BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048C13

Length=679
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794726.1|  PREDICTED: polygalacturonase-1 non-catalytic...    293   1e-91   Nicotiana sylvestris
gb|AHC69823.1|  polygalacturonase isoenzyme 1 beta subunit              293   2e-91   Nicotiana tabacum [American tobacco]
ref|XP_009596009.1|  PREDICTED: polygalacturonase-1 non-catalytic...    291   5e-91   Nicotiana tomentosiformis
ref|XP_011086565.1|  PREDICTED: polygalacturonase-1 non-catalytic...    272   2e-83   Sesamum indicum [beniseed]
emb|CDP00165.1|  unnamed protein product                                268   4e-82   Coffea canephora [robusta coffee]
gb|EYU31262.1|  hypothetical protein MIMGU_mgv1a002697mg                260   1e-78   Erythranthe guttata [common monkey flower]
ref|XP_009794727.1|  PREDICTED: polygalacturonase-1 non-catalytic...    254   8e-77   Nicotiana sylvestris
ref|XP_009596020.1|  PREDICTED: polygalacturonase-1 non-catalytic...    253   4e-76   Nicotiana tomentosiformis
ref|XP_006365227.1|  PREDICTED: polygalacturonase-1 non-catalytic...    251   3e-75   Solanum tuberosum [potatoes]
ref|XP_006365226.1|  PREDICTED: polygalacturonase-1 non-catalytic...    249   1e-74   Solanum tuberosum [potatoes]
ref|NP_001234835.1|  polygalacturonase-1 non-catalytic subunit be...    246   2e-73   Solanum lycopersicum
ref|XP_008340027.1|  PREDICTED: probable polygalacturonase non-ca...    246   2e-73   
ref|XP_004238669.1|  PREDICTED: polygalacturonase-1 non-catalytic...    241   1e-71   Solanum lycopersicum
gb|EPS67761.1|  polygalacturonase-1 non-catalytic subunit beta          238   1e-70   Genlisea aurea
ref|XP_004514684.1|  PREDICTED: polygalacturonase-1 non-catalytic...    238   2e-70   Cicer arietinum [garbanzo]
ref|XP_006365231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    238   3e-70   
ref|XP_006365228.1|  PREDICTED: polygalacturonase non-catalytic s...    237   3e-70   Solanum tuberosum [potatoes]
gb|KDO82433.1|  hypothetical protein CISIN_1g036311mg                   236   6e-70   Citrus sinensis [apfelsine]
ref|XP_010242994.1|  PREDICTED: probable polygalacturonase non-ca...    236   7e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008221810.1|  PREDICTED: probable polygalacturonase non-ca...    236   9e-70   Prunus mume [ume]
ref|XP_006438394.1|  hypothetical protein CICLE_v10030947mg             236   1e-69   Citrus clementina [clementine]
ref|XP_006365229.1|  PREDICTED: polygalacturonase non-catalytic s...    235   1e-69   
ref|XP_006365230.1|  PREDICTED: polygalacturonase-1 non-catalytic...    235   2e-69   Solanum tuberosum [potatoes]
ref|XP_009363553.1|  PREDICTED: probable polygalacturonase non-ca...    235   3e-69   
ref|XP_009363551.1|  PREDICTED: probable polygalacturonase non-ca...    235   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_010100469.1|  hypothetical protein L484_027781                   233   9e-69   
ref|XP_004238668.1|  PREDICTED: polygalacturonase non-catalytic s...    232   2e-68   
ref|XP_011071083.1|  PREDICTED: polygalacturonase-1 non-catalytic...    231   6e-68   Sesamum indicum [beniseed]
gb|KDP26581.1|  hypothetical protein JCGZ_17739                         230   1e-67   Jatropha curcas
ref|XP_011034135.1|  PREDICTED: probable polygalacturonase non-ca...    230   1e-67   Populus euphratica
ref|XP_004238667.1|  PREDICTED: polygalacturonase non-catalytic s...    228   7e-67   
ref|XP_004298578.1|  PREDICTED: probable polygalacturonase non-ca...    228   1e-66   Fragaria vesca subsp. vesca
ref|XP_008389645.1|  PREDICTED: probable polygalacturonase non-ca...    228   1e-66   Malus domestica [apple tree]
gb|KDO82432.1|  hypothetical protein CISIN_1g044596mg                   228   2e-66   Citrus sinensis [apfelsine]
ref|XP_006483847.1|  PREDICTED: probable polygalacturonase non-ca...    227   2e-66   Citrus sinensis [apfelsine]
ref|XP_006438392.1|  hypothetical protein CICLE_v10030930mg             227   2e-66   Citrus clementina [clementine]
ref|XP_003517743.1|  PREDICTED: probable polygalacturonase non-ca...    227   2e-66   Glycine max [soybeans]
ref|XP_008444317.1|  PREDICTED: probable polygalacturonase non-ca...    226   3e-66   Cucumis melo [Oriental melon]
gb|KHG01313.1|  Polygalacturonase non-catalytic subunit protein         226   5e-66   Gossypium arboreum [tree cotton]
ref|XP_004173618.1|  PREDICTED: probable polygalacturonase non-ca...    224   2e-65   
ref|XP_004142981.1|  PREDICTED: probable polygalacturonase non-ca...    224   3e-65   Cucumis sativus [cucumbers]
gb|KJB15113.1|  hypothetical protein B456_002G161400                    223   4e-65   Gossypium raimondii
ref|XP_007044636.1|  Polygalacturonase 2                                224   8e-65   
ref|XP_003519820.2|  PREDICTED: probable polygalacturonase non-ca...    223   1e-64   Glycine max [soybeans]
emb|CBI28514.3|  unnamed protein product                                213   1e-64   Vitis vinifera
ref|XP_002311777.2|  hypothetical protein POPTR_0008s19430g             220   7e-64   Populus trichocarpa [western balsam poplar]
gb|KJB31246.1|  hypothetical protein B456_005G182600                    219   9e-64   Gossypium raimondii
ref|XP_011009539.1|  PREDICTED: probable polygalacturonase non-ca...    220   1e-63   Populus euphratica
gb|KJB31245.1|  hypothetical protein B456_005G182600                    219   1e-63   Gossypium raimondii
ref|XP_002314620.2|  hypothetical protein POPTR_0010s05000g             219   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_003613234.1|  Polygalacturonase-1 non-catalytic subunit beta     219   3e-63   Medicago truncatula
ref|XP_007224206.1|  hypothetical protein PRUPE_ppa017408mg             217   9e-63   
gb|KHG24447.1|  Polygalacturonase non-catalytic subunit protein         217   1e-62   Gossypium arboreum [tree cotton]
ref|XP_008221868.1|  PREDICTED: probable polygalacturonase non-ca...    216   2e-62   Prunus mume [ume]
ref|XP_010551569.1|  PREDICTED: probable polygalacturonase non-ca...    215   7e-62   Tarenaya hassleriana [spider flower]
ref|XP_010251282.1|  PREDICTED: probable polygalacturonase non-ca...    215   9e-62   Nelumbo nucifera [Indian lotus]
ref|XP_007157462.1|  hypothetical protein PHAVU_002G071500g             214   1e-61   Phaseolus vulgaris [French bean]
ref|XP_002266341.1|  PREDICTED: probable polygalacturonase non-ca...    214   1e-61   Vitis vinifera
ref|XP_002266815.1|  PREDICTED: probable polygalacturonase non-ca...    214   2e-61   Vitis vinifera
gb|EYU22487.1|  hypothetical protein MIMGU_mgv1a002927mg                211   1e-60   Erythranthe guttata [common monkey flower]
gb|KCW59875.1|  hypothetical protein EUGRSUZ_H02608                     210   6e-60   Eucalyptus grandis [rose gum]
ref|XP_010023570.1|  PREDICTED: probable polygalacturonase non-ca...    210   6e-60   
ref|XP_003532010.1|  PREDICTED: probable polygalacturonase non-ca...    209   1e-59   Glycine max [soybeans]
ref|XP_002525383.1|  Polygalacturonase-1 non-catalytic subunit be...    208   3e-59   Ricinus communis
gb|AAN60310.1|  unknown                                                 197   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08244.1|  At1g70370/F17O7_9                                       200   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003552018.1|  PREDICTED: probable polygalacturonase non-ca...    202   5e-57   Glycine max [soybeans]
ref|XP_010415713.1|  PREDICTED: probable polygalacturonase non-ca...    202   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007153633.1|  hypothetical protein PHAVU_003G052000g             201   9e-57   Phaseolus vulgaris [French bean]
ref|XP_002888771.1|  hypothetical protein ARALYDRAFT_894840             201   1e-56   
ref|XP_006300881.1|  hypothetical protein CARUB_v10019971mg             201   1e-56   Capsella rubella
ref|XP_010471031.1|  PREDICTED: probable polygalacturonase non-ca...    200   3e-56   
ref|XP_010471032.1|  PREDICTED: probable polygalacturonase non-ca...    200   3e-56   Camelina sativa [gold-of-pleasure]
gb|AAB39546.1|  polygalacturonase isoenzyme 1 beta subunit homolog      199   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177194.1|  polygalacturonase 2                                   199   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460151.1|  PREDICTED: probable polygalacturonase non-ca...    199   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006390895.1|  hypothetical protein EUTSA_v10018277mg             199   7e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010498883.1|  PREDICTED: probable polygalacturonase non-ca...    198   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006303930.1|  hypothetical protein CARUB_v10008588mg             197   3e-55   
emb|CDX68345.1|  BnaA07g23850D                                          197   3e-55   
ref|NP_173788.1|  putative polygalacturonase non-catalytic subuni...    196   5e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99852.1|  putative polygalacuronase isoenzyme 1 beta subunit     196   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AAB39538.1|  aromatic rich glycoprotein JP630                        196   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427809.1|  PREDICTED: probable polygalacturonase non-ca...    196   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010477679.1|  PREDICTED: probable polygalacturonase non-ca...    195   1e-54   Camelina sativa [gold-of-pleasure]
gb|KCW86731.1|  hypothetical protein EUGRSUZ_B03343                     194   3e-54   Eucalyptus grandis [rose gum]
ref|XP_010044636.1|  PREDICTED: polygalacturonase-1 non-catalytic...    194   4e-54   Eucalyptus grandis [rose gum]
ref|XP_010925453.1|  PREDICTED: BURP domain-containing protein 12...    194   6e-54   Elaeis guineensis
ref|XP_010520580.1|  PREDICTED: probable polygalacturonase non-ca...    193   6e-54   Tarenaya hassleriana [spider flower]
emb|CDY59986.1|  BnaC06g43610D                                          193   7e-54   Brassica napus [oilseed rape]
ref|XP_009105700.1|  PREDICTED: probable polygalacturonase non-ca...    193   8e-54   Brassica rapa
ref|XP_002890594.1|  hypothetical protein ARALYDRAFT_472637             193   8e-54   Arabidopsis lyrata subsp. lyrata
emb|CDY57845.1|  BnaA07g38770D                                          193   9e-54   Brassica napus [oilseed rape]
ref|XP_004509821.1|  PREDICTED: probable polygalacturonase non-ca...    192   2e-53   Cicer arietinum [garbanzo]
emb|CDY23501.1|  BnaC06g24700D                                          192   2e-53   Brassica napus [oilseed rape]
gb|KFK41456.1|  hypothetical protein AALP_AA2G132700                    190   1e-52   Arabis alpina [alpine rockcress]
ref|XP_006392169.1|  hypothetical protein EUTSA_v10023352mg             190   1e-52   Eutrema salsugineum [saltwater cress]
gb|KFK44451.1|  hypothetical protein AALP_AA1G258600                    188   6e-52   Arabis alpina [alpine rockcress]
ref|XP_011071835.1|  PREDICTED: probable polygalacturonase non-ca...    187   2e-51   Sesamum indicum [beniseed]
ref|NP_176242.1|  polygalacturonase 1                                   187   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006586545.1|  PREDICTED: probable polygalacturonase non-ca...    181   7e-51   
emb|CDY53059.1|  BnaA09g14240D                                          184   1e-50   Brassica napus [oilseed rape]
ref|XP_009113216.1|  PREDICTED: probable polygalacturonase non-ca...    184   1e-50   Brassica rapa
gb|KEH20007.1|  polygalacturonase non-catalytic protein                 184   2e-50   Medicago truncatula
emb|CDY47228.1|  BnaC09g14770D                                          184   2e-50   Brassica napus [oilseed rape]
ref|XP_006300871.1|  hypothetical protein CARUB_v10019963mg             182   7e-50   Capsella rubella
gb|EPS60630.1|  polygalacturonase-1 non-catalytic subunit beta          181   3e-49   Genlisea aurea
ref|XP_006438393.1|  hypothetical protein CICLE_v10033917mg             179   1e-48   
ref|XP_010682558.1|  PREDICTED: probable polygalacturonase non-ca...    179   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006484316.1|  PREDICTED: probable polygalacturonase non-ca...    179   1e-48   
ref|XP_002318036.2|  hypothetical protein POPTR_0012s08060g             179   1e-48   Populus trichocarpa [western balsam poplar]
emb|CCD74525.1|  polygalacturonase 1                                    177   4e-48   Arabidopsis halleri subsp. halleri
ref|XP_002886622.1|  hypothetical protein ARALYDRAFT_475291             177   5e-48   
gb|KDO69698.1|  hypothetical protein CISIN_1g0378482mg                  175   9e-48   Citrus sinensis [apfelsine]
ref|XP_010553600.1|  PREDICTED: probable polygalacturonase non-ca...    176   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_011044316.1|  PREDICTED: probable polygalacturonase non-ca...    176   1e-47   Populus euphratica
ref|XP_010555103.1|  PREDICTED: probable polygalacturonase non-ca...    176   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_006439797.1|  hypothetical protein CICLE_v10019363mg             175   2e-47   
ref|XP_009394250.1|  PREDICTED: BURP domain-containing protein 12...    175   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010678748.1|  PREDICTED: probable polygalacturonase non-ca...    175   4e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006476763.1|  PREDICTED: probable polygalacturonase non-ca...    174   7e-47   
ref|XP_010510953.1|  PREDICTED: probable polygalacturonase non-ca...    174   7e-47   Camelina sativa [gold-of-pleasure]
gb|KDP31113.1|  hypothetical protein JCGZ_11489                         174   8e-47   Jatropha curcas
ref|XP_010417970.1|  PREDICTED: probable polygalacturonase non-ca...    174   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010924225.1|  PREDICTED: BURP domain-containing protein 12...    173   2e-46   Elaeis guineensis
ref|XP_007036187.1|  Polygalacturonase 2, putative                      172   2e-46   
emb|CBI15046.3|  unnamed protein product                                171   7e-46   Vitis vinifera
ref|XP_002279813.2|  PREDICTED: probable polygalacturonase non-ca...    171   8e-46   Vitis vinifera
ref|XP_008800877.1|  PREDICTED: BURP domain-containing protein 12...    171   9e-46   Phoenix dactylifera
ref|XP_010436291.1|  PREDICTED: probable polygalacturonase non-ca...    162   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010473218.1|  PREDICTED: probable polygalacturonase non-ca...    169   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009593470.1|  PREDICTED: probable polygalacturonase non-ca...    169   4e-45   Nicotiana tomentosiformis
ref|XP_010419424.1|  PREDICTED: probable polygalacturonase non-ca...    160   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009415276.1|  PREDICTED: BURP domain-containing protein 12...    169   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393062.1|  PREDICTED: BURP domain-containing protein 12...    168   9e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG12475.1|  Polygalacturonase non-catalytic subunit protein         167   3e-44   Gossypium arboreum [tree cotton]
gb|KJB30299.1|  hypothetical protein B456_005G136300                    166   6e-44   Gossypium raimondii
ref|XP_009775426.1|  PREDICTED: probable polygalacturonase non-ca...    163   7e-43   Nicotiana sylvestris
gb|KEH20006.1|  polygalacturonase non-catalytic protein                 162   2e-42   Medicago truncatula
ref|XP_008776735.1|  PREDICTED: BURP domain-containing protein 12...    160   4e-42   Phoenix dactylifera
ref|XP_004236111.1|  PREDICTED: probable polygalacturonase non-ca...    160   4e-42   Solanum lycopersicum
ref|XP_010101197.1|  hypothetical protein L484_015001                   160   5e-42   
ref|XP_007141610.1|  hypothetical protein PHAVU_008G210500g             160   7e-42   Phaseolus vulgaris [French bean]
ref|XP_004509826.1|  PREDICTED: probable polygalacturonase non-ca...    158   4e-41   Cicer arietinum [garbanzo]
ref|XP_002511417.1|  Polygalacturonase-1 non-catalytic subunit be...    157   5e-41   Ricinus communis
ref|XP_008453099.1|  PREDICTED: probable polygalacturonase non-ca...    154   1e-39   Cucumis melo [Oriental melon]
ref|XP_007210277.1|  hypothetical protein PRUPE_ppa003003mg             153   2e-39   
gb|KHN30893.1|  Polygalacturonase-1 non-catalytic subunit beta          153   2e-39   Glycine soja [wild soybean]
ref|XP_008346742.1|  PREDICTED: probable polygalacturonase non-ca...    153   2e-39   
ref|XP_006578624.1|  PREDICTED: polygalacturonase-1 non-catalytic...    152   3e-39   Glycine max [soybeans]
ref|XP_004166494.1|  PREDICTED: probable polygalacturonase non-ca...    153   3e-39   
ref|XP_008239752.1|  PREDICTED: probable polygalacturonase non-ca...    152   3e-39   Prunus mume [ume]
gb|KDP26582.1|  hypothetical protein JCGZ_17740                         152   6e-39   Jatropha curcas
ref|XP_003528153.1|  PREDICTED: polygalacturonase-1 non-catalytic...    150   2e-38   Glycine max [soybeans]
ref|XP_004138283.1|  PREDICTED: probable polygalacturonase non-ca...    149   5e-38   Cucumis sativus [cucumbers]
ref|XP_006345047.1|  PREDICTED: probable polygalacturonase non-ca...    147   3e-37   Solanum tuberosum [potatoes]
emb|CDP12374.1|  unnamed protein product                                147   4e-37   Coffea canephora [robusta coffee]
ref|XP_007138090.1|  hypothetical protein PHAVU_009G179500g             144   2e-36   Phaseolus vulgaris [French bean]
ref|XP_008374449.1|  PREDICTED: probable polygalacturonase non-ca...    144   4e-36   
gb|EPS68955.1|  hypothetical protein M569_05812                         143   4e-36   Genlisea aurea
ref|XP_004300895.1|  PREDICTED: probable polygalacturonase non-ca...    143   9e-36   Fragaria vesca subsp. vesca
ref|XP_004501939.1|  PREDICTED: probable polygalacturonase non-ca...    136   2e-33   Cicer arietinum [garbanzo]
ref|XP_007223063.1|  hypothetical protein PRUPE_ppa003712mg             135   2e-33   
dbj|BAK05386.1|  predicted protein                                      135   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16440.1|  unknown                                                 134   2e-32   Picea sitchensis
ref|XP_002444270.1|  hypothetical protein SORBIDRAFT_07g019310          134   3e-32   Sorghum bicolor [broomcorn]
dbj|BAJ92348.1|  predicted protein                                      133   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146063.1|  uncharacterized protein LOC100279594 precursor     133   4e-32   Zea mays [maize]
gb|ACN34141.1|  unknown                                                 131   1e-31   Zea mays [maize]
gb|ACG28762.1|  polygalacturonase-1 non-catalytic beta subunit pr...    130   3e-31   Zea mays [maize]
ref|XP_010028282.1|  PREDICTED: probable polygalacturonase non-ca...    129   8e-31   Eucalyptus grandis [rose gum]
ref|XP_003601289.1|  Polygalacturonase-1 non-catalytic subunit beta     128   2e-30   Medicago truncatula
ref|XP_003574428.1|  PREDICTED: BURP domain-containing protein 12       127   6e-30   Brachypodium distachyon [annual false brome]
emb|CDP00166.1|  unnamed protein product                                125   8e-30   Coffea canephora [robusta coffee]
ref|XP_002525381.1|  Polygalacturonase non-catalytic subunit AroG...    124   2e-29   
ref|XP_006844960.1|  hypothetical protein AMTR_s00058p00173800          124   4e-29   
ref|XP_003610588.1|  BURP domain-containing protein                     120   3e-28   
ref|XP_004973305.1|  PREDICTED: BURP domain-containing protein 12...    116   3e-26   Setaria italica
emb|CBI28512.3|  unnamed protein product                                105   5e-25   Vitis vinifera
ref|XP_003576424.1|  PREDICTED: BURP domain-containing protein 14...    108   3e-23   
ref|NP_001061692.1|  Os08g0380100                                       104   4e-22   
dbj|BAJ97940.1|  predicted protein                                      100   1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460065.1|  hypothetical protein SORBIDRAFT_02g022220        99.4    4e-20   Sorghum bicolor [broomcorn]
ref|XP_004956601.1|  PREDICTED: BURP domain-containing protein 14...  98.6    6e-20   Setaria italica
ref|XP_008652571.1|  PREDICTED: BURP domain-containing protein 14...  97.4    2e-19   
ref|XP_010100466.1|  hypothetical protein L484_027778                 89.7    2e-18   
ref|XP_006661124.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...  92.8    4e-18   
emb|CAN81758.1|  hypothetical protein VITISV_043391                   92.8    4e-18   Vitis vinifera
gb|EEC83505.1|  hypothetical protein OsI_29064                        92.0    9e-18   Oryza sativa Indica Group [Indian rice]
gb|KEH20005.1|  polygalacturonase non-catalytic protein               84.7    8e-16   Medicago truncatula
ref|XP_010044626.1|  PREDICTED: polygalacturonase non-catalytic s...  80.9    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010046641.1|  PREDICTED: polygalacturonase non-catalytic s...  77.8    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010046648.1|  PREDICTED: polygalacturonase non-catalytic s...  73.6    7e-12   Eucalyptus grandis [rose gum]
ref|XP_010046646.1|  PREDICTED: BURP domain-containing protein 16...  73.9    7e-12   
ref|XP_010044627.1|  PREDICTED: polygalacturonase non-catalytic s...  73.2    1e-11   Eucalyptus grandis [rose gum]
ref|XP_010046642.1|  PREDICTED: polygalacturonase non-catalytic s...  71.6    3e-11   
dbj|BAD23622.1|  polygalacturonase isoenzyme 1 beta subunit-like      71.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062896.2|  Os09g0329000                                     71.6    6e-11   
gb|EEE68602.1|  hypothetical protein OsJ_27135                        70.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010044635.1|  PREDICTED: probable polygalacturonase non-ca...  68.6    4e-10   Eucalyptus grandis [rose gum]
gb|KHN12103.1|  Putative polygalacturonase non-catalytic subunit ...  58.2    4e-10   Glycine soja [wild soybean]
ref|XP_010936822.1|  PREDICTED: BURP domain-containing protein 12...  62.8    4e-08   Elaeis guineensis
gb|ABK25588.1|  unknown                                               55.8    1e-06   Picea sitchensis
gb|EMT26618.1|  hypothetical protein F775_18544                       54.7    2e-05   
gb|EMS64687.1|  hypothetical protein TRIUR3_01269                     53.9    3e-05   Triticum urartu
gb|KHN00353.1|  Polygalacturonase-1 non-catalytic subunit beta        53.9    4e-05   Glycine soja [wild soybean]
dbj|BAH57586.1|  BURP domain-containing protein                       52.4    4e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57597.1|  BURP domain-containing protein                       52.4    4e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57598.1|  BURP domain-containing protein                       52.4    4e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57596.1|  BURP domain-containing protein                       52.4    4e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57589.1|  BURP domain-containing protein                       52.4    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006659367.1|  PREDICTED: BURP domain-containing protein 12...  53.5    5e-05   Oryza brachyantha
dbj|BAH57581.1|  BURP domain-containing protein                       51.6    9e-05   Arabidopsis lyrata [lyrate rockcress]
gb|AEN81138.1|  AT1G60390-like protein                                49.3    4e-04   Capsella grandiflora
gb|AEN81137.1|  AT1G60390-like protein                                49.3    4e-04   Capsella grandiflora
gb|EEE69479.1|  hypothetical protein OsJ_28904                        50.8    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMS58973.1|  hypothetical protein TRIUR3_16136                     50.4    6e-04   Triticum urartu
gb|AEN81134.1|  AT1G60390-like protein                                48.5    6e-04   Capsella grandiflora
gb|AEN81136.1|  AT1G60390-like protein                                48.5    7e-04   Capsella grandiflora
gb|AEN81139.1|  AT1G60390-like protein                                48.5    7e-04   Capsella grandiflora
gb|EMT30231.1|  hypothetical protein F775_20363                       49.7    9e-04   



