XP_008353857.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSGSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTP GEPIPTNKR  AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPGGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVXWPLGWPV  147



>gb|AAW21274.1| glutamine synthetase [Saccharum officinarum]
Length=357

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TDKIIAEYIWIGGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR G+NILV+CD YTP GEPIPTNKRY AA++FS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGDNILVMCDCYTPQGEPIPTNKRYNAAKVFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVSWPLGWPV  147



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  T++IIAEYIWIGGSGID RSK+RT++ PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTNQIIAEYIWIGGSGIDMRSKARTLAGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VV
Sbjct  61   GQAPGNDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPTVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE  WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEETWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_009785976.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VVAE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWP+
Sbjct  124  PWYGIEQEYTLLQRDINWPLGWPI  147



>ref|XP_010511548.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 [Camelina 
sativa]
Length=356

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IF +P VVAEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFCNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



>tpg|DAA44141.1| TPA: glutamine synthetase6 [Zea mays]
Length=363

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  NSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  400
             S +  +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    GSVMASLTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDG  63

Query  401  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDP  580
            SSTGQAPGEDSEVILYPQAIFKDPFR GN+ILV+CD YTP GEPIPTNKRY AA++FS P
Sbjct  64   SSTGQAPGEDSEVILYPQAIFKDPFRKGNHILVMCDCYTPQGEPIPTNKRYSAAKVFSHP  123

Query  581  KVVAEVPWYGIEQEYTLLQQNVKWPLGWPV  670
             V AEVPWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  DVAAEVPWYGIEQEYTLLQKDVSWPLGWPV  153



>ref|XP_009139734.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Brassica 
rapa]
Length=356

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDK+IAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKVIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPL  147



>ref|XP_002873784.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50043.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSST
Sbjct  1    MSSLADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP VV
Sbjct  61   GQAPGDDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE  WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  121  AEETWYGIEQEYTLLQKDIKWPVGWPV  147



>ref|XP_009785977.1| PREDICTED: glutamine synthetase isoform X2 [Nicotiana sylvestris]
Length=356

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VVAE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWP+
Sbjct  124  PWYGIEQEYTLLQRDINWPLGWPI  147



>ref|XP_010909363.1| PREDICTED: glutamine synthetase nodule isozyme [Elaeis guineensis]
Length=356

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRFNAAKIFSHPNVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>ref|XP_003600702.1| Glutamine synthetase [Medicago truncatula]
 gb|AES70953.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDINWPLGWPV  147



>ref|XP_009127474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 isoform 
X1 [Brassica rapa]
Length=356

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWGGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKR+ AAQIFS+P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPVGWPI  147



>ref|NP_001105297.1| glutamine synthetase root isozyme 5 [Zea mays]
 dbj|BAA03432.1| glutamine synthetase [Zea mays]
Length=357

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TD+IIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTP GEPIP+NKRYKAA +FS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNNILVMCDCYTPQGEPIPSNKRYKAATVFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDLSWPLGWPV  147



>ref|XP_008803403.1| PREDICTED: glutamine synthetase nodule isozyme-like [Phoenix 
dactylifera]
Length=356

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +E L+N++++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS LPKWNYDGSSTGQA
Sbjct  4    LEDLVNINLSDSTEKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSRLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKR+ AA+IFS P VVAE 
Sbjct  64   PGDDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRFNAAKIFSHPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V+WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVQWPLGWPV  147



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDSTDKIIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRNAAAKIFSHPGVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYG+EQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGLEQEYTLLQKDVNWPLGWPI  147



>dbj|BAA04996.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR  NNILV+CD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRANNILVMCDAYTPAGEPIPTNKRHAAAKVFSQPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_006647853.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Oryza 
brachyantha]
Length=356

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RTIS PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRY AA+IFS+P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKIFSNPDVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDINWPLGWPV  147



>gb|AFN42876.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+K+IAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDTTEKVIAEYIWIGGSGMDLRSKARTLSGPVSDPKKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVI+YPQAIFKDPFR GNNILV+CDTYTP GEPIPTNKR+ AA+IFS P VVAE 
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDTYTPGGEPIPTNKRFNAAKIFSHPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+ VKWPLGWP+
Sbjct  124  PWYGIEQEYTLLQKQVKWPLGWPL  147



>ref|XP_002888488.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64747.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  ++KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDTSEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA IFS+P VVAEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAVIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



