BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048E24

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              328   1e-109   Allium cepa
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     334   3e-109   Nicotiana tabacum [American tobacco]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       333   3e-109   Nicotiana benthamiana
ref|NP_001289538.1|  adenosylhomocysteinase                             332   1e-108   Nicotiana sylvestris
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             331   2e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  331   2e-108   Nelumbo nucifera [Indian lotus]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  330   1e-107   Solanum lycopersicum
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             330   1e-107   Nicotiana sylvestris
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               329   2e-107   Capsicum annuum
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    328   3e-107   Catharanthus roseus [chatas]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                328   3e-107   Erythranthe guttata [common monkey flower]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                331   4e-107   Erythranthe guttata [common monkey flower]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    328   4e-107   
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  328   4e-107   Vitis vinifera
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      328   6e-107   Petunia x hybrida [garden petunia]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             328   6e-107   Nicotiana tomentosiformis
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     327   9e-107   Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       327   9e-107   Gentiana triflora
emb|CDP11183.1|  unnamed protein product                                327   1e-106   Coffea canephora [robusta coffee]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                327   1e-106   Solanum tuberosum [potatoes]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  327   2e-106   Sesamum indicum [beniseed]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  326   2e-106   Malus domestica [apple tree]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  326   3e-106   Pyrus x bretschneideri [bai li]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             325   5e-106   Solanum lycopersicum
ref|NP_001078387.1|  adenosylhomocysteinase 1                           320   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                325   7e-106   Eucalyptus grandis [rose gum]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             325   7e-106   Solanum tuberosum [potatoes]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                327   8e-106   Erythranthe guttata [common monkey flower]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             325   1e-105   Pyrus x bretschneideri [bai li]
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     324   1e-105   Nicotiana tabacum [American tobacco]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    324   1e-105   Petroselinum crispum
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   324   1e-105   Ricinus communis
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             324   2e-105   
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                324   2e-105   Cucumis melo [Oriental melon]
gb|AEI54335.1|  adenosylhomocysteinase                                  324   2e-105   Glycine max [soybeans]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             324   2e-105   Glycine max [soybeans]
ref|XP_010097949.1|  hypothetical protein L484_026840                   324   2e-105   Morus notabilis
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             323   3e-105   
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                323   3e-105   Brassica rapa
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    323   3e-105   Arabis alpina [alpine rockcress]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    323   3e-105   Mesembryanthemum crystallinum
emb|CDY01177.1|  BnaA04g06420D                                          323   3e-105   
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             323   3e-105   Capsella rubella
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             323   3e-105   Vitis vinifera
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            323   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                324   3e-105   
ref|NP_193130.1|  adenosylhomocysteinase 1                              323   3e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            323   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             323   3e-105   Arabidopsis lyrata subsp. lyrata
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     323   3e-105   Eucalyptus grandis [rose gum]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            323   4e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      322   4e-105   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|AAM62888.1|  adenosylhomocysteinase                                  323   5e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     323   6e-105   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     323   6e-105   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     323   6e-105   Populus tomentosa [Chinese white poplar]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  323   6e-105   Eucalyptus grandis [rose gum]
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   321   6e-105   Citrus sinensis [apfelsine]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     322   7e-105   Populus tomentosa [Chinese white poplar]
gb|KJB37872.1|  hypothetical protein B456_006G223900                    321   7e-105   Gossypium raimondii
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     322   7e-105   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     322   7e-105   Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     322   7e-105   Populus tomentosa [Chinese white poplar]
ref|XP_003629610.1|  Adenosylhomocysteinase                             322   7e-105   Medicago truncatula
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           322   7e-105   Brassica rapa
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     322   8e-105   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     322   8e-105   Populus tomentosa [Chinese white poplar]
gb|KHG17040.1|  Adenosylhomocysteinase                                  322   8e-105   Gossypium arboreum [tree cotton]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     322   8e-105   Populus tomentosa [Chinese white poplar]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                322   9e-105   Tarenaya hassleriana [spider flower]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     322   9e-105   Populus tomentosa [Chinese white poplar]
emb|CDY47309.1|  BnaAnng08830D                                          322   9e-105   Brassica napus [oilseed rape]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  322   9e-105   Malus domestica [apple tree]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                322   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             322   1e-104   Phaseolus vulgaris [French bean]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    322   1e-104   Gossypium raimondii
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             322   1e-104   Sesamum indicum [beniseed]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         322   1e-104   Jatropha curcas
gb|KJB72028.1|  hypothetical protein B456_011G154000                    322   1e-104   Gossypium raimondii
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             322   1e-104   Populus euphratica
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             322   1e-104   Sesamum indicum [beniseed]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  322   1e-104   
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   322   2e-104   Citrus sinensis [apfelsine]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             322   2e-104   Citrus sinensis [apfelsine]
emb|CDX85127.1|  BnaC07g07790D                                          321   2e-104   
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    324   2e-104   Linum usitatissimum
emb|CDY50423.1|  BnaCnng19320D                                          322   2e-104   Brassica napus [oilseed rape]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       322   2e-104   Prunus mume [ume]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  322   2e-104   Populus euphratica
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             322   2e-104   