>ref|XP_009794726.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=628

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +3

Query  111  GEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGES  290
            G++SGE  NPFTPK YLIRYWKKQ+SNDL KPWFLLNKASPLNAAQYA Y+K+ AD   +
Sbjct  24   GDNSGESGNPFTPKGYLIRYWKKQVSNDLPKPWFLLNKASPLNAAQYATYTKLVADQ-NA  82

Query  291  LSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTD  470
            LSTQL  FCSSANLLC PDLSPSLEKH+ +VNFASY+ KNFTNYGT RAGG D+FKNY+D
Sbjct  83   LSTQLHSFCSSANLLCAPDLSPSLEKHSNDVNFASYNDKNFTNYGTTRAGGFDAFKNYSD  142

Query  471  NENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNV  650
             ENIPVDSFRRYSRDS GH+D+FSNYAP+GNV+DQ+FNTYGT++ GG GKF+NYGP VNV
Sbjct  143  GENIPVDSFRRYSRDSGGHDDKFSNYAPDGNVIDQAFNTYGTNAAGGTGKFTNYGPNVNV  202

Query  651  PDMRFTSYS  677
            P++RFTSYS
Sbjct  203  PNIRFTSYS  211


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    GG  +F +Y  N N+P ++F+ Y     G  + F+NY    NV D SF  Y
Sbjct  263  FTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNY  322

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               +  G+  F NYG   N    +FT Y
Sbjct  323  IKDTNAGEANFVNYGQSFNEGTDKFTGY  350


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 20/108 (19%)
 Frame = +3

Query  369  HAGNVNFASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHE  530
            + GN NF SY         NF NYG    G  ++F NY D  N+  DSF+ Y +D+   E
Sbjct  271  NGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNYIKDTNAGE  330

Query  531  DRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
              F NY        QSFN        G  KF+ YG   N P + F +Y
Sbjct  331  ANFVNYG-------QSFN-------EGTDKFTGYGKGANDPKVNFKTY  364



>gb|AHC69823.1| polygalacturonase isoenzyme 1 beta subunit [Nicotiana tabacum]
Length=628

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +3

Query  111  GEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGES  290
            G++SGE  NPFTPK YLIRYWKKQ+SNDL KPWFLLNKASPLNAAQYA Y+K+ AD   +
Sbjct  24   GDNSGESGNPFTPKGYLIRYWKKQVSNDLPKPWFLLNKASPLNAAQYATYTKLVADQ-NA  82

Query  291  LSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTD  470
            LSTQL  FCSSANLLC PDLSPSLEKH+ +VNFASY+ KNFTNYGT RAGG D+FKNY+D
Sbjct  83   LSTQLHSFCSSANLLCAPDLSPSLEKHSNDVNFASYNDKNFTNYGTTRAGGFDAFKNYSD  142

Query  471  NENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNV  650
             ENIPVDSFRRYSRDS GH+D+FSNYAP+GNV+DQ+FNTYGT++ GG GKF+NYGP VNV
Sbjct  143  GENIPVDSFRRYSRDSGGHDDKFSNYAPDGNVIDQAFNTYGTNAAGGTGKFTNYGPNVNV  202

Query  651  PDMRFTSYS  677
            P++RFTSYS
Sbjct  203  PNIRFTSYS  211


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    GG  +F +Y  N N+P ++F+ Y     G  + F+NY    NV D SF  Y
Sbjct  263  FTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNY  322

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               +  G+  F NYG   N    +FT Y
Sbjct  323  IKDTNAGEANFVNYGQSFNEGTDKFTGY  350


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 20/108 (19%)
 Frame = +3

Query  369  HAGNVNFASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHE  530
            + GN NF SY         NF NYG    G  ++F NY D  N+  DSF+ Y +D+   E
Sbjct  271  NGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNYIKDTNAGE  330

Query  531  DRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
              F NY        QSFN        G  KF+ YG   N P + F +Y
Sbjct  331  ANFVNYG-------QSFN-------EGTDKFTGYGKGANDPKVNFKTY  364



>ref|XP_009596009.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=629

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  108  GGED-SGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGG  284
            G ED SGE  NPFTPK YLIRYWKKQ+SNDL KPWFLLNKASPLNAAQYA Y+K+ AD  
Sbjct  23   GNEDNSGESGNPFTPKGYLIRYWKKQVSNDLPKPWFLLNKASPLNAAQYATYTKLVADQ-  81

Query  285  ESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNY  464
             +LSTQL  FCSSANLLC PDLSPSLEKH+ +VNFASY+ KNFTNYGT RAGG D FKNY
Sbjct  82   NALSTQLHSFCSSANLLCAPDLSPSLEKHSQDVNFASYNDKNFTNYGTTRAGGFDGFKNY  141

Query  465  TDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEV  644
            +D ENIPVDSFRRYSRDS GH+DRFSNYAP+GNV+DQSFNTYGT++ GG GKF+NYGP V
Sbjct  142  SDGENIPVDSFRRYSRDSGGHDDRFSNYAPDGNVIDQSFNTYGTNAAGGTGKFTNYGPNV  201

Query  645  NVPDMRFTSYS  677
            NVP+++FTSYS
Sbjct  202  NVPNIKFTSYS  212


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    GG  +F +Y  N N+P ++F+ Y     G  + F+NY    NV D +F  Y
Sbjct  264  FTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQANVGDDNFQNY  323

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               +  G+  F NYG   N    +FT Y
Sbjct  324  IKDTNAGEANFVNYGQSFNEGTDKFTGY  351



>ref|XP_011086565.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=634

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 162/196 (83%), Gaps = 3/196 (2%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            +V+    G DS    NPFTPK Y++RYWKKQISNDL KP FLL KASPLNAAQYA +SK+
Sbjct  27   DVVAAAAG-DSTAGENPFTPKGYVMRYWKKQISNDLPKPEFLLKKASPLNAAQYAAFSKL  85

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            A      LSTQLP FCS ANLLCFPDLSPSLEKH GNVNFASYS KNFTNYGTDR GG D
Sbjct  86   ADQ--NLLSTQLPDFCSKANLLCFPDLSPSLEKHDGNVNFASYSNKNFTNYGTDRLGGTD  143

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            SFKNY+D EN+P+DSFRRYSRDS GH D+F++YA + NVVDQSFNTYGTS+TGGKG+F N
Sbjct  144  SFKNYSDGENVPLDSFRRYSRDSTGHNDKFTSYATDANVVDQSFNTYGTSATGGKGQFDN  203

Query  630  YGPEVNVPDMRFTSYS  677
            Y  +VNVP++RFT+YS
Sbjct  204  YNSQVNVPNLRFTAYS  219


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG    G  D+F +Y  N N+P ++F+ Y        D F NY    NV D SF++Y
Sbjct  271  FNNYGESGNGANDTFTSYGTNTNVPENNFKNYGSQGNAATDTFKNYRDQSNVGDDSFDSY  330

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G +S   K  F NYG   N    +FT Y
Sbjct  331  GKNSNAAKIDFVNYGQSFNEGTDKFTGY  358



>emb|CDP00165.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 159/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  96   IGIMGGEDSGEL---SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSK  266
            +GI G   SG      +PFT KA LIRYWKKQ+SNDL KPWF LNKASPL+A Q A +SK
Sbjct  26   VGIAGAGKSGRKLAGDSPFTAKASLIRYWKKQVSNDLPKPWFFLNKASPLDAVQLATFSK  85

Query  267  MAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGV  446
            +A     SL  QLP FCS ANL+CFPDLSPSLEKH G+VNFASYSF+NFTNYGT+RAGGV
Sbjct  86   LADQ--NSLPAQLPAFCSKANLICFPDLSPSLEKHTGDVNFASYSFQNFTNYGTNRAGGV  143

Query  447  DSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFS  626
            DSFKNYT+ ENIPVD+FRRYSRDSVGH+D+F+NYA + NVVDQSFNTYGT++TGG G F 
Sbjct  144  DSFKNYTNGENIPVDAFRRYSRDSVGHDDKFTNYALDANVVDQSFNTYGTAATGGAGDFK  203