>ref|XP_009631593.1| PREDICTED: glutamine synthetase isoform X2 [Nicotiana tomentosiformis]
Length=272

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSST
Sbjct  1    MSMLSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE PWYGIEQEYTLLQ+++ WPLGWP+
Sbjct  121  AEEPWYGIEQEYTLLQRDINWPLGWPI  147



>gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSSTG+A
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGRA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR G+NILVICD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+ V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKEVNWPLGWPL  147



>ref|NP_001105538.1| glutamine synthetase root isozyme 1 [Zea mays]
 dbj|BAA03433.1| glutamine synthetase [Zea mays]
 gb|ACF84604.1| unknown [Zea mays]
 tpg|DAA44140.1| TPA: glutamine synthetase6 [Zea mays]
Length=357

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GN+ILV+CD YTP GEPIPTNKRY AA++FS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNHILVMCDCYTPQGEPIPTNKRYSAAKVFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVSWPLGWPV  147



>sp|P12424.1|GLNA_NICPL RecName: Full=Glutamine synthetase; AltName: Full=Glutamate--ammonia 
ligase [Nicotiana plumbaginifolia]
 gb|AAA34066.1| glutamine synthetase (EC 6.3.1.2) [Nicotiana plumbaginifolia]
Length=356

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VVAE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWP+
Sbjct  124  PWYGIEQEYTLLQRDINWPLGWPI  147



>ref|XP_009800983.1| PREDICTED: glutamine synthetase-like [Nicotiana sylvestris]
Length=356

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL++T  TDKIIAEYIWIGGSG+D RSK+R++S PV+ PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLTESTDKIIAEYIWIGGSGMDLRSKARSLSGPVEDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VVAE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHHAAKIFSNPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
             WYGIEQEYTLLQ+ + WPLGWP+
Sbjct  124  TWYGIEQEYTLLQKEINWPLGWPI  147



>gb|EYU30859.1| hypothetical protein MIMGU_mgv1a008986mg [Erythranthe guttata]
Length=356

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  LLNL++T  T  IIAEYIWIGGSGID RSK+RT+  PV  PS+LP+WNYDGSSTGQA
Sbjct  4    ISDLLNLNLTDSTKSIIAEYIWIGGSGIDIRSKARTLPGPVSDPSKLPRWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAG+PIPTNKRY AA+IFS P VVAEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGDPIPTNKRYSAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWP 
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPT  147



>ref|NP_198576.1| glutamine synthetase 1;1 [Arabidopsis thaliana]
 sp|Q56WN1.2|GLN11_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-1; AltName: 
Full=Glutamate--ammonia ligase GLN1;1; Short=GLN1;1 [Arabidopsis 
thaliana]
 gb|AAL16154.1|AF428386_1 AT5g37600/K12B20_50 [Arabidopsis thaliana]
 gb|AAL31940.1|AF419608_1 AT5g37600/K12B20_50 [Arabidopsis thaliana]
 dbj|BAB08306.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL84997.1| AT5g37600/K12B20_50 [Arabidopsis thaliana]
 gb|AAN31893.1| putative glutamate-ammonia ligase [Arabidopsis thaliana]
 gb|AED94209.1| glutamine synthetase 1;1 [Arabidopsis thaliana]
Length=356

 Score =   245 bits (626),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    VSDLINLNLSDSTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS+P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>emb|CAA71317.1| glutamine synthetase [Medicago truncatula]
Length=356

 Score =   245 bits (626),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVI+YPQAIFKDPFR GNNI V+CD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNIFVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++ WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDINWPLGWPV  147



>ref|XP_009393673.1| PREDICTED: glutamine synthetase nodule isozyme [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   245 bits (626),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LP WNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTEKIIAEYIWIGGSGLDIRSKARTLPGPVSDPSKLPTWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P VVAEV
Sbjct  64   PGDDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>gb|KJB10478.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
 gb|KJB10480.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=259

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V 
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVA  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  121  AEEPWYGIEQEYTLLQKDVKWPIGWPL  147



>ref|NP_001284433.1| glutamine synthetase cytosolic isozyme [Cucumis melo]
 gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo]
Length=356

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPPKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNN LVICD YTPAGEPIPTNKR+ AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNTLVICDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPIGWPI  147



>gb|KJB10479.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=309

 Score =   243 bits (621),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPIGWPL  147