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     322   2e-104   Eucalyptus grandis [rose gum]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             321   2e-104   Prunus persica
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             324   2e-104   
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
emb|CDY58805.1|  BnaC08g46780D                                          321   2e-104   Brassica napus [oilseed rape]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     321   2e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     321   3e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     321   3e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     321   3e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     321   3e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     321   3e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     321   3e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     321   3e-104   Populus tomentosa [Chinese white poplar]
gb|AGV54286.1|  adenosylhomocysteinase                                  321   3e-104   Phaseolus vulgaris [French bean]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           320   3e-104   Brassica rapa
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     321   4e-104   Phaseolus vulgaris [French bean]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   320   4e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   320   4e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     320   4e-104   Populus tomentosa [Chinese white poplar]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    320   4e-104   Phalaenopsis sp.
ref|NP_001234012.1|  adenosylhomocysteinase                             320   4e-104   
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   320   4e-104   Populus tomentosa [Chinese white poplar]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             320   4e-104   Citrus clementina [clementine]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   320   4e-104   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     320   4e-104   Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     320   4e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   320   4e-104   Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              320   4e-104   Populus trichocarpa [western balsam poplar]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     320   4e-104   Cucumis sativus [cucumbers]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   320   4e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              320   5e-104   Populus tomentosa [Chinese white poplar]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             320   5e-104   Phoenix dactylifera
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        320   5e-104   Trifolium pratense [peavine clover]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   320   5e-104   Populus tomentosa [Chinese white poplar]
dbj|BAH19670.1|  AT4G13940                                              315   5e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       320   5e-104   Nicotiana suaveolens
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           320   5e-104   Tarenaya hassleriana [spider flower]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             320   6e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      320   6e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   320   6e-104   Populus tomentosa [Chinese white poplar]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    320   6e-104   Arabis alpina [alpine rockcress]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   320   7e-104   Populus tomentosa [Chinese white poplar]
emb|CDX77483.1|  BnaA07g06210D                                          319   7e-104   
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     320   8e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   320   8e-104   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   320   8e-104   Populus tomentosa [Chinese white poplar]
gb|ABK25129.1|  unknown                                                 320   9e-104   Picea sitchensis
gb|ABK24229.1|  unknown                                                 320   9e-104   Picea sitchensis
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       322   1e-103   
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               320   1e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  319   1e-103   Nelumbo nucifera [Indian lotus]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     319   1e-103   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   319   1e-103   Populus tomentosa [Chinese white poplar]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  319   1e-103   Gossypium arboreum [tree cotton]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    319   1e-103   Gossypium raimondii
gb|AFW60834.1|  adenosyl homocysteine hydrolase1                        311   1e-103   
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             319   1e-103   Cicer arietinum [garbanzo]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     319   1e-103   Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   319   2e-103   Populus tomentosa [Chinese white poplar]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             319   2e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   319   2e-103   Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     318   2e-103   Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   318   2e-103   Populus tomentosa [Chinese white poplar]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                318   2e-103   Brassica rapa
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     318   3e-103   Populus tomentosa [Chinese white poplar]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             318   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006373090.1|  adenosylhomocysteinase family protein              318   3e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             318   3e-103   Elaeis guineensis
ref|NP_189023.1|  adenosylhomocysteinase 2                              318   3e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   318   3e-103   Populus tomentosa [Chinese white poplar]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          318   3e-103   Amborella trichopoda
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     318   4e-103   Populus tomentosa [Chinese white poplar]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        318   4e-103   Kalanchoe daigremontiana
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   318   4e-103   Populus tomentosa [Chinese white poplar]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  318   4e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   318   5e-103   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   318   6e-103   Populus tomentosa [Chinese white poplar]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  317   6e-103   Phoenix dactylifera
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   317   7e-103   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   317   7e-103   Populus tomentosa [Chinese white poplar]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             317   7e-103   Eutrema salsugineum [saltwater cress]
gb|KJB28098.1|  hypothetical protein B456_005G027700                    317   7e-103   Gossypium raimondii
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             317   9e-103   Setaria italica
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     317   1e-102   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   317   1e-102   Populus tomentosa [Chinese white poplar]
emb|CDP15078.1|  unnamed protein product                                317   1e-102   Coffea canephora [robusta coffee]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             317   1e-102   Setaria italica
gb|AGT16642.1|  Adenosylhomocysteinase                                  317   1e-102   Saccharum hybrid cultivar R570
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    317   1e-102   Medicago sativa [alfalfa]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   317   2e-102   Populus tomentosa [Chinese white poplar]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       317   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             316   2e-102   Phoenix dactylifera
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        316   2e-102   
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   316   2e-102   Populus tomentosa [Chinese white poplar]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  316   2e-102   Fragaria vesca subsp. vesca
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             316   2e-102   Selaginella moellendorffii
emb|CDY53211.1|  BnaC03g74050D                                          316   2e-102   Brassica napus [oilseed rape]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   316   3e-102   Populus tomentosa [Chinese white poplar]