Query  627  NYGPEVNVPDMRFTSYS  677
            NY    NVP ++FTSYS
Sbjct  204  NYNDNSNVPGLKFTSYS  220


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT+YG +  G  + F +Y +N N+   +F+ Y   +    D+FS+Y  NGNV + +FN Y
Sbjct  244  FTSYGKNGNGAENDFTSYGNNSNVVGSNFKNYGETANAATDKFSSYGSNGNVPENNFNNY  303

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            G         F+NY  + NV D  F SY+
Sbjct  304  GPGGNAATETFTNYRDQSNVGDDSFQSYA  332


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 40/89 (45%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            NF NYG       D F +Y  N N+P ++F  Y        + F+NY    NV D SF +
Sbjct  271  NFKNYGETANAATDKFSSYGSNGNVPENNFNNYGPGGNAATETFTNYRDQSNVGDDSFQS  330

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y   S      F NYG   N    RFTSY
Sbjct  331  YAKGSNAATANFVNYGQSFNEGSDRFTSY  359



>gb|EYU31262.1| hypothetical protein MIMGU_mgv1a002697mg [Erythranthe guttata]
Length=646

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV    GG+ +    NPFTPK YLIRYWKKQISNDL KP FLL+KASPLNAAQ+A +SK+
Sbjct  27   NVGVAAGGDSTAAGENPFTPKGYLIRYWKKQISNDLPKPEFLLSKASPLNAAQFAAFSKL  86

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            AAD   SLSTQLP FC+ A+LLCFPDL+PSLEKH+ +VNFA+Y  KNFTNYGT R GGVD
Sbjct  87   AADQ-NSLSTQLPEFCAKADLLCFPDLTPSLEKHSSDVNFATYRNKNFTNYGTGRPGGVD  145

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            +F  Y++ EN+P+DSFRRYSRD VGH ++F+ YA   NV DQSFN+YGT++TGG G+F+ 
Sbjct  146  AFSGYSEGENLPIDSFRRYSRDGVGHNEKFTGYATEANVADQSFNSYGTAATGGGGEFTK  205

Query  630  YGPEVNVPDMRFTSYS  677
            Y  EVNVP++RFT+YS
Sbjct  206  YNSEVNVPNLRFTAYS  221



>ref|XP_009794727.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=625

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 2/193 (1%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++   +SG+  NPFTPKAYLIRYWKKQ+SN+L KPWFLLNKASPLNAAQ+A YSK+A D 
Sbjct  16   VIVAGNSGDSINPFTPKAYLIRYWKKQMSNELPKPWFLLNKASPLNAAQFATYSKLAGDQ  75

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
             ESLS ++  FCSSANLLCFPD+S SLEKH  +V F+SY  KNFTNYG+    G DSFK 
Sbjct  76   -ESLSKEISSFCSSANLLCFPDISSSLEKHGQDVQFSSYMSKNFTNYGSKLPRGFDSFKK  134

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY-gtsstggkgkFSNYGP  638
            Y +N+N+PV+SFR+YSR   GH+D+FS YAPNGNVVDQSFNTY    S GG G+F NY P
Sbjct  135  YAENDNLPVNSFRQYSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVGEFKNYAP  194

Query  639  EVNVPDMRFTSYS  677
             VNVP++RFT+YS
Sbjct  195  NVNVPNLRFTTYS  207


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +3

Query  360  LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRF  539
             + +A NVN  +     FT Y T+ AG   SF +YT + N    SF  Y R+S G  + F
Sbjct  189  FKNYAPNVNVPNL---RFTTYSTEVAGRKQSFSSYTKDTNSGDQSFTSYGRNSNGAINDF  245

Query  540  SNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            ++YA N NV+  +F  YG S  GG   F +YG   NVP+  FT+Y
Sbjct  246  TSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENTFTNY  290


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++FT+YG +  G ++ F +Y +N N+   +F  Y     G  + F +Y  N NV + +F 
Sbjct  229  QSFTSYGRNSNGAINDFTSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENTFT  288

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             YG         F NY  + NV D +FTSY
Sbjct  289  NYGADGNAPFETFINYRDKSNVGDDKFTSY  318



>ref|XP_009596020.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=628

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  114  EDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESL  293
            ++SG+  NPFTPKAYLIRYWKKQISN L KPWFLLNKASPLNAAQ+A YSK+A D  ESL
Sbjct  23   DNSGDSINPFTPKAYLIRYWKKQISNQLPKPWFLLNKASPLNAAQFATYSKLAGDQ-ESL  81

Query  294  STQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDN  473
            S ++  FCSSANLLCFPD+S SLEK+  +V F+SY  KNFTNYG+    G DSFK Y +N
Sbjct  82   SKEISSFCSSANLLCFPDISSSLEKYGQDVQFSSYMSKNFTNYGSKLPRGFDSFKKYAEN  141

Query  474  ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY-gtsstggkgkFSNYGPEVNV  650
            +N+PV+SFR+YSR   GH+D+FS YAPNGNVVDQSFNTY    S GG  +F NY P VNV
Sbjct  142  DNLPVNSFRQYSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVSEFKNYAPNVNV  201

Query  651  PDMRFTSYS  677
            P++RFT+YS
Sbjct  202  PNLRFTTYS  210


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +3

Query  360  LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRF  539
             + +A NVN  +     FT Y T+ AG   SF +YT + N    SF  Y ++S G  + F
Sbjct  192  FKNYAPNVNVPNL---RFTTYSTEVAGRKQSFTSYTKDTNSGDQSFTSYGKNSNGAVNDF  248

Query  540  SNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            ++YA N NV+  +F  YG S  GG   F +YG   NVP+  F +Y
Sbjct  249  TSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENSFKNY  293


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++FT+YG +  G V+ F +Y +N N+   +F  Y     G  + F +Y  N NV + SF 
Sbjct  232  QSFTSYGKNSNGAVNDFTSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENSFK  291

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             YG         F NY  + NV D +FTSY
Sbjct  292  NYGVDGNAPFETFINYRDKSNVGDDKFTSY  321


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 42/88 (48%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    GG ++FK+Y  N N+P +SF+ Y  D     + F NY    NV D  F +Y
Sbjct  262  FTNYGESGNGGGNTFKSYGSNANVPENSFKNYGVDGNAPFETFINYRDKSNVGDDKFTSY  321

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
                  GK  F NYG         F+ Y
Sbjct  322  VDDPNAGKANFENYGQSFGEGSDTFSKY  349



>ref|XP_006365227.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=629

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 3/186 (2%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            GE  NPFTPK YLIRYWKKQISN+L KPWFLLNKASPLNAAQYA Y+K+ AD   +L+TQ
Sbjct  29   GESGNPFTPKGYLIRYWKKQISNELPKPWFLLNKASPLNAAQYATYTKLVAD-QNALTTQ  87

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GVDSFKNYTDNEN  479
            L  FCSSANL+C PDLSPSLEKH+G ++FA+YS KNFTNYGT+  G GV++FKNY+D EN
Sbjct  88   LHTFCSSANLMCAPDLSPSLEKHSGEIHFATYSDKNFTNYGTNEPGIGVNTFKNYSDGEN  147

Query  480  IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDM  659
            IPV+SFRRY R S   +++F NYAP+GNV+DQSFN+Y TS+ GG G+F+NY    NVP++
Sbjct  148  IPVNSFRRYGRGSP-RDNKFDNYAPDGNVIDQSFNSYSTSTAGGSGEFTNYAANTNVPNL  206

Query  660  RFTSYS  677
             FTSYS
Sbjct  207  HFTSYS  212



>ref|XP_006365226.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=625

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  114  EDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESL  293
            E+SG+  NPFTPKAY IRYW K+ISN L KPWFLLNKASPLNAAQ+A YSK+A    ESL
Sbjct  23   ENSGDSVNPFTPKAYSIRYWNKRISNKLPKPWFLLNKASPLNAAQFAKYSKLATGDQESL  82

Query  294  STQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDN  473
            S ++  FCSSANLLCFPD+S SL+KH  +  F+SY+ KNFTNYG    GG DSFK Y +N
Sbjct  83   SNEIQSFCSSANLLCFPDISTSLDKHGQDTQFSSYTSKNFTNYGNKLPGGFDSFKKYAEN  142

Query  474  ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstg-gkgkFSNYGPEVNV  650
            +N+PV+SFR+YSR   GH+D FS YAPNGNV+DQSFNTYGT     G G+F  YGP VNV
Sbjct  143  DNLPVNSFRQYSRGGAGHDDIFSTYAPNGNVIDQSFNTYGTGLAAFGVGQFKIYGPNVNV  202

Query  651  PDMRFTSYS  677
            P++RFT+YS
Sbjct  203  PNLRFTTYS  211


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT Y T+  G   SF +Y+ + N    SF  Y+R++ G  + F++YA N NV+  +F  Y
Sbjct  207  FTTYSTEGVGRKQSFTSYSKDTNSGSQSFTSYARNANGAVNDFTSYANNSNVIGSTFTNY  266

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G S  GG   F++YG   NVP   F SY
Sbjct  267  GESENGGGNTFNSYGSNANVPKNTFKSY  294



>ref|NP_001234835.1| polygalacturonase-1 non-catalytic subunit beta precursor [Solanum 
lycopersicum]
 sp|Q40161.1|GP1_SOLLC RecName: Full=Polygalacturonase-1 non-catalytic subunit beta; 
AltName: Full=AroGP1; AltName: Full=Polygalacturonase converter; 
Short=PG converter; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34181.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
 gb|AAB39547.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
Length=630

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG+  GE  NPFTPK YLIRYWKKQISNDL KPWFLLNKASPLNAAQYA Y+K+ AD 
Sbjct  25   VVGGD--GESGNPFTPKGYLIRYWKKQISNDLPKPWFLLNKASPLNAAQYATYTKLVAD-  81

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GVDSFK  458
              +L+TQL  FCSSANL+C PDLSPSLEKH+G+++FA+YS KNFTNYGT+  G GV++FK
Sbjct  82   QNALTTQLHTFCSSANLMCAPDLSPSLEKHSGDIHFATYSDKNFTNYGTNEPGIGVNTFK  141

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NY++ ENIPV+SFRRY R S   +++F NYA +GNV+DQSFN+Y TS+ GG GKF+NY  
Sbjct  142  NYSEGENIPVNSFRRYGRGSP-RDNKFDNYASDGNVIDQSFNSYSTSTAGGSGKFTNYAA  200

Query  639  EVNVPDMRFTSYS  677
              N P++ FTSYS
Sbjct  201  NANDPNLHFTSYS  213


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    GG   F +Y  N N+P + F  Y     G  + F++Y    NV D +F TY
Sbjct  265  FTNYGQTANGGDQKFTSYGFNGNVPENHFTNYGAGGNGPSETFNSYRDQSNVGDDTFTTY  324

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + GG+  F+NYG   N     FT+Y
Sbjct  325  VKDANGGEANFTNYGQSFNEGTDVFTTY  352



>ref|XP_008340027.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=636

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV     G  SG   NPF+PKAYL+RYW K++ ND  KP FLL+KASPLNA   A ++K+
Sbjct  24   NVALAANGGSSGAAENPFSPKAYLVRYWSKEVRNDAEKPSFLLSKASPLNAVDSAAFAKL  83

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            AA  G  LST+LP FCS+ANLLCFPDL+PSLEKH  N NFA Y+ KNFTNYGTDR  GVD
Sbjct  84   AAQNG--LSTRLPEFCSAANLLCFPDLAPSLEKHDKNANFAVYTDKNFTNYGTDRLAGVD  141

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            SFKNY+  EN+PVDSFRRYSRDSV H+D+F++YA +GNVVDQSFN+Y   STGG G F  
Sbjct  142  SFKNYSIGENLPVDSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNSYAGGSTGGAGDFKK  201

Query  630  YGPEVNVPDMRFTSYS  677
            Y   VNVP + F SYS
Sbjct  202  YADSVNVPHLGFNSYS  217


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  D F NY +++N P ++FR Y        + F++Y  + NV   SF +Y
Sbjct  269  FTGYGQSGNGANDKFNNYGNDQNNPTNNFRSYGDGGNAGVETFTSYRDSANVGXDSFQSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S G K  F+NYG   NV   +FT Y
Sbjct  329  AKNSNGQKMDFTNYGKSFNVGSDKFTGY  356



>ref|XP_004238669.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum lycopersicum]
Length=622

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  114  EDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESL  293
            E+SG+  NPFTPKAY IRYW K+ISN L KPWFLLNKASPLNAAQ+A YSK+A    ESL
Sbjct  23   ENSGDSVNPFTPKAYSIRYWNKRISNKLPKPWFLLNKASPLNAAQFAKYSKLATGDQESL  82

Query  294  STQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDN  473
            S ++  FCSSANLLCFPD+S SL+KH  +  F+SY  KNFTNYG     G DSFK Y +N
Sbjct  83   SNEIQSFCSSANLLCFPDISTSLDKHGQDTQFSSYMSKNFTNYGNKLPRGFDSFKKYAEN  142

Query  474  ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstg-gkgkFSNYGPEVNV  650
            +N+PV+SFR+YSR   GH+D FS YAPNGNV+DQSFNTYGT     G G+F  YG  VNV
Sbjct  143  DNLPVNSFRQYSRGGAGHDDIFSTYAPNGNVIDQSFNTYGTGLAAFGVGQFKIYGANVNV  202

Query  651  PDMRFTSYS  677
            P++RFT+YS
Sbjct  203  PNLRFTTYS  211


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT Y T+  G   SF +Y+ + N    SF  Y+R++ G +  F++YA N NV+  +F  Y
Sbjct  207  FTTYSTEGVGRKQSFTSYSKDTNSGTQSFTSYARNANGADSDFTSYANNSNVIGSTFTNY  266

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G S  GG   F++YG   NVP   F SY
Sbjct  267  GESENGGGYTFNSYGSNANVPKNTFKSY  294



>gb|EPS67761.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=608

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 148/185 (80%), Gaps = 1/185 (1%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            GE  +PFTP+ Y++RYWK+QIS+DLA+P FL+ KASPL AA YA ++K+A D   SLS +
Sbjct  3    GEGESPFTPRGYILRYWKRQISSDLAQPDFLMEKASPLTAADYAAFAKIAGDQ-NSLSAR  61

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            LP FC  A LLCFPD SPSLEKH G+VNFA+Y  +NFTNYG+ R GG DSF+NY++N+N+
Sbjct  62   LPEFCKKAKLLCFPDSSPSLEKHDGDVNFATYLDQNFTNYGSKRVGGADSFRNYSENDNV  121

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
             VD+FRRYSR S GH+D FS YA + NV+DQSFNTYG    GG+GKFSNY  +VNVP++R
Sbjct  122  VVDTFRRYSRGSTGHDDGFSAYATSSNVIDQSFNTYGAGGNGGEGKFSNYNSDVNVPNLR  181

Query  663  FTSYS  677
            FTSYS
Sbjct  182  FTSYS  186


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            NF NYG     G D+F +Y +N+N+P ++F+ Y+    G  D FS+Y    NV D SF++
Sbjct  237  NFNNYGESGNAGSDNFTSYGENQNVPENNFKNYAAGGNGATDAFSSYRDQANVGDDSFDS  296

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            YG  S G K  FSNYG   N    +FT Y
Sbjct  297  YGKESNGAKLGFSNYGQSFNEGTDKFTGY  325



>ref|XP_004514684.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X1 [Cicer arietinum]
 ref|XP_004514685.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X2 [Cicer arietinum]
Length=630

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = +3

Query  105  MGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGG  284
            +GG+      NPFTPKA+L RYW K+I N L KP FL +KASPL   + A ++K+AA  G
Sbjct  22   IGGDAVAGDKNPFTPKAFLNRYWDKEIRNSLPKPSFLFSKASPLTTVEAATFAKLAA--G  79

Query  285  ESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNY  464
             +LST+LP FCS+A LLCFP++SPSLEKH  + NFA Y  KNFTNYGT R GGVDSFKNY
Sbjct  80   NTLSTRLPEFCSAAKLLCFPEVSPSLEKHDKDANFAVYQDKNFTNYGTSRPGGVDSFKNY  139

Query  465  TDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEV  644
            +D ENIPV+ FRRYSRDS GH+D F+NYA +GNVVDQSF+TYG  +TGG G+F+NY  E 
Sbjct  140  SDGENIPVNDFRRYSRDSAGHKDSFTNYAKDGNVVDQSFHTYGAGATGGAGEFNNYAEET  199