>dbj|BAH56851.1| AT1G66200 [Arabidopsis thaliana]
Length=271

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  ++KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IF++P V+
Sbjct  61   GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVI  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++V WPLGWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPLGWPI  147



>ref|XP_009338856.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST QA
Sbjct  4    VSDLINLDLSDSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTNQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAGEPIPTNKR  AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
             WYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  TWYGIEQEYTLLQKDVKWPLGWPV  147



>ref|XP_002870545.1| ATGSR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46804.1| ATGSR1 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    VSDLINLNLSDITDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|NP_001031240.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34475.1| glutamine synthetase [Arabidopsis thaliana]
Length=272

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD++  ++KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IF++P V+
Sbjct  61   GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVI  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AEVPWYGIEQEYTLLQ++V WPLGWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPLGWPI  147



>emb|CCO25538.1| glutamine synthetase [Pinus pinaster]
Length=355

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDVTEKIIAEYIWIGGSGMDIRSKARTLSHPVTDPKDLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIF+DPFR GNNILVICDTYTPAGEPIPTNKR  AA+IFS P VV E 
Sbjct  64   PGKDSEVILYPQAIFRDPFRRGNNILVICDTYTPAGEPIPTNKRANAAKIFSHPDVVVEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPV  147



>ref|XP_010551131.1| PREDICTED: glutamine synthetase nodule isozyme-like [Tarenaya 
hassleriana]
Length=357

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  TDK+IAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  5    LSDLINLDLSGSTDKLIAEYIWIGGSGMDIRSKARTLHGPVSDPSKLPKWNYDGSSTGQA  64

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
             G+DSEVILYPQAIF+DPFR GNNILV+CD YTP GEP+PTNKR+KAA+IFS P VVAE 
Sbjct  65   TGDDSEVILYPQAIFRDPFRRGNNILVMCDAYTPTGEPLPTNKRHKAAKIFSHPDVVAEE  124

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  125  PWYGIEQEYTLLQKDVKWPLGWPV  148



>ref|XP_011035558.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Populus 
euphratica]
Length=356

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT++  V  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDTTDKIIAEYIWIGGSGMDLRSKARTLTGAVSDPKKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P V AEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPDVAAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+++KWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDLKWPLGWPV  147



>ref|XP_004299511.1| PREDICTED: glutamine synthetase cytosolic isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDITDKIIAEYIWVGGSGMDVRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKR KAA+IF+ P VVAEV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRAKAAKIFNHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYG+EQEYTLLQ++V+WP+GWP+
Sbjct  124  PWYGLEQEYTLLQKDVQWPIGWPL  147



>ref|XP_008460506.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
melo]
Length=356

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL++  +TDKIIAEYIW+GGSG D RSK+RTIS P   PS+LPKWNYDGSST
Sbjct  1    MSSLSDLINLNLCDFTDKIIAEYIWVGGSGTDVRSKARTISGPTSDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIF+DPFR GNNILVICD+YTPAGE IPTNKR+ AA+IF  P VV
Sbjct  61   GQAPGQDSEVILYPQAIFRDPFRKGNNILVICDSYTPAGEAIPTNKRHGAAKIFRHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE PWYGIEQEYTLLQ++VKWPLGWP+
Sbjct  121  AEEPWYGIEQEYTLLQKDVKWPLGWPI  147



>ref|XP_009629012.1| PREDICTED: glutamine synthetase-like [Nicotiana tomentosiformis]
Length=356

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL++T  T+KIIAEYIWIGGSG+D RSK+RT+S PV+ PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLTESTEKIIAEYIWIGGSGMDLRSKARTLSGPVKDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P VVAE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHHAAKIFSKPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
             WYGIEQEYTLLQ+ V WPLGWP+
Sbjct  124  TWYGIEQEYTLLQKEVNWPLGWPI  147



>ref|XP_009631592.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana tomentosiformis]
Length=356

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSST
Sbjct  1    MSMLSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS+P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE PWYGIEQEYTLLQ+++ WPLGWP+
Sbjct  121  AEEPWYGIEQEYTLLQRDINWPLGWPI  147



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFSDP V AE 
Sbjct  64   PGSDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
             WYGIEQEYTLLQ+++KWP+GWPV
Sbjct  124  TWYGIEQEYTLLQKDIKWPVGWPV  147