gb|EMT01272.1|  Adenosylhomocysteinase                                  316   3e-102   
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       316   3e-102   Gentiana triflora
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    316   3e-102   Lupinus luteus
gb|ABR17322.1|  unknown                                                 315   3e-102   Picea sitchensis
gb|ABR16547.1|  unknown                                                 315   4e-102   Picea sitchensis
gb|ACN40278.1|  unknown                                                 315   4e-102   Picea sitchensis
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    315   4e-102   Lupinus luteus
gb|ABR16573.1|  unknown                                                 315   4e-102   Picea sitchensis
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    315   4e-102   Pinus pinaster [cluster pine]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   315   4e-102   Populus tomentosa [Chinese white poplar]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      315   7e-102   Gossypium hirsutum [American cotton]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     315   8e-102   Populus tomentosa [Chinese white poplar]
ref|NP_001148534.1|  adenosylhomocysteinase                             315   9e-102   
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     314   1e-101   Populus tomentosa [Chinese white poplar]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           314   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             314   1e-101   Glycine max [soybeans]
gb|ABR16138.1|  unknown                                                 314   1e-101   Picea sitchensis
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    314   1e-101   Camelina sativa [gold-of-pleasure]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        314   2e-101   Cicer arietinum [garbanzo]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                313   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             313   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    313   2e-101   
gb|ACN34730.1|  unknown                                                 313   3e-101   Zea mays [maize]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    313   3e-101   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003601687.1|  Adenosylhomocysteinase                             313   3e-101   Medicago truncatula
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  313   4e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             313   4e-101   Oryza brachyantha
ref|XP_001755906.1|  predicted protein                                  312   5e-101   
emb|CDY50106.1|  BnaC01g43540D                                          313   7e-101   Brassica napus [oilseed rape]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    312   7e-101   Arabis alpina [alpine rockcress]
ref|XP_001755926.1|  predicted protein                                  312   7e-101   
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                312   9e-101   Brassica rapa
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             312   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS72602.1|  adenosylhomocysteinase                                  314   2e-100   Genlisea aurea
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             311   2e-100   Elaeis guineensis
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             310   4e-100   Cucumis melo [Oriental melon]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             309   1e-99    Phaseolus vulgaris [French bean]
ref|XP_001755929.1|  predicted protein                                  308   2e-99    
gb|AAL33588.1|  S-adenosyl-L-homocysteine hydrolase                     299   5e-99    Zea mays [maize]
gb|AFY99087.1|  S-adenosyl-l-homocysteine hydrolase                     295   5e-98    Campanula persicifolia [peach-bells]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             305   7e-98    Cucumis sativus [cucumbers]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    304   1e-97    
gb|AFY99082.1|  S-adenosyl-l-homocysteine hydrolase                     294   2e-97    Clermontia kakeana
gb|KJB19538.1|  hypothetical protein B456_003G108500                    303   3e-97    Gossypium raimondii
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                301   1e-96    
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  301   1e-96    Gossypium arboreum [tree cotton]
ref|NP_001067845.2|  Os11g0455500                                       301   2e-96    
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    296   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756025.1|  predicted protein                                  285   7e-94    
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     289   4e-92    Eucalyptus grandis [rose gum]
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                      282   4e-92    Chlamydomonas incerta
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                287   3e-91    Chlorella variabilis
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  287   3e-91    Chlamydomonas reinhardtii
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       287   4e-91    Chlamydomonas sp. ICE-L
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              285   4e-90    Volvox carteri f. nagariensis
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     282   2e-89    Eucalyptus grandis [rose gum]
gb|ABR16332.1|  unknown                                                 283   2e-89    Picea sitchensis
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  281   7e-89    Coccomyxa subellipsoidea C-169
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       280   2e-88    Dunaliella salina
ref|XP_011397211.1|  Adenosylhomocysteinase                             281   5e-88    Auxenochlorella protothecoides
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     279   7e-88    Helicosporidium sp. ATCC 50920
gb|AFY99086.1|  S-adenosyl-l-homocysteine hydrolase                     267   3e-87    Lobelia erinus
dbj|BAA03710.1|  cytokinin binding protein CBP57                        276   3e-87    Nicotiana sylvestris
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      274   4e-86    Polytomella sp. Pringsheim 198.80
gb|KIZ05177.1|  adenosylhomocysteinase                                  285   5e-86    Monoraphidium neglectum
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     272   2e-85    Eucalyptus grandis [rose gum]
gb|KJB72029.1|  hypothetical protein B456_011G154000                    271   3e-85    Gossypium raimondii
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    270   2e-84    Ostreococcus tauri
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     268   4e-84    Eucalyptus grandis [rose gum]
ref|XP_001419579.1|  predicted protein                                  267   2e-83    Ostreococcus lucimarinus CCE9901
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             263   5e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    265   1e-82    Eucalyptus grandis [rose gum]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             264   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005708566.1|  adenosylhomocysteinase                             265   2e-82    Galdieria sulphuraria
gb|ABR16616.1|  unknown                                                 263   5e-82    Picea sitchensis
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    261   3e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003057172.1|  adenosylhomocysteinase                             256   6e-79    
ref|XP_002505983.1|  adenosylhomocysteinase                             255   9e-79    
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                254   4e-78    
ref|XP_002177758.1|  adenosylhomocysteinase                             253   9e-78    
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   251   2e-77    
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   251   3e-77    
gb|EPT27008.1|  adenosylhomocysteinase, putative                        252   2e-76    
gb|KFG55060.1|  putative adenosylhomocysteinase                         252   2e-76    
gb|KFH13893.1|  putative adenosylhomocysteinase                         252   2e-76    
gb|EPR62066.1|  putative adenosylhomocysteinase                         252   2e-76    
gb|ESS32583.1|  putative adenosylhomocysteinase                         251   2e-76    
gb|KFG42936.1|  putative adenosylhomocysteinase                         251   3e-76    
ref|XP_008611237.1|  adenosylhomocysteinase                             249   3e-76    
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  247   1e-75    
ref|XP_002776364.1|  adenosylhomocysteinase, putative                   239   1e-75    