Query  645  NVPDMRFTSYS  677
            NVP++ FTSYS
Sbjct  200  NVPNLVFTSYS  210


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT+Y  D  G   SF +Y++N N    SF  Y ++  G  + F++Y  + NVV   F+ Y
Sbjct  206  FTSYSDDSNGRKQSFTSYSENGNAGEQSFSSYGKNGNGPTEEFTSYGTSSNVVGSGFSNY  265

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSYS  677
              +S      F  YG ++N P   FT+Y+
Sbjct  266  AETSNAANDSFKAYGVDMNNPTNTFTNYA  294



>ref|XP_006365231.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase non-catalytic 
subunit AroGP3-like [Solanum tuberosum]
Length=628

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 150/197 (76%), Gaps = 6/197 (3%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV+    G+ SG   NPFTPK YLIRYW K +SNDL KPWFLLNKASPL+AAQYA Y+K+
Sbjct  23   NVVVAKDGDKSG---NPFTPKGYLIRYWNKHVSNDLPKPWFLLNKASPLSAAQYAAYTKL  79

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GV  446
             AD   +L+T L  FCSSANL+C PDLSPSLEKH G+V+F SY  KNFTNYGT   G G 
Sbjct  80   VAD-QNALTTHLQSFCSSANLMCAPDLSPSLEKHKGDVHFVSYGDKNFTNYGTKEFGLGF  138

Query  447  DSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFS  626
            +SFKNYT++EN PV+SFRRY RDS  H+++F NY P GN   QSFN+Y T++ GG G+F+
Sbjct  139  NSFKNYTEDENFPVNSFRRYGRDSP-HDNQFDNYGPGGNTPVQSFNSYSTNTPGGSGQFT  197

Query  627  NYGPEVNVPDMRFTSYS  677
            NY P  NVPD+ FTSYS
Sbjct  198  NYAPGANVPDLHFTSYS  214



>ref|XP_006365228.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=632

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            N++    GE+SG+  NPFTPK YLIRYWKK +SNDL KPWFLLNKASPLNAAQYA Y+K+
Sbjct  23   NIVVAGDGENSGDAGNPFTPKGYLIRYWKKHVSNDLPKPWFLLNKASPLNAAQYATYTKL  82

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GV  446
             AD   +L+T L  FCSSANL+C  DLSPSL KH G+++F +Y  KNFTNYGT+  G GV
Sbjct  83   VAD-QNALTTHLQSFCSSANLMCASDLSPSLVKHTGDIHFTTYGNKNFTNYGTNEPGIGV  141

Query  447  DSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFS  626
            +SFKNY+  E+  V+SFRRY R S   +++F NYAP+GNV+DQSFN+Y T++ GG GKF+
Sbjct  142  NSFKNYS--EDASVNSFRRYGRGSP-RDNKFDNYAPDGNVIDQSFNSYSTNTPGGSGKFT  198

Query  627  NYGPEVNVPDMRFTSYS  677
            NY P  NVPD+RFT+YS
Sbjct  199  NYAPNTNVPDLRFTAYS  215



>gb|KDO82433.1| hypothetical protein CISIN_1g036311mg [Citrus sinensis]
Length=632

 Score =   236 bits (603),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 152/200 (76%), Gaps = 6/200 (3%)
 Frame = +3

Query  90   NVIGIMGG---EDSGEL-SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAG  257
            N +  +GG    DS ++  NPFTPKA+LIRYW K+I ++L K  FLL+KASPLNA   A 
Sbjct  21   NHVNYLGGTEISDSIDMKQNPFTPKAHLIRYWDKEIRSNLPKSPFLLSKASPLNAVDSAS  80

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRA  437
            ++K+AA    +LS+ LP FCSSA L CFPDLS SLEKH  + NFA Y  KNFTNYGT R 
Sbjct  81   FAKLAAQ--NALSSVLPSFCSSAKLFCFPDLSNSLEKHDTDSNFARYLNKNFTNYGTSRV  138

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG DSFKNY+D +N+PVDSFRRYSRD+VGH+D+FSNYAP  NV DQSFNTYG S++GG G
Sbjct  139  GGADSFKNYSDGDNLPVDSFRRYSRDAVGHQDKFSNYAPGSNVADQSFNTYGASASGGAG  198

Query  618  kFSNYGPEVNVPDMRFTSYS  677
             F NY  EVNVP +RFTSY+
Sbjct  199  SFKNYNEEVNVPHLRFTSYA  218


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 42/90 (47%), Gaps = 0/90 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            + F NYG +  G  ++F  Y    N+    F  Y   + G  D F++Y  +GNV +  FN
Sbjct  240  EEFANYGKNANGAPNAFTGYGKETNVIGSGFSNYGEGANGANDSFTSYGEDGNVPNNRFN  299

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             YG         FSNY  + NV D  F SY
Sbjct  300  NYGAGGNAAVESFSNYRDQANVGDDSFQSY  329



>ref|XP_010242994.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=641

 Score =   236 bits (603),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA++IRYW KQISN+L KP FLL+KASPL+       +K+A     +LS++LP F
Sbjct  42   NPFTAKAFVIRYWNKQISNNLPKPSFLLSKASPLSTVDSVVLTKLADQ--NALSSRLPSF  99

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CSSANL CF DL+PSL+KH  + NFASYS +NFTNYGT + GGVDSFKNY+DN N+PVDS
Sbjct  100  CSSANLFCFSDLTPSLDKHDKDSNFASYSNRNFTNYGTSQLGGVDSFKNYSDNINVPVDS  159

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYSR S GH D+FSNYAPNGNVVDQSFNTYG+S+TGG G F+NY   VN+P++RFTSY
Sbjct  160  FRRYSRGSTGHNDKFSNYAPNGNVVDQSFNTYGSSATGGSGDFTNYNQLVNIPNLRFTSY  219



>ref|XP_008221810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=632

 Score =   236 bits (602),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 145/196 (74%), Gaps = 2/196 (1%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV     G + G + NPF+PKAYL RYW K++ ND  KP FLL+KASPL A   A ++K+
Sbjct  24   NVALTAAGRNLGAVENPFSPKAYLARYWNKEVRNDAEKPSFLLSKASPLTAVDSAAFAKL  83

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            A+  G  LS++LP FC+SANLLCF DL  SLEKH  +  F +Y+ KNFTNYGTDR  GVD
Sbjct  84   ASQNG--LSSKLPEFCASANLLCFSDLGQSLEKHDKDSTFTTYAAKNFTNYGTDRLAGVD  141

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            SFKNY+ +EN+PVDSFRRYSRDSV H+D+F+NYA  GNVVDQSFN+Y   +T G G+F  
Sbjct  142  SFKNYSIDENLPVDSFRRYSRDSVNHKDQFTNYASGGNVVDQSFNSYAGGATSGTGEFKK  201

Query  630  YGPEVNVPDMRFTSYS  677
            Y   VNVP++RF SYS
Sbjct  202  YADSVNVPNLRFNSYS  217


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 3/105 (3%)
 Frame = +3

Query  360  LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRF  539
             +K+A +VN  +     F +Y  D  G   SF +YT+N N    SF  YS++  G  + F
Sbjct  199  FKKYADSVNVPNL---RFNSYSDDSNGRAQSFTSYTENGNAGDQSFTSYSKNGNGAPNEF  255

Query  540  SNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + Y  + NVV   F  YG +  G   KF+NYG ++N P  RF SY
Sbjct  256  TGYGTSSNVVGSGFTGYGETGNGANDKFNNYGKDMNNPVNRFKSY  300


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  D F NY  + N PV+ F+ Y        + F++Y    NV + SF +Y
Sbjct  269  FTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDGGNAAVETFTSYRDKANVGEDSFQSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S G K  F+NYG   NV   +FT Y
Sbjct  329  AKNSNGEKINFANYGKSFNVGFDKFTGY  356



>ref|XP_006438394.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
 ref|XP_006483846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
 gb|ESR51634.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
Length=632

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 6/200 (3%)
 Frame = +3

Query  90   NVIGIMGG---EDSGEL-SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAG  257
            N +  +GG    DS ++  NPFTPKA+LIRYW K+I ++L K  FLL+KASPLNA   A 
Sbjct  21   NHVNYLGGTEISDSIDMKQNPFTPKAHLIRYWDKEIRSNLPKSPFLLSKASPLNAVDSAS  80

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRA  437
            ++K+AA    +LS+ LP FCSSA L CFPDLS SLEKH  + NFA Y  KNFTNYGT R 
Sbjct  81   FAKLAAQ--NALSSVLPSFCSSAKLFCFPDLSNSLEKHDTDSNFARYLNKNFTNYGTSRV  138

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG DSFKNY+D +N+PVDSFRRYSRD+VGH D+FSNYAP  NV DQSFNTYG S++GG G
Sbjct  139  GGADSFKNYSDGDNLPVDSFRRYSRDAVGHHDKFSNYAPGSNVADQSFNTYGASASGGAG  198

Query  618  kFSNYGPEVNVPDMRFTSYS  677
             F NY  EVNVP +RFTSY+
Sbjct  199  SFKNYNEEVNVPHLRFTSYA  218


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 42/90 (47%), Gaps = 0/90 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            + F NYG +  G  ++F  Y    N+    F  Y   + G  D F++Y  +GNV +  FN
Sbjct  240  EEFANYGKNANGAPNAFTGYGKETNVIGSGFSNYGEGANGANDSFTSYGEDGNVPNNRFN  299

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             YG         FSNY  + NV D  F SY
Sbjct  300  NYGAGGNAAVESFSNYRDQANVGDDSFQSY  329



>ref|XP_006365229.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=611

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 151/196 (77%), Gaps = 6/196 (3%)
 Frame = +3

Query  93   VIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA  272
            V+    G+ SG   NPFTPK YLIRYW K +SNDL KPWFLLNKASPL+AAQYA YSK+ 
Sbjct  3    VVVARNGDKSG---NPFTPKGYLIRYWSKHVSNDLPKPWFLLNKASPLSAAQYATYSKLV  59

Query  273  ADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GVD  449
             D   +L+TQL  FCSSANL+C PDLSPSLEKH G+++FASY  KNFTNYGT  +G G +
Sbjct  60   TD-QNALTTQLQSFCSSANLMCAPDLSPSLEKHTGDIHFASYGDKNFTNYGTKESGVGFN  118

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            SFKNY+D  N PV+SFRRYSRDS  H+++F NYAP+GNV DQSFN+Y  ++ GG G+F+N
Sbjct  119  SFKNYSDEGNFPVNSFRRYSRDSP-HDNQFDNYAPDGNVPDQSFNSYSKNTPGGSGQFNN  177

Query  630  YGPEVNVPDMRFTSYS  677
            Y P  NV +M F SY+
Sbjct  178  YDPNSNVANMGFNSYA  193


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 45/89 (51%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +FT+Y     GG + FK+Y+D+ N  V SF+ Y +D  G   +F  Y    N    +FN 
Sbjct  217  HFTSYSDHGTGGEEEFKSYSDDANGGVQSFKNYGKDGNGPNGKFIEYGNKANDPQNNFNN  276

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            YG    G    F+NY  +  + D +FT Y
Sbjct  277  YGVEGNGISETFTNYRDQSTLGDDKFTVY  305



>ref|XP_006365230.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=627

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 151/197 (77%), Gaps = 6/197 (3%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV+    G+ SG   NPFTPK YLIRYW K +SNDL KPWFLLNKASPLNAAQYA YSK+
Sbjct  23   NVVVARNGDKSG---NPFTPKGYLIRYWNKHVSNDLPKPWFLLNKASPLNAAQYATYSKL  79

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GV  446
             AD   +L+TQL  FCSSANL+C PDLSPSLEKH G+++FASY  KNFTNYGT  AG GV
Sbjct  80   VAD-QNALTTQLQSFCSSANLMCAPDLSPSLEKHTGDIHFASYGNKNFTNYGTKEAGIGV  138

Query  447  DSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFS  626
            +SFKNYT+ EN P++SFRRY RDS   +++F NY P+GN   QSFN+Y T++ GG GKF+
Sbjct  139  NSFKNYTEEENFPMNSFRRYGRDSP-RDNQFDNYGPDGNTAVQSFNSYSTNTPGGSGKFN  197

Query  627  NYGPEVNVPDMRFTSYS  677
            NYGP  N  +M F SY+
Sbjct  198  NYGPNSNDANMGFNSYA  214



>ref|XP_009363553.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363554.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X3 [Pyrus x bretschneideri]
Length=632

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV     G  SG   NPF+PKAYL+RYW K++ ND  KP FLL+KASPL+A   A ++K+
Sbjct  24   NVAIAAAGGSSGATENPFSPKAYLVRYWNKEVQNDAEKPSFLLSKASPLDAVGSAAFAKL  83

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            AA  G  LST+LP FCS+ANLLCFPDL+ SLEKH  + NFA Y+ KNFTNYGTDR  GVD
Sbjct  84   AAQNG--LSTRLPEFCSAANLLCFPDLAQSLEKHDKDANFAVYADKNFTNYGTDRLAGVD  141

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            SFKNY+  EN+PVDSFRRYSRDSV H+D+F++YA +GNVVDQSFN Y   +TGG G F  
Sbjct  142  SFKNYSLGENLPVDSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAGATGGAGDFKK  201

Query  630  YGPEVNVPDMRFTSYS  677
            Y   VNVP + F SYS
Sbjct  202  YADSVNVPHLGFNSYS  217


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  D F NY +++N P ++F+ Y        + F++Y    NV D SF +Y
Sbjct  269  FTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDGGNAGVETFTSYRERANVGDDSFQSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S G K  F++YG   N+   +FT Y
Sbjct  329  AKNSNGEKMDFTSYGKSFNIGSDKFTGY  356


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 3/105 (3%)
 Frame = +3

Query  360  LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRF  539
             +K+A +VN     F ++++    R+ G   F  Y++N N    SF  YS++  G  + F
Sbjct  199  FKKYADSVNVPHLGFNSYSDDSNGRSHG---FTGYSENANAGDQSFTSYSKNGNGAPNEF  255

Query  540  SNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + Y  N NVV   F  YG S  G   KF+NYG + N P   F SY
Sbjct  256  TGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSY  300



>ref|XP_009363551.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Pyrus x bretschneideri]
Length=646

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV     G  SG   NPF+PKAYL+RYW K++ ND  KP FLL+KASPL+A   A ++K+
Sbjct  24   NVAIAAAGGSSGATENPFSPKAYLVRYWNKEVQNDAEKPSFLLSKASPLDAVGSAAFAKL  83

Query  270  AADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            AA  G  LST+LP FCS+ANLLCFPDL+ SLEKH  + NFA Y+ KNFTNYGTDR  GVD
Sbjct  84   AAQNG--LSTRLPEFCSAANLLCFPDLAQSLEKHDKDANFAVYADKNFTNYGTDRLAGVD  141

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            SFKNY+  EN+PVDSFRRYSRDSV H+D+F++YA +GNVVDQSFN Y   +TGG G F  
Sbjct  142  SFKNYSLGENLPVDSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAGATGGAGDFKK  201

Query  630  YGPEVNVPDMRFTSYS  677
            Y   VNVP + F SYS
Sbjct  202  YADSVNVPHLGFNSYS  217


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  D F NY +++N P ++F+ Y        + F++Y    NV D SF +Y
Sbjct  269  FTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDGGNAGVETFTSYRERANVGDDSFQSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S G K  F++YG   N+   +FT Y
Sbjct  329  AKNSNGEKMDFTSYGKSFNIGSDKFTGY  356


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 3/105 (3%)
 Frame = +3

Query  360  LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRF  539
             +K+A +VN     F ++++    R+ G   F  Y++N N    SF  YS++  G  + F
Sbjct  199  FKKYADSVNVPHLGFNSYSDDSNGRSHG---FTGYSENANAGDQSFTSYSKNGNGAPNEF  255

Query  540  SNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + Y  N NVV   F  YG S  G   KF+NYG + N P   F SY
Sbjct  256  TGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSY  300



>ref|XP_010100469.1| hypothetical protein L484_027781 [Morus notabilis]
 gb|EXB82603.1| hypothetical protein L484_027781 [Morus notabilis]
Length=608

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = +3

Query  96   IGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAA  275
            + + GGE+     NPF+PKA+LIRYW K+I ND+ KP FLL+KASPL A Q A ++K+AA
Sbjct  5    LAVAGGEE-----NPFSPKAHLIRYWNKEIRNDIEKPSFLLSKASPLTAVQTAVFAKLAA  59