>gb|ABK94916.1| unknown [Populus trichocarpa]
Length=356

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+   V  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDTTDKIIAEYIWIGGSGMDLRSKARTLDGAVSDPQKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHSAAKIFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYG+EQEYTLLQ+++KWPLGWPV
Sbjct  124  PWYGLEQEYTLLQKDLKWPLGWPV  147



>gb|KFK41041.1| hypothetical protein AALP_AA2G077900 [Arabis alpina]
Length=356

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS LP+WNYDGSSTGQA
Sbjct  4    LTDLINLDLSDSTEKIIAEYIWVGGSGLDMRSKARTLPGPVTDPSNLPRWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAG+PIPTNKR+ AA+IFS+P VVAEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGDPIPTNKRHAAAEIFSNPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPVGWPI  147



>ref|XP_010271347.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Nelumbo 
nucifera]
Length=356

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK++T+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWVGGSGMDMRSKAKTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR GNNILV+CDTYTPAGEPIPTNKR  AA+IFS P V+AE 
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVMCDTYTPAGEPIPTNKRCNAAKIFSHPDVLAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWPLGWPV
Sbjct  124  PWYGIEQEYTLLQKDVKWPLGWPV  147



>gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypium arboreum]
Length=356

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPIGWPL  147



>ref|NP_176794.1| glutamine synthetase [Arabidopsis thaliana]
 sp|Q8LCE1.2|GLN12_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-2; AltName: 
Full=Glutamate--ammonia ligase GLN1;2; Short=GLN1;2 [Arabidopsis 
thaliana]
 gb|AAG51310.1|AC026480_17 glutamine synthetase, putative [Arabidopsis thaliana]
 gb|AAM14052.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AAM67495.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34474.1| glutamine synthetase [Arabidopsis thaliana]
Length=356

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  ++KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IF++P V+AEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



>gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPIGWPL  147



>ref|XP_004162638.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  409
            ++ +  L+NLD+  +TDKIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDGSST
Sbjct  1    MSSLSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSST  60

Query  410  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVV  589
            GQAPG+DSEVILYPQAIF+DPFR GNNILVICD+YTP+GE IPTNKR+ AA+IFS P VV
Sbjct  61   GQAPGQDSEVILYPQAIFRDPFRRGNNILVICDSYTPSGEAIPTNKRHGAAKIFSHPDVV  120

Query  590  AEVPWYGIEQEYTLLQQNVKWPLGWPV  670
            AE PWYGIEQEYTLLQ++V WP+GWP+
Sbjct  121  AEEPWYGIEQEYTLLQKDVNWPIGWPI  147



>gb|ABW89463.1| glutamine synthetase [Gossypium raimondii]
 gb|KJB10477.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPIGWPL  147



>gb|AAK49029.1| cytosolic glutamine synthetase [Populus tremula x Populus alba]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL ++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSSTGQA
Sbjct  4    LTDLINLKLSDITDKIIAEYIWIGGSGMDMRSKARTLSGPVTDPAQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTP GEPIPTNKRY AA+IFS P+V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPQGEPIPTNKRYAAAKIFSSPEVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WP+GWPV
Sbjct  124  PWYGIEQEYTLLQRDVNWPIGWPV  147



>dbj|BAD99525.1| glutamine synthetase [Camellia sinensis]
 gb|AEM44626.1| theanine synthetase [Camellia sinensis]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  T+K+IAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKVIAEYIWIGGSGMDLRSKARTLSGPVSDPKKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVI+YPQAIFKDPFR GNNILV+CDTYTP GEPIPTNKR+ AA+IFS P VVAE 
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDTYTPGGEPIPTNKRFNAAKIFSHPDVVAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+ VKWPLGWP+
Sbjct  124  PWYGIEQEYTLLQKQVKWPLGWPL  147



>gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum]
 gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V AE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEE  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++VKWP+GWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPIGWPL  147



>sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PGEDSEVILYPQAIF+DPFR G+NILVICD YTPAGEPIPTNKR+ AA++FS P VVAEV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ+ V WP+GWP+
Sbjct  124  PWYGIEQEYTLLQKEVNWPVGWPI  147



>gb|AAM63710.1| glutamine synthetase, putative [Arabidopsis thaliana]
Length=356

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  239  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  418
            +  L+NLD++  ++KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  419  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQIFSDPKVVAEV  598
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IF++P V+AEV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEV  123

Query  599  PWYGIEQEYTLLQQNVKWPLGWPV  670
            PWYGIEQEYTLLQ++V WPLGWP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPLGWPI  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350