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             245   4e-75    
ref|XP_008893590.1|  adenosylhomocysteinase                             244   2e-74    
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             243   3e-74    
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                243   4e-74    
ref|XP_008872075.1|  adenosylhomocysteinase 2                           243   5e-74    
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              243   5e-74    
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                243   3e-73    
ref|XP_002788757.1|  conserved hypothetical protein                     241   4e-73    
ref|XP_009493630.1|  adenosylhomocysteinase 1                           240   6e-73    
ref|XP_009833581.1|  adenosylhomocysteinase 2                           239   1e-72    
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                       241   2e-72    
gb|EJK60373.1|  hypothetical protein THAOC_19286                        229   2e-72    
emb|CCA20123.1|  unnamed protein product                                237   9e-72    
ref|XP_002765933.1|  conserved hypothetical protein                     236   1e-71    
ref|XP_002902721.1|  adenosylhomocysteinase                             236   2e-71    
ref|WP_037787267.1|  hypothetical protein                               228   6e-71    
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              235   7e-71    
ref|XP_005786995.1|  S-adenosyl-L-homocysteine hydrolase                233   2e-70    
ref|WP_030724358.1|  adenosylhomocysteinase                             226   3e-70    
emb|CDI83949.1|  adenosylhomocysteinase, putative                       225   7e-70    
emb|CCI50303.1|  unnamed protein product                                231   1e-69    
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 230   4e-69    
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 229   8e-69    
ref|WP_005221374.1|  S-adenosyl-L-homocysteine hydrolase                229   8e-69    
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                229   9e-69    
ref|WP_031077053.1|  hypothetical protein                               229   1e-68    
gb|ACJ13434.1|  adenosylhomocysteinase                                  221   2e-68    
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase                228   2e-68    
ref|WP_042432571.1|  adenosylhomocysteinase                             228   2e-68    
ref|WP_030310801.1|  hypothetical protein                               228   3e-68    
ref|WP_033354750.1|  hypothetical protein                               228   3e-68    
ref|WP_030398087.1|  MULTISPECIES: hypothetical protein                 227   4e-68    
ref|WP_028061676.1|  hypothetical protein                               227   4e-68    
ref|WP_030245490.1|  hypothetical protein                               227   5e-68    
ref|WP_029018156.1|  hypothetical protein                               227   5e-68    
ref|WP_035863223.1|  S-adenosyl-L-homocysteine hydrolase                227   6e-68    
ref|WP_043914237.1|  S-adenosyl-L-homocysteine hydrolase                227   7e-68    
ref|XP_001423621.1|  hypothetical protein                               226   1e-67    
ref|WP_028072996.1|  hypothetical protein                               221   1e-67    
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                226   2e-67    
ref|WP_030634444.1|  adenosylhomocysteinase                             218   2e-67    
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                226   2e-67    
ref|WP_035848617.1|  hypothetical protein                               226   2e-67    
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                225   3e-67    
ref|WP_030634534.1|  adenosylhomocysteinase                             217   3e-67    
ref|WP_017613514.1|  S-adenosyl-L-homocysteine hydrolase                225   4e-67    
ref|WP_015281066.1|  adenosylhomocysteinase                             224   5e-67    
ref|WP_017595102.1|  S-adenosyl-L-homocysteine hydrolase                224   5e-67    
ref|WP_037796630.1|  adenosylhomocysteinase                             224   7e-67    
ref|WP_033255593.1|  S-adenosyl-L-homocysteine hydrolase                224   7e-67    
ref|WP_028062632.1|  hypothetical protein                               224   7e-67    
ref|WP_014911909.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    224   8e-67    
ref|WP_030920540.1|  S-adenosyl-L-homocysteine hydrolase                224   9e-67    
ref|WP_030119663.1|  adenosylhomocysteinase                             217   9e-67    
ref|WP_009148000.1|  S-adenosyl-L-homocysteine hydrolase                224   9e-67    
ref|WP_030461911.1|  S-adenosyl-L-homocysteine hydrolase                224   9e-67    
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                224   1e-66    
ref|WP_007192127.1|  S-adenosyl-L-homocysteine hydrolase                223   1e-66    
gb|EDY66712.2|  adenosylhomocysteinase                                  223   1e-66    
gb|ADE22275.1|  putative adenosylhomocysteinase                         223   1e-66    
ref|WP_037775629.1|  adenosylhomocysteinase                             223   1e-66    
ref|WP_020252885.1|  hypothetical protein                               223   1e-66    
ref|WP_014136057.1|  S-adenosyl-L-homocysteine hydrolase                223   1e-66    
ref|WP_030759761.1|  adenosylhomocysteinase                             217   1e-66    
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    223   2e-66    
ref|WP_017604622.1|  S-adenosyl-L-homocysteine hydrolase                223   2e-66    
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      223   2e-66    
ref|WP_017542451.1|  S-adenosyl-L-homocysteine hydrolase                223   2e-66    
ref|WP_035801129.1|  hypothetical protein                               223   2e-66    
ref|WP_030264019.1|  hypothetical protein                               223   2e-66    
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    223   2e-66    
ref|WP_034088535.1|  hypothetical protein                               223   2e-66    
ref|WP_017583238.1|  S-adenosyl-L-homocysteine hydrolase                223   2e-66    
ref|WP_028648434.1|  S-adenosyl-L-homocysteine hydrolase                223   3e-66    
ref|WP_020389898.1|  S-adenosyl-L-homocysteine hydrolase                223   3e-66    
ref|WP_037575816.1|  hypothetical protein                               223   3e-66    
ref|WP_033824956.1|  hypothetical protein                               222   5e-66    
ref|WP_031147523.1|  adenosylhomocysteinase                             215   6e-66    
ref|WP_037840693.1|  adenosylhomocysteinase                             215   6e-66    
ref|WP_030221563.1|  adenosylhomocysteinase                             221   6e-66    
ref|WP_042410976.1|  hypothetical protein                               221   7e-66    
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                222   7e-66    
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                221   8e-66    
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                221   8e-66    
ref|WP_037837039.1|  adenosylhomocysteinase                             214   8e-66    
ref|WP_031943710.1|  S-adenosyl-L-homocysteine hydrolase                221   8e-66    
ref|WP_030716579.1|  adenosylhomocysteinase                             214   9e-66    
ref|WP_042802104.1|  adenosylhomocysteinase                             221   1e-65    
ref|WP_030122306.1|  adenosylhomocysteinase                             214   1e-65    
ref|WP_014779838.1|  S-adenosyl-L-homocysteine hydrolase                221   1e-65    
gb|EFL18396.1|  adenosylhomocysteinase                                  221   1e-65    
ref|WP_017585142.1|  S-adenosyl-L-homocysteine hydrolase                221   2e-65    
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                221   2e-65    
ref|WP_017608316.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-65    
ref|WP_017625947.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-65    
ref|WP_017570953.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-65    
ref|WP_030979035.1|  adenosylhomocysteinase                             213   3e-65    
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                220   3e-65    
ref|WP_042456565.1|  hypothetical protein                               219   4e-65    
ref|WP_043962062.1|  adenosylhomocysteinase                             220   4e-65    
ref|WP_037605447.1|  hypothetical protein                               219   5e-65    
ref|WP_007041769.1|  S-adenosyl-L-homocysteine hydrolase                219   5e-65    
ref|WP_031147752.1|  adenosylhomocysteinase                             212   5e-65    