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
                SLST+LP FCS+A+LLCFPDL PSLE H  + +F+ Y  +NFTNYGTDR GG D F
Sbjct  60   Q--NSLSTRLPEFCSAAHLLCFPDLGPSLESHDKDSSFSGYVDRNFTNYGTDRIGGADVF  117

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            KNY+   NIPV+SFR YSR S GH+D+F NYA  GNVVDQSFNTY T +TGG G FS Y 
Sbjct  118  KNYSPEVNIPVNSFRSYSRHSTGHDDKFHNYAFEGNVVDQSFNTYATKTTGGAGDFSKYA  177

Query  636  PEVNVPDMRFTSYS  677
              VNVP++RFTSYS
Sbjct  178  ESVNVPNLRFTSYS  191


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 6/128 (5%)
 Frame = +3

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSF------KNFTNYGTDRAGGVDSFKNYTDN  473
            +  S N+      S S + +    NF  YS       ++F+NYG D  G  + F +Y ++
Sbjct  176  YAESVNVPNLRFTSYSFQTNGREQNFKGYSVNANSGDQSFSNYGKDGNGAENDFSSYGNS  235

Query  474  ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVP  653
             N+    F  Y R S G +D F+ YA +GN    +F  YG  +     KF++Y  + NV 
Sbjct  236  SNVIGSEFSSYQRTSNGGQDTFTAYAFDGNNPQNNFRNYGDGANAAVEKFTSYRDQSNVG  295

Query  654  DMRFTSYS  677
            D  F SY+
Sbjct  296  DDSFQSYA  303



>ref|XP_004238668.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2 [Solanum 
lycopersicum]
 sp|P93217.1|GP2_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP2; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39556.1| AROGP2 [Solanum lycopersicum]
Length=629

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 150/193 (78%), Gaps = 5/193 (3%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            I+  +D  E  NPFTPK Y+IRYW K +SNDL KPWFLLNKASPLNAAQYA Y+K+ AD 
Sbjct  24   IVVAKDGDESGNPFTPKGYVIRYWNKHVSNDLPKPWFLLNKASPLNAAQYATYTKLVAD-  82

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GVDSFK  458
              +LST L  FCSSANL+C PDL PSLEKH G+++F +Y  KNFTNYGT+  G GV++FK
Sbjct  83   QNALSTHLQSFCSSANLMCAPDLLPSLEKHTGDIHFTTYGNKNFTNYGTNEPGIGVNTFK  142

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NY+  E+  V+SFRRY R S   +++F NYAP+GNV+DQSFN+Y T++ GG G+F+NY P
Sbjct  143  NYS--EDASVNSFRRYGRGSP-RDNKFDNYAPDGNVIDQSFNSYSTNTPGGSGQFTNYAP  199

Query  639  EVNVPDMRFTSYS  677
              NVPD+RFT+YS
Sbjct  200  NTNVPDLRFTAYS  212



>ref|XP_011071083.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=628

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 7/195 (4%)
 Frame = +3

Query  93   VIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA  272
            V+  + GE      NPFTPK Y++RYWKKQISN+L +P FLL+KASPL AA+YA + K+ 
Sbjct  26   VLAALAGE------NPFTPKGYVVRYWKKQISNNLPEPSFLLDKASPLTAAEYASFCKLV  79

Query  273  ADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDS  452
             D   +LST LP FC+ ANL+CFPDLSPSLEKH  NV+FA+Y  KNFTNYG DR GGVDS
Sbjct  80   NDQ-NALSTHLPLFCTKANLICFPDLSPSLEKHMDNVDFATYLNKNFTNYGGDRLGGVDS  138

Query  453  FKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNY  632
            FKNY+D +N+  D+FRRYSRD+VGH ++F++YA   N+ DQSF+ YGT+STGG G+FSNY
Sbjct  139  FKNYSDGDNVVSDNFRRYSRDAVGHNEKFTSYATEVNMADQSFSGYGTASTGGDGEFSNY  198

Query  633  GPEVNVPDMRFTSYS  677
               VNVP++RF  Y+
Sbjct  199  NHGVNVPNLRFNEYA  213



>gb|KDP26581.1| hypothetical protein JCGZ_17739 [Jatropha curcas]
Length=629

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = +3

Query  96   IGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAA  275
            + + GG       +P TPKAYLIRYW K+I N+L +  F+L KASPLNA     +SK+A 
Sbjct  22   VSLAGGRRLLAGESPLTPKAYLIRYWNKEIHNNLPQSSFILAKASPLNAVDAVTFSKLAE  81

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
                +LS++LP FCSSA+L CFPDLSPSLEKH  + +F  YS +NFTNYGT RAGG+DSF
Sbjct  82   K--NALSSKLPDFCSSAHLFCFPDLSPSLEKHTDDSDFTRYSNQNFTNYGTSRAGGLDSF  139

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            KNY+D ENIPVDSFRRY R++ GH + F+NYA +GNVVDQSFNTYG  +TGG G+F  Y 
Sbjct  140  KNYSDGENIPVDSFRRYGRNAAGHNETFANYAHDGNVVDQSFNTYGHGATGGTGEFKKYN  199

Query  636  PEVNVPDMRFTSYS  677
             +VNVP++RFTSYS
Sbjct  200  EQVNVPNLRFTSYS  213


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT+Y  D       F +YT+N N   ++F+ Y ++     D FS Y  N NV+   F++Y
Sbjct  209  FTSYSDDANAKGQKFTSYTENTNSGSEAFKSYGKNGNAIADEFSRYGENSNVIGSDFDSY  268

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G         F +YG   NVP+  F +Y
Sbjct  269  GAKGNAANDTFKSYGFNGNVPENNFKNY  296



>ref|XP_011034135.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=636

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = +3

Query  105  MGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGG  284
            +G  DS    +PFTPKA L+RYWKK+I   L K  FL++KASPLN    A ++K+A+   
Sbjct  26   VGSGDSPNGESPFTPKASLVRYWKKEIHTVLPKSGFLISKASPLNPVDLATFAKLASQ--  83

Query  285  ESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNY  464
             +LS QLP FCSSA L CFPDLSPSLEKH  + +FA Y+ KNFTNYGTDRAGG DSFKNY
Sbjct  84   NALSAQLPAFCSSAKLFCFPDLSPSLEKHDHDSHFAIYNNKNFTNYGTDRAGGADSFKNY  143

Query  465  TDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEV  644
            +D +NIPVDSFRRY RD+ GH + FSNYAP  NVVDQSFNTYG S+TGG G+F  Y  EV
Sbjct  144  SDGDNIPVDSFRRYGRDAAGHGETFSNYAPESNVVDQSFNTYGASATGGTGEFKGYNVEV  203

Query  645  NVPDMRFTSYS  677
            N P++RF SYS
Sbjct  204  NNPNLRFASYS  214



>ref|XP_004238667.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP3 [Solanum 
lycopersicum]
 sp|P93218.1|GP3_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP3; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39557.1| AROGP3 [Solanum lycopersicum]
Length=632

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 146/194 (75%), Gaps = 4/194 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++  +D  E  NPFTPK YLIRYW K +SNDL KPWFLLNKASPLNAAQYA Y+K+ AD 
Sbjct  24   VVVAKDGDESGNPFTPKGYLIRYWNKHVSNDLPKPWFLLNKASPLNAAQYATYTKLVAD-  82

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG-GVDSFK  458
              + +T L  FCSSANL+C  DL PSLEKH G+V+F SY  KNFTNYGT  +G G +SFK
Sbjct  83   QNAFTTHLQSFCSSANLMCALDLLPSLEKHKGDVHFVSYGDKNFTNYGTKESGLGFNSFK  142

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNY-APNGNVVDQSFNTYgtsstggkgkFSNYG  635
            NYT+ EN PV+SFRRY RDS  H+++F NY AP GN   QSFN+Y T++ GG G+F+NY 
Sbjct  143  NYTEEENFPVNSFRRYGRDSP-HDNQFDNYGAPGGNTPVQSFNSYSTNTPGGSGQFTNYA  201

Query  636  PEVNVPDMRFTSYS  677
            P  NVPD+ FTSYS
Sbjct  202  PGSNVPDLHFTSYS  215



>ref|XP_004298578.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Fragaria vesca subsp. vesca]
Length=624

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 137/181 (76%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+PK YL RYW K++ ND   P FLL+KASPL+A Q A ++K+A++   +L T+LP F
Sbjct  33   NPFSPKGYLTRYWNKEVRNDAVGPTFLLSKASPLSAVQSASFAKLASE--NALQTKLPEF  90

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS+A LLCFPDL  SLEKH  + +F  YS +NFTNYGTDR  G DSFKNY+  EN+PVDS
Sbjct  91   CSAAKLLCFPDLGESLEKHVKDASFTGYSGRNFTNYGTDRLAGADSFKNYSLGENLPVDS  150

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYSRDSV H+D+F+NYA +GNV+DQSFN+Y   +T G G F  Y    NVP++RFTSY
Sbjct  151  FRRYSRDSVNHKDKFNNYAADGNVIDQSFNSYAAGATSGTGDFKRYADSTNVPNLRFTSY  210

Query  675  S  677
            S
Sbjct  211  S  211


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 44/89 (49%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +FT Y     G  D+F NY ++EN P + F+ Y        ++FSNY    NV + SF +
Sbjct  262  DFTGYSESGNGINDTFTNYGNDENNPTERFKSYGDGGNAGSEKFSNYRDKANVGESSFQS  321

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            YG +S   K  F NYG   N     FT Y
Sbjct  322  YGKNSNSDKVSFVNYGKSFNNGSESFTGY  350



>ref|XP_008389645.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=632

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 139/181 (77%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+PKAYL+RYW K++ ND  KP FLL+KASPLN    A ++K+AA  G  LST+LP F
Sbjct  39   NPFSPKAYLVRYWNKEVRNDAEKPSFLLSKASPLNTVDSAAFAKLAAQNG--LSTRLPEF  96

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS+ANLLCFPDL+ SLEKH  + NFA Y+ KNFTNYGTDR  GVDSFKNY+   NIPVDS
Sbjct  97   CSAANLLCFPDLAQSLEKHDKDANFAIYADKNFTNYGTDRLAGVDSFKNYSLGNNIPVDS  156

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYSRDSV H+D+F++YA +GNVVDQSFN Y   +TGG G F  Y   VNVP + F SY
Sbjct  157  FRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAGATGGAGDFKKYADSVNVPHLGFNSY  216

Query  675  S  677
            S
Sbjct  217  S  217


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 3/105 (3%)
 Frame = +3

Query  360  LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRF  539
             +K+A +VN     F ++++    R+ G   F  Y++N N    SF  YS++  G  + F
Sbjct  199  FKKYADSVNVPHLGFNSYSDDSNGRSHG---FTGYSENANAGDQSFTGYSKNGNGAPNEF  255

Query  540  SNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + Y  N NVV   F +YG S  G   KFSNYG + N P   F SY
Sbjct  256  TGYGSNANVVGSGFTSYGQSGNGANDKFSNYGNDQNNPKNNFQSY  300


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT+YG    G  D F NY +++N P ++F+ Y        + F++Y    NV D SF +Y
Sbjct  269  FTSYGQSGNGANDKFSNYGNDQNNPKNNFQSYGDGGNAGVETFTSYRERANVGDDSFQSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S G K  F++YG   N+   +FT Y
Sbjct  329  AKNSNGEKMDFTSYGKSFNIGSDKFTGY  356



>gb|KDO82432.1| hypothetical protein CISIN_1g044596mg [Citrus sinensis]
Length=644

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 146/194 (75%), Gaps = 6/194 (3%)
 Frame = +3

Query  108  GGEDSGEL----SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAA  275
            G   SG++     NPF+PKAYL+RYW K +S +  KP FLL+KASPLNA + A YSK+A 
Sbjct  37   GANTSGDVLKGKENPFSPKAYLMRYWDKTVSKNSPKPQFLLSKASPLNAVETATYSKLAE  96

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
               ++LS+ LP FCSSA L CFPDLSPSLEKH  + NFA Y  KNFTNYGT   GGV+SF
Sbjct  97   Q--KTLSSVLPSFCSSAKLFCFPDLSPSLEKHGADANFAVYENKNFTNYGTAGLGGVNSF  154

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            KNY+++ N+ VDSFRRYSRDS GH D+FS YA + NVVD SFNTYGT +TGG G F +Y 
Sbjct  155  KNYSEDGNVEVDSFRRYSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYN  214

Query  636  PEVNVPDMRFTSYS  677
             EVNVP++RFTSYS
Sbjct  215  REVNVPNLRFTSYS  228


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +3

Query  381  VNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNG  560
            VN  +  F ++++ G  RA    +F +YT+N N   +SF  Y ++  G  + F +YA   
Sbjct  217  VNVPNLRFTSYSDAGNGRA---QTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKES  273

Query  561  NVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            NV+  +F +YG +       F +YG + NVP+  F SY
Sbjct  274  NVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSY  311



>ref|XP_006483847.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
Length=644

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 146/194 (75%), Gaps = 6/194 (3%)
 Frame = +3

Query  108  GGEDSGEL----SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAA  275
            G   SG++     NPF+PKAYL+RYW K +S +  KP FLL+KASPLNA + A YSK+A 
Sbjct  37   GANTSGDVLKGKENPFSPKAYLMRYWDKTVSKNSPKPHFLLSKASPLNAVETATYSKLAE  96

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
               ++LS+ LP FCSSA L CFPDLSPSLEKH  + NFA Y  KNFTNYGT   GGV+SF
Sbjct  97   Q--KTLSSVLPSFCSSAKLFCFPDLSPSLEKHGADANFAVYENKNFTNYGTAGLGGVNSF  154

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            KNY+++ N+ VDSFRRYSRDS GH D+FS YA + NVVD SFNTYGT +TGG G F +Y 
Sbjct  155  KNYSEDGNVEVDSFRRYSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYN  214

Query  636  PEVNVPDMRFTSYS  677
             EVNVP++RFTSYS
Sbjct  215  REVNVPNLRFTSYS  228


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +3

Query  381  VNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNG  560
            VN  +  F ++++ G  RA    +F +YT+N N   +SF  Y ++  G  + F +YA   
Sbjct  217  VNVPNLRFTSYSDAGNGRA---QTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKES  273

Query  561  NVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            NV+  +F +YG +       F +YG + NVP+  F SY
Sbjct  274  NVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSY  311



>ref|XP_006438392.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
 gb|ESR51632.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
Length=644

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 146/194 (75%), Gaps = 6/194 (3%)
 Frame = +3

Query  108  GGEDSGEL----SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAA  275
            G   SG++     NPF+PKAYL+RYW K +S +  KP FLL+KASPLNA + A YSK+A 
Sbjct  37   GANTSGDVLKGKENPFSPKAYLMRYWDKTVSKNSPKPHFLLSKASPLNAVETATYSKLAE  96

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
               ++LS+ LP FCSSA L CFPDLSPSLEKH  + NFA Y  KNFTNYGT   GGV+SF
Sbjct  97   Q--KTLSSVLPSFCSSAKLFCFPDLSPSLEKHGADANFAVYENKNFTNYGTAGLGGVNSF  154

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            KNY+++ N+ VDSFRRYSRDS GH D+FS YA + NVVD SFNTYGT +TGG G F +Y 
Sbjct  155  KNYSEDGNVEVDSFRRYSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYN  214

Query  636  PEVNVPDMRFTSYS  677
             EVNVP++RFTSYS
Sbjct  215  REVNVPNLRFTSYS  228


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +3

Query  381  VNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNG  560
            VN  +  F ++++ G  RA    +F +YT+N N   +SF  Y ++  G  + F +YA   
Sbjct  217  VNVPNLRFTSYSDAGNGRA---QTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKES  273

Query  561  NVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            NV+  +F +YG +       F +YG + NVP+  F SY
Sbjct  274  NVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSY  311



>ref|XP_003517743.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=629

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 146/194 (75%), Gaps = 3/194 (2%)
 Frame = +3

Query  96   IGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAA  275
            +G  G  D+ E  NPFTPKA+ IRYW K+I + LAKP FLL+KASPLNAA+ A + K+A+
Sbjct  19   VGFAGAGDAAE-KNPFTPKAFAIRYWDKEIRSGLAKPQFLLSKASPLNAAEAAAFVKLAS  77