ref|WP_030231660.1|  adenosylhomocysteinase                             213   6e-65    
ref|WP_009717416.1|  S-adenosyl-L-homocysteine hydrolase                219   6e-65    
ref|XP_002784976.1|  adenosylhomocysteinase, putative                   209   6e-65    
ref|WP_030723207.1|  adenosylhomocysteinase                             219   7e-65    
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                219   7e-65    
ref|WP_028810729.1|  adenosylhomocysteinase                             219   7e-65    
ref|WP_007074914.1|  S-adenosyl-L-homocysteine hydrolase                219   8e-65    
ref|WP_030802969.1|  MULTISPECIES: adenosylhomocysteinase               219   8e-65    
ref|WP_018846770.1|  S-adenosyl-L-homocysteine hydrolase                219   8e-65    
ref|WP_017575237.1|  S-adenosyl-L-homocysteine hydrolase                219   8e-65    
ref|WP_042387828.1|  hypothetical protein                               219   8e-65    
ref|WP_031063941.1|  adenosylhomocysteinase                             211   9e-65    
gb|EJY87176.1|  Adenosylhomocysteinase                                  219   9e-65    
ref|WP_006134655.1|  S-adenosyl-L-homocysteine hydrolase                211   9e-65    
ref|WP_017596835.1|  S-adenosyl-L-homocysteine hydrolase                219   1e-64    
ref|WP_016910634.1|  S-adenosyl-L-homocysteine hydrolase                219   1e-64    
ref|WP_030543976.1|  adenosylhomocysteinase                             219   1e-64    
ref|WP_037910293.1|  adenosylhomocysteinase                             219   1e-64    
ref|WP_033342518.1|  hypothetical protein                               218   1e-64    
ref|WP_019546896.1|  S-adenosyl-L-homocysteine hydrolase                219   1e-64    
ref|WP_031509769.1|  adenosylhomocysteinase                             219   1e-64    
ref|WP_024494417.1|  adenosylhomocysteinase                             214   1e-64    
ref|WP_018386384.1|  S-adenosyl-L-homocysteine hydrolase                219   1e-64    
ref|WP_030390893.1|  adenosylhomocysteinase                             216   1e-64    
ref|WP_027734715.1|  adenosylhomocysteinase                             218   1e-64    
ref|WP_017945881.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    218   1e-64    
ref|WP_017564266.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-64    
ref|WP_030998790.1|  adenosylhomocysteinase                             218   1e-64    
ref|WP_020506665.1|  S-adenosyl-L-homocysteine hydrolase                218   2e-64    
gb|EKD42945.1|  hypothetical protein ACD_72C00527G0002                  218   2e-64    
ref|WP_030891029.1|  adenosylhomocysteinase                             218   2e-64    
ref|WP_030276178.1|  hypothetical protein                               218   2e-64    
ref|WP_017538521.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    218   2e-64    
ref|WP_043752821.1|  adenosylhomocysteinase                             218   2e-64    
ref|WP_008746056.1|  S-adenosyl-L-homocysteine hydrolase                218   2e-64    
ref|WP_027357796.1|  adenosylhomocysteinase                             218   2e-64    
ref|WP_007822968.1|  S-adenosyl-L-homocysteine hydrolase                218   2e-64    
ref|WP_014155919.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    218   2e-64    
ref|WP_009068214.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    218   2e-64    
ref|WP_032787207.1|  adenosylhomocysteinase                             218   2e-64    
ref|WP_028072995.1|  hypothetical protein                               213   2e-64    
ref|WP_030735559.1|  adenosylhomocysteinase                             218   2e-64    
ref|WP_030350966.1|  adenosylhomocysteinase                             218   3e-64    
ref|WP_007460887.1|  S-adenosyl-L-homocysteine hydrolase                218   3e-64    
ref|WP_031015775.1|  adenosylhomocysteinase                             214   3e-64    
ref|WP_030365247.1|  adenosylhomocysteinase                             218   3e-64    
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase               218   3e-64    
gb|KIZ22480.1|  adenosylhomocysteinase                                  218   3e-64    
ref|WP_032784234.1|  adenosylhomocysteinase                             217   3e-64    
ref|WP_032769603.1|  adenosylhomocysteinase                             217   3e-64    
ref|WP_030595575.1|  adenosylhomocysteinase                             217   3e-64    
ref|WP_003968738.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    217   3e-64    
ref|WP_031126383.1|  adenosylhomocysteinase                             217   3e-64    
ref|WP_006125011.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    217   4e-64    
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                217   4e-64    
ref|WP_010059945.1|  S-adenosyl-L-homocysteine hydrolase                217   4e-64    
ref|WP_015608928.1|  MULTISPECIES: SAHH Adenosylhomocysteinase          217   4e-64    
ref|WP_030593735.1|  adenosylhomocysteinase                             217   4e-64    
ref|WP_018961954.1|  S-adenosyl-L-homocysteine hydrolase                217   4e-64    
ref|WP_020963739.1|  hypothetical protein                               208   4e-64    
ref|WP_030337328.1|  adenosylhomocysteinase                             217   4e-64    
ref|WP_030199703.1|  MULTISPECIES: adenosylhomocysteinase               217   4e-64    
ref|WP_028417695.1|  adenosylhomocysteinase                             217   5e-64    
ref|WP_018492922.1|  S-adenosyl-L-homocysteine hydrolase                217   5e-64    
ref|WP_030265792.1|  adenosylhomocysteinase                             209   5e-64    
ref|WP_030742429.1|  adenosylhomocysteinase                             217   5e-64    
ref|WP_019763336.1|  S-adenosyl-L-homocysteine hydrolase                217   5e-64    
ref|WP_030010948.1|  adenosylhomocysteinase                             216   6e-64    
ref|WP_029384937.1|  MULTISPECIES: adenosylhomocysteinase               217   6e-64    
ref|WP_030977071.1|  adenosylhomocysteinase                             217   6e-64    
ref|WP_019435388.1|  S-adenosyl-L-homocysteine hydrolase                216   6e-64    
ref|WP_031093876.1|  adenosylhomocysteinase                             216   7e-64    
ref|WP_019608106.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-64    
ref|WP_030927023.1|  adenosylhomocysteinase                             216   7e-64    
ref|WP_023417428.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-64    
ref|WP_030855068.1|  adenosylhomocysteinase                             216   7e-64    
ref|WP_013154760.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-64    
ref|WP_030724754.1|  adenosylhomocysteinase                             216   8e-64    
ref|WP_030700076.1|  adenosylhomocysteinase                             216   8e-64    
ref|WP_043501387.1|  adenosylhomocysteinase                             216   8e-64    
ref|WP_030497957.1|  adenosylhomocysteinase                             214   8e-64    
ref|WP_018515534.1|  S-adenosyl-L-homocysteine hydrolase                216   9e-64    
ref|WP_030763676.1|  MULTISPECIES: adenosylhomocysteinase               216   9e-64    
ref|WP_018552942.1|  S-adenosyl-L-homocysteine hydrolase                214   9e-64    
ref|WP_030568825.1|  adenosylhomocysteinase                             216   9e-64    
ref|WP_044347377.1|  adenosylhomocysteinase                             216   9e-64    
ref|WP_030266050.1|  adenosylhomocysteinase                             209   9e-64    
ref|WP_028429456.1|  adenosylhomocysteinase                             216   1e-63    
ref|WP_023421854.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    216   1e-63    
ref|WP_039960509.1|  adenosylhomocysteinase                             211   1e-63    
ref|WP_030082756.1|  adenosylhomocysteinase                             209   1e-63    
ref|WP_010527565.1|  S-adenosyl-L-homocysteine hydrolase                215   1e-63    
ref|WP_030694652.1|  adenosylhomocysteinase                             213   1e-63    
gb|ACJ22539.1|  S-adenosylhomocysteinase                                208   1e-63    
gb|AJD20014.1|  S-adenosyl-L-homocysteine hy-drolase                    216   2e-63    
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase                216   2e-63    
ref|WP_017618754.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-63    
ref|WP_038284612.1|  hypothetical protein                               215   2e-63    
ref|WP_030326708.1|  adenosylhomocysteinase                             214   2e-63    
ref|WP_040623224.1|  adenosylhomocysteinase                             209   2e-63    
ref|WP_031065684.1|  adenosylhomocysteinase                             209   2e-63    
ref|WP_014061185.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-63    
ref|WP_014440987.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-63    



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   328 bits (842),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEV+MPGLMACR EFGPSQPFKGARITGSL MT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGPSQPFKGARITGSLLMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDPSSTDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTLPDPSSTDNAEFQIVLTII  181



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTII  181



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTII  181



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTII  181



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTII  181



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTII  181



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDPSSTDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPSSTDNVEFQLVLTII  181



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQLVLTII  181



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDPSSTDN EFQ+VL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPSSTDNVEFQLVLGII  181



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQ+HAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDPSSTDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTII  181



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDPSSTDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPSSTDNAEFQIVLTII  181



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  94   VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  153

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  154  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  213

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ KNGTVPDP+STDNAEFQIVLTII
Sbjct  214  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKNGTVPDPNSTDNAEFQIVLTII  270



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTII  181



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGP QPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPQQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTII  181



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   328 bits (840),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+GTVPDP+STDN EFQ+VL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKDGTVPDPTSTDNVEFQLVLGII  181



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   328 bits (840),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTII  181



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   327 bits (839),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            TVEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+G +PDP+STDNAEFQIVL+II
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGKLPDPTSTDNAEFQIVLSII  181



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   327 bits (839),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDPSSTDNAEFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFKKSGKLPDPSSTDNAEFQLVLTII  181



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CRAEFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPTQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGKLPDPASTDNAEFQIVLTII  181



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTII  181



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDPSSTDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTII  181



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK+SSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTII  181



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK+SSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTII  181



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPNSTDNVEFQLVLTII  181



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   320 bits (820),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+ GREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAE+GP+QPFKGARITGSLHMT
Sbjct  5    VEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGPAQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVLTII  181



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPHSTDNVEFQLVLTII  181



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   327 bits (838),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDM+ ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  67   VEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  126

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  127  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  186

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDPSSTDNAEFQIVLTII
Sbjct  187  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPSSTDNAEFQIVLTII  243



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK+SSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTII  181



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  97   KTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ  276
            KT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQ
Sbjct  1    KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQ  60

Query  277  TAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERALD  456
            TAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERALD
Sbjct  61   TAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALD  120

Query  457  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTII
Sbjct  121  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTII  175



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVF WKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL+II
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSII  181



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPTSTDNAEFQIVLTII  181



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTII  181



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTII  181



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTII  181



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTII  181



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTII  181



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTII  181



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSII  181



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDP+STDN EFQ+VL +I
Sbjct  125  LDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLI  181



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGP QPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPQQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY ++G +PDP+STDNAEFQIVL II
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYERSGKLPDPASTDNAEFQIVLGII  181



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTII  181



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+ GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTII  181



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+ GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTII  181



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK++SGRE+KVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTII  181



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTII  181



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            TVEKT +GREYKV+D+S ADFGRLE+ELAE+EMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDNAEFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNAEFQLVLTII  181



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSII  181



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTII
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTII  181



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQII  181



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK+SSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPLKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTII  181



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQII  181



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKD+S ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVLTII  181



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTII
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTII  181



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTII  181



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKT+ GREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAE+GPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGPSQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQLPDPSSTDNAEFQIVLTII  181



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTII
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTII  181



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTII  181



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP+STDNAEFQIVL +I
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPASTDNAEFQIVLGLI  181



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK++SGRE+KVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTII  181



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK++SGRE+KVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTII  181



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V+KT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  81   VDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  140

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  141  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  200

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTII
Sbjct  201  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPASTDNAEFQIVLTII  257



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPG GPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  124  ALDWGPGAGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK+SSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTII  181



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  27   VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  86

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  87   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  146

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II
Sbjct  147  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSII  203



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+ GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTII  181



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK+SSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTII  181



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  108  VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  167

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  168  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  227

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  228  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSII  284



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYDKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AGV54286.1| adenosylhomocysteinase [Phaseolus vulgaris]
Length=485

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVLTII  181



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKD+S ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPASTDNAEFQIVLTII  181



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKV+DMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            L+WG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDP+STDNAEFQIVL +I
Sbjct  125  LEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLI  181



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMA RAEFGPSQP KGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVLTII  181



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +V+K++SGRE+KVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTII  181



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDL VDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLTVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G  PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGASPDPASTDNAEFQIVLTII  181



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT++GRE KVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTII  181



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN EFQIVL +I
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNVEFQIVLGLI  181



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            TVEKT++GREYKVKD+S ADFGRLE+ELAE+EMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNVEFQLVLTII  181



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   315 bits (806),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRL LELAEVEMPGLMACR  FGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLGLELAEVEMPGLMACRTGFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEVFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFG LE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF  +GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFRVEGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLI+EGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIYEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTII  181



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPS TDN EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGQVPDPSCTDNPEFQIVLQII  181