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
              G +LST+LP FC++A LLCFP++  SLEKH  + NFA Y  KNFTNYGT R GG+DSF
Sbjct  78   --GNALSTRLPEFCAAAKLLCFPEVGSSLEKHDKDANFAVYRDKNFTNYGTGRPGGLDSF  135

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            KNY++ ENIPV+ FRRYSRDS GH+D F +Y  +GNVV QSF+TY   +TGG G+F  Y 
Sbjct  136  KNYSEGENIPVNDFRRYSRDSAGHKDGFLSYGTSGNVVQQSFHTYAAGATGGAGEFKRYA  195

Query  636  PEVNVPDMRFTSYS  677
             E NVP++ FTSYS
Sbjct  196  DETNVPNLGFTSYS  209



>ref|XP_008444317.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=623

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 143/185 (77%), Gaps = 2/185 (1%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            G+  NPFTPKA+L RYW K++ ND+ KP FL +KASPL A Q A ++K+AA+   +LS++
Sbjct  28   GDEDNPFTPKAFLNRYWNKEVRNDIPKPSFLFSKASPLTAVQSAAFAKLAAE--NALSSR  85

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            LP FCS+ANLLCFPDLSPSL KH  + NFA YS KNFT YGT R+GG+DSFKNY++ +N+
Sbjct  86   LPDFCSAANLLCFPDLSPSLAKHDRDSNFAVYSNKNFTTYGTQRSGGIDSFKNYSNGDNV  145

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
             VDSFRRYS +++GH DRFS Y    NV DQSFNTY + + GG GKF+ Y   VNVP++R
Sbjct  146  VVDSFRRYSHEALGHTDRFSTYGTETNVPDQSFNTYASKAIGGDGKFTTYEQSVNVPNLR  205

Query  663  FTSYS  677
            FT+YS
Sbjct  206  FTTYS  210


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F++YGTD  G  D+F NY +++N P ++FR Y     G  + FS+Y    NV D SF +Y
Sbjct  262  FSSYGTDGNGANDTFTNYGNDQNNPQNNFRSYGEGGNGAIESFSSYRDQANVGDDSFQSY  321

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F++YG   N    +F+ Y
Sbjct  322  SKNSNSAKVNFASYGKSFNEGTDKFSGY  349


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT Y +D  G   +FK+Y++N N    SF  Y +   G  + F+ Y  + NVV   F++Y
Sbjct  206  FTTYSSDATGRSQAFKSYSENANAGDQSFVNYGKRGNGGPNEFTGYGTSANVVGSRFSSY  265

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            GT   G    F+NYG + N P   F SY
Sbjct  266  GTDGNGANDTFTNYGNDQNNPQNNFRSY  293



>gb|KHG01313.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=616

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 142/185 (77%), Gaps = 2/185 (1%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            G   NPFTPK+  IRYW K++  ++    FLL+K SPL A   A +SK+AA    +L+++
Sbjct  24   GVSGNPFTPKSSFIRYWNKELHKEIPNTHFLLSKVSPLTAVDSASFSKLAAH--NNLASR  81

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            LP FCSSA L CFPDLSPSLEKH+ +VNFA Y  +NFTNYG+DR  G+DSFKNY++N+N+
Sbjct  82   LPSFCSSAKLFCFPDLSPSLEKHSKDVNFAVYLDRNFTNYGSDRLAGLDSFKNYSENDNV  141

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
             +DSFRRYSRDS GH+D+FSNYA   NVVDQSFNTYG  +TGG   F+NY  EVNVP++R
Sbjct  142  VIDSFRRYSRDSAGHKDQFSNYASASNVVDQSFNTYGGDATGGSENFNNYNHEVNVPNLR  201

Query  663  FTSYS  677
            FTSYS
Sbjct  202  FTSYS  206


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 44/89 (49%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+ YG    G  D+F +Y  + N PV+ F+ Y        D FS+Y    NV D SF +
Sbjct  257  DFSGYGKTANGAKDTFTSYAFDSNNPVNGFKSYGDGGNAAVDSFSSYRDQSNVGDSSFQS  316

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  SS G K  F NYG   N    +FT Y
Sbjct  317  YAKSSNGAKVDFDNYGQSFNEGTEKFTGY  345



>ref|XP_004173618.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like, 
partial [Cucumis sativus]
Length=612

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = +3

Query  120  SGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLST  299
            +G+  +PFTPKA+L RYW K++ ND  KP FL +KASPL A Q A ++K+AA+   +LS+
Sbjct  16   AGDEDDPFTPKAFLNRYWNKEVRNDFPKPSFLFSKASPLTAVQSAAFAKLAAE--NALSS  73

Query  300  QLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNEN  479
            +LP FCS+ANLLCFPDLSPSL KH  + NFA YS KNFT YGT R+GG+DSFKNY++ +N
Sbjct  74   RLPDFCSAANLLCFPDLSPSLAKHDRDSNFAVYSNKNFTTYGTQRSGGIDSFKNYSNGDN  133

Query  480  IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDM  659
            + VDSFRRYS +++GH DRFS Y  + NV DQSFNTY + + GG GKF+ Y   VNVP++
Sbjct  134  VVVDSFRRYSHEALGHTDRFSVYGTDTNVPDQSFNTYASKAIGGDGKFTTYEQSVNVPNL  193

Query  660  RFTSYS  677
            RFT+YS
Sbjct  194  RFTTYS  199


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT Y +D  G   SFK+Y++N N    SF  Y +   G  + F+ Y  + NV+   F++Y
Sbjct  195  FTTYSSDATGRSQSFKSYSENANAGDQSFVNYGKRGNGGPNEFTGYGTSANVIGSRFSSY  254

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G    G    F+NYG + N P   F SY
Sbjct  255  GAEGNGANDTFTNYGNDQNNPQNNFRSY  282


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F++YG +  G  D+F NY +++N P ++FR Y     G  + FS+Y    NV D SF +Y
Sbjct  251  FSSYGAEGNGANDTFTNYGNDQNNPQNNFRSYGEGGNGAIESFSSYRDQANVGDDSFQSY  310

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F++YG   N    +F+ Y
Sbjct  311  SKNSNSAKVNFASYGKSFNEGTDKFSGY  338



>ref|XP_004142981.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN62285.1| hypothetical protein Csa_2G348230 [Cucumis sativus]
Length=623

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = +3

Query  120  SGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLST  299
            +G+  +PFTPKA+L RYW K++ ND  KP FL +KASPL A Q A ++K+AA+   +LS+
Sbjct  27   AGDEDDPFTPKAFLNRYWNKEVRNDFPKPSFLFSKASPLTAVQSAAFAKLAAE--NALSS  84

Query  300  QLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNEN  479
            +LP FCS+ANLLCFPDLSPSL KH  + NFA YS KNFT YGT R+GG+DSFKNY++ +N
Sbjct  85   RLPDFCSAANLLCFPDLSPSLAKHDRDSNFAVYSNKNFTTYGTQRSGGIDSFKNYSNGDN  144

Query  480  IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDM  659
            + VDSFRRYS +++GH DRFS Y  + NV DQSFNTY + + GG GKF+ Y   VNVP++
Sbjct  145  VVVDSFRRYSHEALGHTDRFSVYGTDTNVPDQSFNTYASKAIGGDGKFTTYEQSVNVPNL  204

Query  660  RFTSYS  677
            RFT+YS
Sbjct  205  RFTTYS  210


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT Y +D  G   SFK+Y++N N    SF  Y +   G  + F+ Y  + NV+   F++Y
Sbjct  206  FTTYSSDATGRSQSFKSYSENANAGDQSFVNYGKRGNGGPNEFTGYGTSANVIGSRFSSY  265

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G    G    F+NYG + N P   F SY
Sbjct  266  GAEGNGANDTFTNYGNDQNNPQNNFRSY  293


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F++YG +  G  D+F NY +++N P ++FR Y     G  + FS+Y    NV D SF +Y
Sbjct  262  FSSYGAEGNGANDTFTNYGNDQNNPQNNFRSYGEGGNGAIESFSSYRDQANVGDDSFQSY  321

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F++YG   N    +F+ Y
Sbjct  322  SKNSNSAKVNFASYGKSFNEGTDKFSGY  349



>gb|KJB15113.1| hypothetical protein B456_002G161400 [Gossypium raimondii]
Length=616

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 143/185 (77%), Gaps = 2/185 (1%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            G   NPFTPK+  IRYW K++  ++    FLL+K SPL A   A +SK+AA    +L+++
Sbjct  24   GVSGNPFTPKSSFIRYWNKEVHKEIPNTHFLLSKVSPLTAVDSASFSKLAAH--NNLASR  81

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            LP FCSSA L CFPDLS SLEKH+ +VNFA Y  +NFTNYG+DR  G+DSFKNY++N+N+
Sbjct  82   LPSFCSSAKLFCFPDLSSSLEKHSKDVNFAFYLDRNFTNYGSDRLAGLDSFKNYSENDNV  141

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
             VDSFRRYSRDS GH+D+FSNYA   NVVDQSFNTYG ++TGG G F+NY  EVNVP++R
Sbjct  142  VVDSFRRYSRDSAGHKDQFSNYASASNVVDQSFNTYGGAATGGSGNFNNYNHEVNVPNLR  201

Query  663  FTSYS  677
            FTSYS
Sbjct  202  FTSYS  206


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 44/89 (49%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+ YG    G  D+F +Y  + N PV+ F+ Y        D FS+Y    NV D SF +
Sbjct  257  DFSGYGKTANGAKDTFTSYAFDSNNPVNGFKSYGDGGNAAVDSFSSYRDQSNVGDSSFQS  316

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  SS G K  F NYG   N    +FT Y
Sbjct  317  YAKSSNGAKVDFDNYGQSFNEGTEKFTGY  345



>ref|XP_007044636.1| Polygalacturonase 2 [Theobroma cacao]
 gb|EOY00468.1| Polygalacturonase 2 [Theobroma cacao]
Length=682

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 146/193 (76%), Gaps = 3/193 (2%)
 Frame = +3

Query  102  IMGGEDSGELS-NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAAD  278
            I GG  +  +S NPFTPKA LIRYW K+I N + K  FLL+K SPL A   A +SK+AA 
Sbjct  76   IFGGVGASSVSENPFTPKASLIRYWNKEIRNQIPKTHFLLSKVSPLTAVDSASFSKLAAQ  135

Query  279  GGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
                L+++LP FCSSA L CFPDLSPSLEKH  + NFA Y+ KNFTNYGTDR  GVDSFK
Sbjct  136  --NDLASRLPSFCSSAKLFCFPDLSPSLEKHPKDANFAFYANKNFTNYGTDRLAGVDSFK  193

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NY++ +N+ VDSFRRYSRDS GH+D FSNYA   NVVDQSFNTYG ++TGG G F+NY  
Sbjct  194  NYSEGDNVIVDSFRRYSRDSAGHKDLFSNYASESNVVDQSFNTYGAAATGGGGNFNNYNR  253

Query  639  EVNVPDMRFTSYS  677
            EVN P++RFTSYS
Sbjct  254  EVNNPNLRFTSYS  266


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+ YG    G  D+F +Y  + N+P+++F+ Y        D FS+Y    NV D SF +Y
Sbjct  319  FSGYGESANGANDTFTSYGFDSNVPLNTFKSYGDGGNAAVDSFSSYRDQSNVGDDSFQSY  378

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F+NYG   N    +FT Y
Sbjct  379  AKNSNAAKVDFNNYGQSFNEGTDKFTGY  406



>ref|XP_003519820.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=628

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = +3

Query  93   VIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA  272
             +G  G  D+ E  NPFTPKA+ IRYW K+I + L KP FL++KASPL+AA+ A + K+ 
Sbjct  19   CVGFAGAGDTAE-KNPFTPKAFAIRYWDKEIRSGLPKPPFLVSKASPLSAAEAAAFLKLV  77

Query  273  ADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDS  452
            +  G SLST+LP FC++A LLCFP++ P LEKH  + NFA Y   NFTNYGT R GG+DS
Sbjct  78   S--GNSLSTRLPEFCAAAKLLCFPEVGPRLEKHDKDANFAVYRDNNFTNYGTGRPGGLDS  135

Query  453  FKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNY  632
            FKNY++ ENIPV+ FRRYSRDS GH+D F +Y  NGNVV QSF+TY   +TGG G+F +Y
Sbjct  136  FKNYSEGENIPVNDFRRYSRDSAGHKDGFLSYGTNGNVVQQSFHTYAAGATGGTGEFKHY  195

Query  633  GPEVNVPDMRFTSYS  677
              E NVP++ FTSYS
Sbjct  196  ADETNVPNLGFTSYS  210



>emb|CBI28514.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 138/199 (69%), Gaps = 7/199 (4%)
 Frame = +3

Query  90   NVIGIMGGEDSGEL---SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGY  260
            NV    G E +GE    +NPFTPKA L+RYW KQI +DL K  FLL++ASPL+A + A +
Sbjct  16   NVALGGGSEVAGESRDGANPFTPKAALVRYWNKQIGSDLQKSTFLLSRASPLSAVESATF  75

Query  261  SKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG  440
            +K+AA    +LS  LP FC SANL CFPDL  SLEKH  N NFA YS KNFTNYGT   G
Sbjct  76   TKLAAQ--NALSNYLPAFCKSANLFCFPDLGQSLEKHGPNSNFAVYSNKNFTNYGTGGHG  133

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G DSFKNYTD    PVDSFRRYSRDS GH D F NY P GN +D SFN YG+ +T G G+
Sbjct  134  GTDSFKNYTD--YFPVDSFRRYSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSGATRGVGE  191

Query  621  FSNYGPEVNVPDMRFTSYS  677
            F  Y  E NVP++RF SYS
Sbjct  192  FKKYSEESNVPNVRFNSYS  210



>ref|XP_002311777.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
 gb|EEE89144.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
Length=633

 Score =   220 bits (561),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 142/191 (74%), Gaps = 2/191 (1%)
 Frame = +3

Query  105  MGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGG  284
            +G  DS    +PFTPKA L+RYW K+I   L K  F ++KASPL+    A ++K+A+   
Sbjct  26   VGSGDSPNGESPFTPKASLVRYWNKEIHTVLPKSGFFISKASPLSPVDLATFAKLASQ--  83

Query  285  ESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNY  464
             +LS QLP FCSSA L CFPDLSPSLEKH  + +FA Y+ KNF+NYGTDRAGG DSFKNY
Sbjct  84   NALSAQLPAFCSSAELFCFPDLSPSLEKHDHDSHFAIYNNKNFSNYGTDRAGGADSFKNY  143

Query  465  TDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEV  644
            +D +NIPVDSFRRY RD+ GH + FS+YAP+ NVVDQSFNTYG  +TGG G+F  Y  EV
Sbjct  144  SDGDNIPVDSFRRYGRDAAGHGELFSSYAPDSNVVDQSFNTYGAGATGGAGEFKGYNVEV  203

Query  645  NVPDMRFTSYS  677
            N P++RF SYS
Sbjct  204  NNPNLRFVSYS  214


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 45/89 (51%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +FTNYG    G  D+FK+Y  + N+P ++F  Y        D F+ Y    NV D SF T
Sbjct  266  DFTNYGETANGANDTFKSYGVDGNVPQNNFVNYGDGGNAGVDSFATYREKSNVGDDSFQT  325

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F+NYG   N    +F+ Y
Sbjct  326  YAKNSNAEKANFANYGKSFNEGTDKFSGY  354



>gb|KJB31246.1| hypothetical protein B456_005G182600 [Gossypium raimondii]
Length=611

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 144/194 (74%), Gaps = 4/194 (2%)
 Frame = +3

Query  93   VIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA  272
            V+G +G  DS    NPFTPKA +IRYW K+I  ++ K  FLL+K SPL A   A +SK+A
Sbjct  4    VLGGVG--DSLVSENPFTPKASVIRYWNKEIRREITKTHFLLSKVSPLTAVDSASFSKLA  61

Query  273  ADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDS  452
            A     L++ LP FCSSA L CFPDLSPSLEKH  +  FA YS KNF+NYGTDR  GVDS
Sbjct  62   AQ--NDLASHLPSFCSSAKLFCFPDLSPSLEKHPKDERFAVYSNKNFSNYGTDRLAGVDS  119