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C AEFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSII  181



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTS GREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWG GGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGTGGGPDLIVDDGGDATLLIHEGVKAEEVFEKTGQVPDPNSTDNPEFQIVLSII  181



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (820),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   319 bits (818),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPAQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLL+HEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLVHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALI  181



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALI  181



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK+SSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTII
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTII  181



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTII
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTII  181



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V+KTSSGREYKVKDMS ADFGRLE++LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G  PDPSST+NAEFQIVLT+I
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKFPDPSSTNNAEFQIVLTLI  181



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDA LLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDAALLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGV+AEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVRAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTII  181



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTII
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTII  181



>gb|AFW60834.1| adenosyl homocysteine hydrolase1 [Zea mays]
Length=259

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEE+Y K G +PDP STDNAEF+IVLTII
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVLTII  181



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VE T+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y KNG +PDPSSTDNAEFQI+LTII
Sbjct  125  LDWGPTGGPDLIVDDGGDVTLLIHEGVKAEELYEKNGQLPDPSSTDNAEFQIILTII  181



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVL ETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLTETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS A+FGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTII
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTII  181



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAALIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLH T
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHTT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF W+GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWEGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPF GARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFTGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSII  181



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITDSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSII  181



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGR YKVKD+S ADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR+EFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPFKGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN+EFQIVL +I
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNSEFQIVLGLI  181



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSII  181



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDW PGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWSPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+ST N EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTTNPEFQIVLGII  181



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAGVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR+EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLI DDGGDA++LIHEGVKAEEE+AKNGTVPDP ST N +FQIVLTII
Sbjct  125  LDWGPSGGPDLIFDDGGDASMLIHEGVKAEEEFAKNGTVPDPHSTTNPDFQIVLTII  181



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPG M+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGA+ITGSLHM
Sbjct  6    SVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGAKITGSLHM  65

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  66   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  125

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL +I
Sbjct  126  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPTSTDNVEFQLVLGLI  183



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGR YKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKD+S ADFGRLELELAEVEMPGLMACR+E+GPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGPSQPFKGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            L+WGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +I
Sbjct  125  LEWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLI  181



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQ HAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQGHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDAT LIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATPLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G  PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQFPDPTSTDNPEFQIVLSII  181



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +V+KTS GREYKVKDMS ADFGRLE++LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARDSA+VF WKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSASVFAWKGETLQEYWWCTEK  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            +LDWG GGGPDLIVDDGGD T+LIHEGVKAEE Y K G VPDP+S+DNAEFQIVLTII
Sbjct  124  SLDWGAGGGPDLIVDDGGDVTMLIHEGVKAEEAYEKTGKVPDPTSSDNAEFQIVLTII  181



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   317 bits (812),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP STDNAEF+IVLTII
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPESTDNAEFKIVLTII  181



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCS NIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSRNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWW TERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWSTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQP KGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPLKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGASVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDPSST+NAEFQIVL II
Sbjct  124  ALDWGSEGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTENAEFQIVLGII  181



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR EFGPSQPF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFAGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP STDNAEF+IVLTII
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPESTDNAEFKIVLTII  181



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTII
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTII  181



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VE T+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTII  181



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGLSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  +AKNGT PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAIFAKNGTFPDPTSTDNPEFQIVLSII  181



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V KTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR+EFGPSQP KGARI+GSLHMT
Sbjct  5    VGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPLKGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVF WKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSVAVFAWKGETLQEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +I
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLI  181



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAII  181



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LD GPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDRGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEK SSGREYKVKDMS ADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGPSQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDP+STDNAEFQIVL+II
Sbjct  124  ALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQLPDPTSTDNAEFQIVLSII  181



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGE LQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGENLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWG GGGPDLIVDDGGDATLLIHEGVKAE+E+ KNGT+PDPSST N EFQIVL I+
Sbjct  124  ALDWGVGGGPDLIVDDGGDATLLIHEGVKAEKEFEKNGTLPDPSSTTNQEFQIVLGIL  181



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSII  181



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVD GGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDGGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLEL+LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTII
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTII  181



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V+KT++GREYKVKDMS ADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARD AAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAATIARDCAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEEE+  +GT+PDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEEEFKTSGTMPDPNSTDNAEFQIVLTII  181



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  8    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  67

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  68   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  127

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II
Sbjct  128  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSII  184



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLI  181



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLI  181



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLI  181



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSII  181



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLI  181



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGRE+KVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP+ST N EFQ+VL +I
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPASTTNLEFQMVLGLI  181



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGS HMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSFHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEV WCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVPWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTII
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTII  181



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT++GREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+A DSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIAHDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ Y K G +PDPSSTDNAEFQIVLTII
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEQVYEKTGQLPDPSSTDNAEFQIVLTII  181



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTII
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTII  181



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT+SGREYKVKDMS ADFGRLE+ELAE EMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTII  181



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAII  181



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDM+ ADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G  PDP+S+DNAEFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQFPDPASSDNAEFQIVLSII  181



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   EKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  273
            EKT SGREYKVKDMS ADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  274  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERAL  453
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  454  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DWGPGGGPDLIV+DGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I
Sbjct  126  DWGPGGGPDLIVNDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLI  181



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAII  181



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT++GREYKVKD+S ADFGRLE+ELAE+EMPGL++ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTNTGREYKVKDLSQADFGRLEIELAEIEMPGLISSRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G VPDPSSTDNAEFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEELFEKTGEVPDPSSTDNAEFQIVLSII  181



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAII  181



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
             VEKTS+GREYKVKD+S ADFGRLE+ELAEVEMPGLM+CRAEFGPSQPF GARITGSLHM
Sbjct  4    VVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFAGARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDP+STDNAEFQIVL II
Sbjct  124  CLDWGPTGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPASTDNAEFQIVLGII  181



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSC IFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCXIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP STDN EF+IVLTII
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPESTDNPEFKIVLTII  181



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEE+Y K G +PDP STDNAEF+IVLTII
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVLTII  181



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+  ADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVF WKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTII
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTII  181



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VE T+SGREYKVKDMS ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWG GGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTII
Sbjct  125  LDWGTGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTII  181