Query  453  FKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNY  632
            FKNY+++ NI VDSF RYSRDS GH+++F+NYA  GNVVDQ+F++Y  S+TGG G F+NY
Sbjct  120  FKNYSEDSNIVVDSFHRYSRDSTGHKEQFANYASEGNVVDQNFHSYAASATGGSGNFNNY  179

Query  633  GPEVNVPDMRFTSY  674
              EVN P++RF+SY
Sbjct  180  NREVNNPNLRFSSY  193



>ref|XP_011009539.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=633

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 2/190 (1%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            G  DS    +PFT KA LIRYW K+I   L K  FLL+KASPL+    A +SK+A+    
Sbjct  27   GSSDSANGESPFTAKASLIRYWNKEIHTGLPKAAFLLSKASPLSPVDLATFSKLASQ--N  84

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYT  467
            +LSTQ P FCSSA L CFPDLSPSLEKH  + +FA Y  KNFTNYGT RAGG DSFKNY+
Sbjct  85   ALSTQFPAFCSSAKLFCFPDLSPSLEKHDQDSHFAFYLNKNFTNYGTGRAGGADSFKNYS  144

Query  468  DNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN  647
            D  N+PVDSFRRY RD+ GH++ FSNYAP  NV DQSFNTYG  +TGG G+F  Y   +N
Sbjct  145  DGINLPVDSFRRYGRDAAGHDETFSNYAPETNVADQSFNTYGAGATGGTGEFKGYNVRIN  204

Query  648  VPDMRFTSYS  677
             PD+RF SYS
Sbjct  205  KPDLRFVSYS  214


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG    G  D+FK Y  + N+P ++++ Y     G  D F+NY    NV D SF +
Sbjct  265  DFSNYGEAGNGASDTFKTYGVDGNVPENNYKNYGDGGNGGVDSFANYREKSNVGDDSFQS  324

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG   N    +FT Y
Sbjct  325  YAKNSNAQKADFVNYGKSFNEGTDKFTGY  353



>gb|KJB31245.1| hypothetical protein B456_005G182600 [Gossypium raimondii]
Length=628

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 143/192 (74%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGE-DSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAAD  278
            ++GG  DS    NPFTPKA +IRYW K+I  ++ K  FLL+K SPL A   A +SK+AA 
Sbjct  21   VLGGVGDSLVSENPFTPKASVIRYWNKEIRREITKTHFLLSKVSPLTAVDSASFSKLAAQ  80

Query  279  GGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
                L++ LP FCSSA L CFPDLSPSLEKH  +  FA YS KNF+NYGTDR  GVDSFK
Sbjct  81   --NDLASHLPSFCSSAKLFCFPDLSPSLEKHPKDERFAVYSNKNFSNYGTDRLAGVDSFK  138

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NY+++ NI VDSF RYSRDS GH+++F+NYA  GNVVDQ+F++Y  S+TGG G F+NY  
Sbjct  139  NYSEDSNIVVDSFHRYSRDSTGHKEQFANYASEGNVVDQNFHSYAASATGGSGNFNNYNR  198

Query  639  EVNVPDMRFTSY  674
            EVN P++RF+SY
Sbjct  199  EVNNPNLRFSSY  210



>ref|XP_002314620.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
 gb|EEF00791.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
Length=633

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 2/190 (1%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            G  DS    +PFT KA LIRYW K+I   L K  FLL+KASPL+    A +SK+A+    
Sbjct  27   GSSDSANGESPFTAKASLIRYWNKEIHTGLPKSAFLLSKASPLSPVDLATFSKLASQ--N  84

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYT  467
            +LSTQ P FCSSA L CFPDLSPSLEKH  + +FA Y  KNFTNYGT RAGG DSFKNY+
Sbjct  85   ALSTQFPAFCSSAKLFCFPDLSPSLEKHDQDSHFAFYFNKNFTNYGTGRAGGADSFKNYS  144

Query  468  DNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN  647
            D  N+PVDSFRRY RD+ GH++ FSNYAP  NV DQSFNTYG  +TGG G+F  Y   +N
Sbjct  145  DGVNLPVDSFRRYGRDAAGHDETFSNYAPETNVADQSFNTYGAGATGGTGEFKGYNVRIN  204

Query  648  VPDMRFTSYS  677
             PD+RF SYS
Sbjct  205  KPDLRFVSYS  214


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG    G  D+FK Y  + N+P ++++ Y     G  D F+NY    NV D SF +
Sbjct  265  DFSNYGEAGNGASDTFKTYGVDGNVPENNYKNYGDGGNGGVDSFANYREKSNVGDDSFQS  324

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG   N    +FT Y
Sbjct  325  YAKNSNAQKADFVNYGKSFNEGTDKFTGY  353



>ref|XP_003613234.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96192.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=630

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 143/195 (73%), Gaps = 2/195 (1%)
 Frame = +3

Query  93   VIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA  272
            +  I  G+D     NPFTPKA+L RYW K+I N L KP FL +KASPL+  + A ++K+A
Sbjct  18   ITVISAGDDVAGDKNPFTPKAFLNRYWDKEIRNGLPKPSFLFSKASPLSTVEAATFAKLA  77

Query  273  ADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDS  452
            +  G  LST+LP FCS+ANLLC P+++ SLEKH  +VNFA Y  KNFTNYGTDR GG DS
Sbjct  78   S--GNVLSTRLPEFCSAANLLCLPEVAQSLEKHGDDVNFAIYRDKNFTNYGTDRPGGFDS  135

Query  453  FKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNY  632
            FKNY+D EN+ V+ FRRYSR+S GH++ F++YA N NV DQSF+TYG  +TGG G+F  Y
Sbjct  136  FKNYSDGENVLVNDFRRYSRNSAGHKETFTSYATNANVADQSFHTYGAGATGGGGEFKTY  195

Query  633  GPEVNVPDMRFTSYS  677
              E NVP+  FTSYS
Sbjct  196  TTETNVPNEVFTSYS  210


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 6/108 (6%)
 Frame = +3

Query  369  HAGNVNFASYS------FKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHE  530
            ++G  +F SY        + FT+YGT        F NY +  N   DSF+ Y  D     
Sbjct  228  NSGQQSFTSYGKNGNGPTEEFTSYGTSSNTAGSGFSNYAETSNAGNDSFKSYGVDMNNPT  287

Query  531  DRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + FSNYA  GN   Q+F+TY   S  G   F++Y    N   + F +Y
Sbjct  288  NSFSNYANGGNGATQTFSTYREKSNVGADSFTSYAKTANAAKIGFDNY  335



>ref|XP_007224206.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
 gb|EMJ25405.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
Length=620

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 136/186 (73%), Gaps = 4/186 (2%)
 Frame = +3

Query  120  SGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLST  299
            SGE  +PFTPKA+LIRYW K + ND  KP FLL+KASPL A   A ++++AA    +LST
Sbjct  33   SGE--SPFTPKAHLIRYWNKAVQNDAQKPSFLLSKASPLTAVDSAAFAQLAAQ--NALST  88

Query  300  QLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNEN  479
            +L  FCSSANLLCFPD+  SLE H G+ NF +YS KNFTNYGT R  GVDSFKNY+  + 
Sbjct  89   RLQEFCSSANLLCFPDVGQSLENHDGDTNFTAYSTKNFTNYGTARWAGVDSFKNYSVGDT  148

Query  480  IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDM  659
              VDSFRRYSRDSV H D F++Y P  N+VDQSFN+Y T +  G G+F NY   VNVP++
Sbjct  149  SQVDSFRRYSRDSVNHTDDFNSYGPEANLVDQSFNSYATGAIAGTGEFKNYADSVNVPNL  208

Query  660  RFTSYS  677
            RF SYS
Sbjct  209  RFNSYS  214



>gb|KHG24447.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=628

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGE-DSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAAD  278
            ++GG  DS    NPFTPKA +IRYW K+I  ++ K  FLL+K SPL A   A +SK+AA 
Sbjct  21   VLGGVGDSLVSENPFTPKASVIRYWNKEIRREITKTHFLLSKVSPLTAVDSASFSKLAAQ  80

Query  279  GGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
                L++ LP FCSSA L CFPDLSPSLEKH  +  FA YS  NF+NYGTDR  GVDSFK
Sbjct  81   --NDLASHLPSFCSSAKLFCFPDLSPSLEKHPKDERFAVYSNMNFSNYGTDRLAGVDSFK  138

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NY+++ NI VDSF RYSRDS GH+++F+NYA  GNVVDQ+F++Y  S+TGG G F+NY  
Sbjct  139  NYSEDSNIVVDSFHRYSRDSTGHKEQFANYASEGNVVDQNFHSYAASATGGSGNFNNYNR  198

Query  639  EVNVPDMRFTSY  674
            EVN P++RF+SY
Sbjct  199  EVNNPNLRFSSY  210



>ref|XP_008221868.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=619

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 136/186 (73%), Gaps = 4/186 (2%)
 Frame = +3

Query  120  SGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLST  299
            SGE  +PFTPKA+LIRYW K + ND  KP FLL+KASPL+A   A ++++AA    +LST
Sbjct  33   SGE--SPFTPKAHLIRYWNKAVQNDAEKPSFLLSKASPLSAVDSAAFAQLAAQ--NALST  88

Query  300  QLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNEN  479
            +L  FCSSANLLCFPD+  SLE H G+ NF +YS KNFTNYGT R  GVDSFKNY+  + 
Sbjct  89   RLQEFCSSANLLCFPDVGHSLENHDGDTNFTAYSTKNFTNYGTARWAGVDSFKNYSVGDT  148

Query  480  IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDM  659
              VDSFRRYSRDSV H D F++Y P  N+VDQSFN Y T +  G G+F NY   VNVP++
Sbjct  149  SQVDSFRRYSRDSVNHTDDFNSYGPEANLVDQSFNNYATGAIAGTGEFKNYADSVNVPNL  208

Query  660  RFTSYS  677
            RF SYS
Sbjct  209  RFNSYS  214



>ref|XP_010551569.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=625

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 144/192 (75%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG  S E  NPFTPKA L+RYW K+I ++  +  FLL+KASPL+A   A ++K+AA  
Sbjct  29   LIGGGFSAE-ENPFTPKASLVRYWNKEIRSESPRSEFLLSKASPLSAVDSASFAKLAAV-  86

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
             +SL T+LP FCS+ANL CFPDL  SLEKH  +V F+ Y  KNFTNYGT RAGGVDSFKN
Sbjct  87   -DSLPTRLPEFCSAANLFCFPDLGASLEKHTDDVKFSVYDQKNFTNYGTTRAGGVDSFKN  145

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRYSRDS GH+D+FSNYA + NVV++SFN+YG S+ GG G F+NY  +
Sbjct  146  YSQDSNVVADSFRRYSRDSAGHDDKFSNYATSSNVVEESFNSYGGSTAGGSGTFTNYHND  205

Query  642  VNVPDMRFTSYS  677
            VN P   FTSYS
Sbjct  206  VNNPTSTFTSYS  217


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++FT+YG    G VD F +Y  N N+    F  Y        + F+NY  + NV   +F 
Sbjct  239  QSFTSYGKHGTGDVDDFSSYAVNSNVVGSGFANYGTHGHVANESFTNYGIDSNVPQNNFR  298

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            +YG+        FSNY    NV D RF+SY+
Sbjct  299  SYGSEGNAATQTFSNYRDRSNVGDDRFSSYA  329


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 42/88 (48%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYGT      +SF NY  + N+P ++FR Y  +       FSNY    NV D  F++Y
Sbjct  269  FANYGTHGHVANESFTNYGIDSNVPQNNFRSYGSEGNAATQTFSNYRDRSNVGDDRFSSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N     FT Y
Sbjct  329  AKNSNAEKVNFVNYGQTFNPGSDTFTGY  356



>ref|XP_010251282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=639

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 154/199 (77%), Gaps = 6/199 (3%)
 Frame = +3

Query  90   NVIGIMGGEDSGELS---NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGY  260
            NV     G++SG+ S   NPFT KA++IRYW+KQ+SN+L KP FL++KASPLNA   A  
Sbjct  25   NVCFAESGQNSGKSSAGENPFTAKAFVIRYWRKQVSNNLPKPSFLVSKASPLNAVDSALL  84

Query  261  SKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG  440
            +K+A     +LS+    FCSSAN+ CFPD+SPSLEKH  + NFASYS  NFTNYGT RAG
Sbjct  85   TKLADQ--NALSSHFSSFCSSANMFCFPDISPSLEKHDKDANFASYSNINFTNYGTSRAG  142

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G+DSFKNY+DN   P+DSFRRYSRDS GH+D+F+NYAPN NV++Q FNTYG S+TGG G+
Sbjct  143  GMDSFKNYSDNFGGPIDSFRRYSRDSAGHDDKFANYAPNNNVIEQDFNTYGVSATGGTGE  202

Query  621  FSNYGPE-VNVPDMRFTSY  674
            F NY  E VNVP++RF++Y
Sbjct  203  FKNYMNEGVNVPNLRFSTY  221


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+ Y +D  G   SF +YTD  N   +SF  Y  +  G    F +Y  + NV+  SF  Y
Sbjct  218  FSTYESDANGREQSFSSYTDEANAGDESFSSYGNNGNGLPLEFKSYGKDSNVMGSSFKAY  277

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G    G    F++YG   NVP+ +F SY
Sbjct  278  GEEGNGANDSFTSYGVNGNVPENKFVSY  305



>ref|XP_007157462.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
 gb|ESW29456.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
Length=626

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKAY +RYW K+I + L KP FL +KASPL+AA+ A + K+A  G  +L  +LP F
Sbjct  30   NPFTPKAYAVRYWDKEIRSTLPKPPFLFSKASPLSAAESAVFVKLA--GQNALDKRLPEF  87

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            C++A LLCFP+++PSLEKH  + NFA Y  KNFTNYGT R GGVDSFKNY++ ENIPV+ 
Sbjct  88   CAAAKLLCFPEVAPSLEKHDKDSNFAVYRDKNFTNYGTGRPGGVDSFKNYSEGENIPVND  147

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYSRDS GH+D F +Y  +GNVV QSF+TYG  +TGG G+F  Y  + NVP++ FTSY
Sbjct  148  FRRYSRDSAGHKDNFLSYGTDGNVVQQSFHTYGAGATGGTGEFKRYSDQTNVPNLDFTSY  207

Query  675  S  677
            S
Sbjct  208  S  208



>ref|XP_002266341.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Vitis vinifera]
Length=633

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 141/192 (73%), Gaps = 5/192 (3%)
 Frame = +3

Query  111  GEDSGEL---SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            GE+SG+     NPFTP+A L+RYW KQI + L K  FLL+KASPL+A + A ++K+AA  
Sbjct  30   GEESGKPVAGENPFTPRASLLRYWNKQIGSGLPKSTFLLSKASPLSAVESATFTKLAAQ-  88

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
              +LS  LP FC SANLLCFPDL  SLEKH  + NFA YS KNFTNYGTD  GG D+F  
Sbjct  89   -NALSDNLPAFCKSANLLCFPDLGQSLEKHDASSNFAVYSNKNFTNYGTDGLGGTDAFTK  147

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y++  N+PVD+F+RYSRDSVG+ D+F NY   GNVVDQSF+ YG  +TGG G+F  Y  E
Sbjct  148  YSEGVNLPVDAFKRYSRDSVGNNDKFDNYGREGNVVDQSFSGYGAGATGGSGEFKKYNEE  207

Query  642  VNVPDMRFTSYS  677
            VNVP++RF SY+
Sbjct  208  VNVPNLRFNSYT  219



>ref|XP_002266815.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=624

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 136/193 (70%), Gaps = 7/193 (4%)
 Frame = +3

Query  108  GGEDSGEL---SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAAD  278
            G E +GE    +NPFTPKA L+RYW KQI +DL K  FLL++ASPL+A + A ++K+AA 
Sbjct  22   GSEVAGESRDGANPFTPKAALVRYWNKQIGSDLQKSTFLLSRASPLSAVESATFTKLAAQ  81

Query  279  GGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
               +LS  LP FC SANL CFPDL  SLEKH  N NFA YS KNFTNYGT   GG DSFK
Sbjct  82   --NALSNYLPAFCKSANLFCFPDLGQSLEKHGPNSNFAVYSNKNFTNYGTGGHGGTDSFK  139

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NYTD    PVDSFRRYSRDS GH D F NY P GN +D SFN YG+ +T G G+F  Y  
Sbjct  140  NYTD--YFPVDSFRRYSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSGATRGVGEFKKYSE  197