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   313 bits (802),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTS+GREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGP++PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAKPFAGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL EYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL II
Sbjct  125  LDWGPNGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGII  181



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWW TER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWGTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VP+P STDNAEF+IVLTII
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPNPDSTDNAEFKIVLTII  181



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+SGREYKV+DMS ADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDAYAKDGTLPDPESTTNAEFKIVLTIL  181



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSII  181



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   312 bits (800),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G  PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGVFPDPTSTDNPEFQIVLSII  181



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   312 bits (800),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+SGREYKV+DMS ADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTIL  181



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   312 bits (799),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLI DDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II
Sbjct  125  LDWGPGGGPDLIGDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSII  181



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTS+GREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIE+LTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL EYWWCTER 
Sbjct  65   IQTAVLIESLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +I
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGLI  181



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKT++GRE+KVKDMS ADFGRLE+ELAEVEMPGLM+ R+EFGPSQPFKGARITGSLHMT
Sbjct  87   VEKTTAGREFKVKDMSQADFGRLEIELAEVEMPGLMSSRSEFGPSQPFKGARITGSLHMT  146

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  147  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  206

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAE EY K G +PDP+STDNAEFQ+VL +I
Sbjct  207  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAEYEKTGKLPDPNSTDNAEFQLVLGLI  263



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKD+S ADFGRLE+ELAEVEMPGLMACR+E+GPSQP KGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGPSQPLKGARISGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTE+ 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTEQC  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +I
Sbjct  125  LDWGAAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLI  181



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V+KTS+GREYKVKDM+ ADFGRLE++LAEVEMPGLMACR E+GPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPSQPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K GT+PDPSST N+E QIV TII
Sbjct  125  LDWGPEGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTII  181



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            VEKTSSGREYKVKDMS ADFGR+E+ELAEVEMPGL++CR EFG SQPFKG RITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFGSSQPFKGTRITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGD TLLIHEGVKAE+ + K G  PDPSS+DNAEFQIVL+II
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEQVFEKTGQSPDPSSSDNAEFQIVLSII  181



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            +VEKT+SGREYKV+DMS ADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLI+TLT LGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER
Sbjct  64   TIQTAVLIDTLTDLGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTIL  181



>gb|AAL33588.1| S-adenosyl-L-homocysteine hydrolase [Zea mays]
Length=232

 Score =   299 bits (765),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  ADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEV  321
            ADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEV
Sbjct  2    ADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEV  61

Query  322  RWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGG  501
            RWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERALDWGPGGGPDLIVDDGG
Sbjct  62   RWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGG  121

Query  502  DATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII
Sbjct  122  DATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTII  161



>gb|AFY99087.1| S-adenosyl-l-homocysteine hydrolase, partial [Campanula persicifolia]
Length=202

 Score =   295 bits (755),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +1

Query  133  MSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  312
            MS ADFGRLELELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMTIQT VLIETLTALG
Sbjct  1    MSLADFGRLELELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALG  60

Query  313  AEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            AEVRWCSCNIFSTQDHAAAA+ARDS AVF WKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  493  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DGGDATLLIHEGVKAEEE+ K+G VPDP+STDNAEFQIVLTII
Sbjct  121  DGGDATLLIHEGVKAEEEFEKSGAVPDPASTDNAEFQIVLTII  163



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   305 bits (780),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V+KTS+GREYKVKDM+ ADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TII
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTII  181



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V+KTS+GREYKVKDM+ ADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TII
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAEEIYEKXGTLPDPSSTTNSELQIVFTII  181



>gb|AFY99082.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia kakeana]
 gb|AFY99083.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia arborescens 
subsp. waihiae]
 gb|AFY99084.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia fauriei]
 gb|AFY99085.1| S-adenosyl-l-homocysteine hydrolase, partial [Cyanea asplenifolia]
Length=202

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +1

Query  133  MSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  312
            MS ADFGRLELELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMTIQT VLIETLTALG
Sbjct  1    MSLADFGRLELELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALG  60

Query  313  AEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            AEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  493  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            DGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTII
Sbjct  121  DGGDATLLIHEGVKAEEEYEKSGALPDPTSTDNAEFQIVLTII  163



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            TV +T++GRE+KVKD++ ADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTEK  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            ALDWGPGGGPDLIVDDGGDATLLIHEG KAEEEY ++G +P+P+ T+NAEF+IVL+II
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGAKAEEEYERSGKLPNPNETENAEFRIVLSII  181



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   TVEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  267
            T+ +T +GREYKVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  268  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTER  447
            TIQTAVLIETLTALGA+VRWCSCNIFSTQDHAAAA+ARDSA+VF WKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAQVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLEEYWWCTEK  123

Query  448  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            AL+WGPGGGPDLIVDDGGDATLLIHEGVKAEE Y ++G +P+P+ T+NAEF+IVL+II
Sbjct  124  ALEWGPGGGPDLIVDDGGDATLLIHEGVKAEEVYERSGKLPNPNETENAEFRIVLSII  181



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  91   VEKTSSGREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  270
            V +T++GRE+KVKD++ ADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHMT
Sbjct  5    VSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKEARITGSLHMT  64

Query  271  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERA  450
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVF WKGETL+EYWWCTE+A
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLEEYWWCTEKA  124

Query  451  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            L+WGPGGGPDLIVDDGGDATLLIHEGVKAE EY ++G +P+P+ T+NAEFQIVL+II
Sbjct  125  LEWGPGGGPDLIVDDGGDATLLIHEGVKAEGEYERSGKLPNPNETENAEFQIVLSII  181



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  109  GREYKVKDMSXADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL  288
            G  +KVKD+S ADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMTIQTAVL
Sbjct  41   GGSFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVL  100

Query  289  IETLTALGAEVRWCSCNIFSTQDHaaaavardsaaVFXWKGETLQEYWWCTERALDWGPG  468
            IETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF WKGETL+EYWWCTER LDWG G
Sbjct  101  IETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVG  160

Query  469  GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII  621
            GGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTII
Sbjct  161  GGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTII  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950