Query  639  EVNVPDMRFTSYS  677
            E NVP++RF SYS
Sbjct  198  ESNVPNVRFNSYS  210



>gb|EYU22487.1| hypothetical protein MIMGU_mgv1a002927mg [Erythranthe guttata]
Length=624

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 134/183 (73%), Gaps = 2/183 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKAYLIRYW KQISN+  KP FL +KASPL AAQ A + K+AA    SLS  L  F
Sbjct  26   NPFTPKAYLIRYWNKQISNNFPKPSFLFDKASPLTAAQSAAFYKLAATDRNSLSANLSDF  85

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSF--KNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            C+ ANLLCFPDLSPSLEKH  NVNF SY    +NFTNYGT R GG DSFKNY+D  N+  
Sbjct  86   CNKANLLCFPDLSPSLEKHNDNVNFTSYLLDGQNFTNYGTGRLGGADSFKNYSDGGNVVT  145

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            ++FRRYSR+S  H D+F+ YA + NV D+SF  YGT++  G G+F++Y  E NVP++ F 
Sbjct  146  NNFRRYSRNSTAHTDKFAAYATDTNVPDESFKGYGTTAAAGDGQFTSYNDESNVPNLNFA  205

Query  669  SYS  677
            +YS
Sbjct  206  AYS  208



>gb|KCW59875.1| hypothetical protein EUGRSUZ_H02608 [Eucalyptus grandis]
Length=623

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 137/178 (77%), Gaps = 2/178 (1%)
 Frame = +3

Query  141  FTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGFCS  320
            FTP+A L+RYW + I+N L KP FLL+KASPL A   A ++K+AA G  +L   LP FC+
Sbjct  33   FTPRASLLRYWDQHIANSLPKPAFLLSKASPLGAVDAAAFAKLAARG--ALPDHLPAFCA  90

Query  321  SANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFR  500
            +A LLCFPDL+PSLEKH  + +FASYS KNFTNYGTDR GG+DSFKNY+D  N+ VD+FR
Sbjct  91   AAGLLCFPDLAPSLEKHPADSDFASYSNKNFTNYGTDRLGGLDSFKNYSDGLNVIVDTFR  150

Query  501  RYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            RYSRDS GH+DRF+NY  +GN+VDQSF +Y   + GG G+F NY P VNVP++ F +Y
Sbjct  151  RYSRDSSGHDDRFANYGSDGNLVDQSFQSYAGGAAGGTGEFKNYNPGVNVPNLNFNNY  208


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            NF NYG+   G   +F  YTD  N   +SF  Y +   G  ++F+ YA + NV++  FN 
Sbjct  204  NFNNYGSGATGRPQNFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNG  263

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +  G    F+NYG E NVP+  F +Y
Sbjct  264  YSQAGNGANDTFTNYGKEGNVPENNFRNY  292


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F  Y     G  D+F NY    N+P ++FR Y     G  D F+NY    NV D SF +Y
Sbjct  261  FNGYSQAGNGANDTFTNYGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSY  320

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F+NYG   NV   +FT Y
Sbjct  321  AKNSNSAKVNFANYGKSFNVGTDKFTGY  348


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 51/104 (49%), Gaps = 6/104 (6%)
 Frame = +3

Query  384  NFASYS------FKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSN  545
            NFA+Y+       ++F+NYG    G  + F  Y  + N+    F  YS+   G  D F+N
Sbjct  218  NFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNGYSQAGNGANDTFTN  277

Query  546  YAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y   GNV + +F  YG    G    F+NY  + NV D  F SY+
Sbjct  278  YGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSYA  321



>ref|XP_010023570.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
Length=624

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 137/178 (77%), Gaps = 2/178 (1%)
 Frame = +3

Query  141  FTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGFCS  320
            FTP+A L+RYW + I+N L KP FLL+KASPL A   A ++K+AA G  +L   LP FC+
Sbjct  34   FTPRASLLRYWDQHIANSLPKPAFLLSKASPLGAVDAAAFAKLAARG--ALPDHLPAFCA  91

Query  321  SANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFR  500
            +A LLCFPDL+PSLEKH  + +FASYS KNFTNYGTDR GG+DSFKNY+D  N+ VD+FR
Sbjct  92   AAGLLCFPDLAPSLEKHPADSDFASYSNKNFTNYGTDRLGGLDSFKNYSDGLNVIVDTFR  151

Query  501  RYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            RYSRDS GH+DRF+NY  +GN+VDQSF +Y   + GG G+F NY P VNVP++ F +Y
Sbjct  152  RYSRDSSGHDDRFANYGSDGNLVDQSFQSYAGGAAGGTGEFKNYNPGVNVPNLNFNNY  209


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            NF NYG+   G   +F  YTD  N   +SF  Y +   G  ++F+ YA + NV++  FN 
Sbjct  205  NFNNYGSGATGRPQNFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNG  264

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +  G    F+NYG E NVP+  F +Y
Sbjct  265  YSQAGNGANDTFTNYGKEGNVPENNFRNY  293


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F  Y     G  D+F NY    N+P ++FR Y     G  D F+NY    NV D SF +Y
Sbjct  262  FNGYSQAGNGANDTFTNYGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSY  321

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F+NYG   NV   +FT Y
Sbjct  322  AKNSNSAKVNFANYGKSFNVGTDKFTGY  349


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 51/104 (49%), Gaps = 6/104 (6%)
 Frame = +3

Query  384  NFASYS------FKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSN  545
            NFA+Y+       ++F+NYG    G  + F  Y  + N+    F  YS+   G  D F+N
Sbjct  219  NFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNGYSQAGNGANDTFTN  278

Query  546  YAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y   GNV + +F  YG    G    F+NY  + NV D  F SY+
Sbjct  279  YGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSYA  322



>ref|XP_003532010.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=627

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 145/192 (76%), Gaps = 5/192 (3%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            GG D G+  NPFTPKAY+ RYW + + N+L KP FLL+KASP++A+  A ++K+AA    
Sbjct  23   GGRDLGD-KNPFTPKAYVARYWDQHVRNNLPKPSFLLSKASPMSASDTASFAKLAA--AN  79

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYS-FKNFTNYGTDRAGGVDSFKNY  464
             LST+LP FCS+A+LLCFP++ PSLEKH  +  F +Y+  +NFTNYGTD AGG+D+FKNY
Sbjct  80   KLSTRLPEFCSAAHLLCFPEVRPSLEKHTEDAGFQTYNDGQNFTNYGTDFAGGIDTFKNY  139

Query  465  TDN-ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            ++     PV+ FRRYSR + GHE+RFS YA + NV DQSF+TYGT++ GG G+F NY   
Sbjct  140  SNEISTTPVNDFRRYSRGAAGHEERFSAYASDSNVADQSFSTYGTNAAGGSGEFKNYSSN  199

Query  642  VNVPDMRFTSYS  677
             NVPD+RFT+YS
Sbjct  200  SNVPDLRFTTYS  211


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +FTNYG   AG  ++F NY  N N P ++F+ Y+  +VG    FSNY    NV   SF +
Sbjct  262  DFTNYGKGGAGPNNTFTNYGVNMNNPTETFQSYADGTVGGTQSFSNYRDQANVGADSFKS  321

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y  S++G +  F +YG   N     F  Y+
Sbjct  322  YAKSTSGSEADFKSYGNSFNPGSDTFKGYA  351



>ref|XP_002525383.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF37021.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=631

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = +3

Query  96   IGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAA  275
            + + GG       +P +PKA LIRYW K+I N+L K  F+L+KASPLN  + A +SK+AA
Sbjct  23   VALAGGRGLLSEESPLSPKASLIRYWNKEIHNNLPKSQFILSKASPLNVIEAATFSKLAA  82

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
                +LST+LP FCSSA LLCFPDLSPSLEKH  + NFA+Y  KNFTNYG + AGGV++F
Sbjct  83   Q--NALSTKLPAFCSSAKLLCFPDLSPSLEKHDRDTNFANYLNKNFTNYGNEMAGGVNAF  140

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            KNY+DN+N+PVDSFRRY R   G +++FSNYAP GNV+D+SF+ YGTS TGGK  F NY 
Sbjct  141  KNYSDNDNLPVDSFRRYGRGGAGRDEKFSNYAPGGNVIDESFSGYGTSGTGGKSDFKNYA  200

Query  636  PEVNVPDMRFTSYS  677
             +VNVP++ FTSYS
Sbjct  201  EQVNVPNLVFTSYS  214



>gb|AAN60310.1| unknown [Arabidopsis thaliana]
Length=226

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = +3

Query  90   NVIGIMGGEDSG----ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAG  257
            NV+ I+GG   G       NPFTPKA L+RYW K+I     +  FL++KASPLN+   A 
Sbjct  17   NVV-IVGGRTFGGGFSAEENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNSVDSAT  75

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRA  437
            +SK+AA    SL T+ P FCS+ANL CFPDL  SLEKH  +V F+ Y  KNFTNYG  RA
Sbjct  76   FSKLAA--ANSLPTRFPDFCSAANLFCFPDLGASLEKHDDDVKFSVYDQKNFTNYGNARA  133

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG DSFKNY+ + N+  DSFRRYSR++ GH+D+F+ Y  N NVV++ FN+YGT  TGG G
Sbjct  134  GGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAG  193

Query  618  kFSNYGPEVNVPDMRFTSYS  677
             F+NY   VN P  RFT+YS
Sbjct  194  DFTNYQNNVNNPTSRFTAYS  213



>gb|AAL08244.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
 gb|AAN18083.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
Length=517

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = +3

Query  90   NVIGIMGGEDSG----ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAG  257
            NV+ I+GG   G       NPFTPKA L+RYW K+I     +  FL++KASPLNA   A 
Sbjct  17   NVV-IVGGRTFGGGFSAEENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNAVDSAT  75

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRA  437
            +SK+AA    SL T+ P FCS+ANL CFPDL  SLEKH  +V F+ Y  KNFTNYG  RA
Sbjct  76   FSKLAA--ANSLPTRFPDFCSAANLFCFPDLGASLEKHDDDVKFSVYDQKNFTNYGNARA  133

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG DSFKNY+ + N+  DSFRRYSR++ GH+D+F+ Y  N NVV++ FN+YGT  TGG G
Sbjct  134  GGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAG  193

Query  618  kFSNYGPEVNVPDMRFTSYS  677
             F+NY   VN P  RFT+YS
Sbjct  194  DFTNYQNNVNNPTSRFTAYS  213



>ref|XP_003552018.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=622

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 147/192 (77%), Gaps = 5/192 (3%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            GG D  +  NPFT +AY+ RYW K + N+L KP FLL+KASP++A+  A ++ +AA    
Sbjct  22   GGRDLVD-KNPFTEQAYVARYWDKHVGNNLPKPSFLLSKASPMSASDTASFANLAAT--N  78

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYS-FKNFTNYGTDRAGGVDSFKNY  464
            SLST+LP FCS+A+LLCFP++ PSLEKH G+ +F +Y+  +NFTNYGTD AGG+D+FKNY
Sbjct  79   SLSTRLPEFCSAAHLLCFPEVRPSLEKHTGDSDFQTYNDGQNFTNYGTDFAGGLDTFKNY  138

Query  465  TDNE-NIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            +++  + PV+ FRRYSR + GHE+RFS YA + NV DQSF+TYGT++ GG G+F NY   
Sbjct  139  SNDLFSTPVNDFRRYSRGAAGHEERFSAYAGDTNVADQSFSTYGTNAGGGSGEFKNYSRN  198

Query  642  VNVPDMRFTSYS  677
             NVPD+RFT+YS
Sbjct  199  SNVPDLRFTTYS  210


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +FTNYG   AG  D+F NY  N N P ++F+ Y+  +VG    FSNY    NV   SF +
Sbjct  261  DFTNYGKGGAGPNDTFTNYGVNMNNPTETFQSYADGTVGGTQSFSNYRDQANVGADSFQS  320

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y  ++ G +  F NYG   N     F  Y+
Sbjct  321  YAKNTLGSEADFKNYGNSFNPGSDTFKGYA  350



>ref|XP_010415713.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=624

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG  S E  NPFTPKA L+RYW K+I ++  +  FL++KASPLNA   A +SK+AA  
Sbjct  25   LIGGGFSAE-QNPFTPKASLVRYWNKEIRSESPRSDFLISKASPLNAVDSATFSKLAAT-  82

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
              SL T+ P FCS+ANL CFPDL  SLEKH G+V F++Y  KNFTNYG+ R GG DSFKN
Sbjct  83   -NSLPTRFPDFCSAANLFCFPDLGTSLEKHEGDVKFSTYDQKNFTNYGSGRPGGGDSFKN  141

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRYSR+  GH+D+FS Y  + NVV++ FN+YGTS TGG G+F+NY   
Sbjct  142  YSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNN  201

Query  642  VNVPDMRFTSYS  677
            VN P  RFT+YS
Sbjct  202  VNNPTSRFTAYS  213


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (51%), Gaps = 6/102 (6%)
 Frame = +3

Query  387  FASYSFKN------FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNY  548
            FASY   +      F+NYG +     D+F +Y  + N+P ++F+ Y       +D FSNY
Sbjct  252  FASYGVSSNVIGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNY  311

Query  549  APNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
                NV D SF++Y   S+  K KF NYG   N    +FT Y
Sbjct  312  RDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGY  353



>ref|XP_007153633.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
 gb|ESW25627.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
Length=624

 Score =   201 bits (511),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA + RYW   + N L KP FLL+KASP+ AA  A ++K+AA    +LST+LP F
Sbjct  32   NPFTPKASVARYWDNHVRNTLPKPSFLLSKASPMTAADTATFAKLAA--ANTLSTRLPEF  89

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYS-FKNFTNYGTDRAGGVDSFKNYT-DNENIPV  488
            CS+A+LLCFP++ PSLEKH  + NF +Y+  +NFTNYGT R GG+D+FKNY+ D  +IPV
Sbjct  90   CSAAHLLCFPEVRPSLEKHTQDENFQTYNDGQNFTNYGTARGGGIDTFKNYSNDLLSIPV  149

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            + FRRYSR + GHE+ F+ YA   NV DQSF+TYGT+S GG G+F NY  + NVPD+RF+
Sbjct  150  NDFRRYSRGAAGHEETFTGYASGTNVADQSFHTYGTNSAGGSGEFKNYSSDSNVPDLRFS  209

Query  669  SYS  677
            +YS
Sbjct  210  TYS  212


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            + F +YG + AG  + F  Y  N N+    F  Y     G  D F+NY  + NV + +F 
Sbjct  234  QTFQSYGKNSAGAENEFTGYGTNSNVASSGFTNYGSKGTGPNDTFANYGVDMNVPEITFK  293

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            +Y   + GG   F+NY  + NV D  F SY+
Sbjct  294  SYADGTHGGTETFANYRDQSNVGDDTFQSYA  324



>ref|XP_002888771.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65030.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 136/192 (71%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG  S E  NPFTPKA L+RYW K+I  +  +  FL++KASPLNA   A +SK+AA  
Sbjct  25   LIGGGFSAE-ENPFTPKASLVRYWNKEIRGESPRSEFLISKASPLNAVDSATFSKLAA--  81

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
              SL T+ P FCS+ANL CFPDL  SLEKH  +V F+ Y  KNFTNYG  RAGG DSFKN
Sbjct  82   ANSLPTRFPDFCSAANLFCFPDLGASLEKHDDDVKFSVYDQKNFTNYGNARAGGADSFKN  141

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRYSR++ GH+D+F+ Y  N NVV++ FN+YGT  TGG G F+NY   
Sbjct  142  YSRDGNVVTDSFRRYSRNAAGHDDKFTVYGDNSNVVEEGFNSYGTFGTGGAGVFTNYQNN  201

Query  642  VNVPDMRFTSYS  677
            VN P  RFT+YS
Sbjct  202  VNNPTSRFTAYS  213


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 47/102 (46%), Gaps = 6/102 (6%)
 Frame = +3

Query  387  FASYSFKN------FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNY  548
            FASY   +      F+NYG       D+F +Y  + N+P ++F+ Y        D F+NY
Sbjct  252  FASYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFKNYGASGNAAVDTFANY  311

Query  549  APNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
                NV D SF++Y   S   K  F NYG   N     FT Y
Sbjct  312  RDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGY  353



>ref|XP_006300881.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
 gb|EOA33779.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
Length=625

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 133/181 (73%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA L+RYW K+I N   +  FL++KASPLNA   A +SK+AA    SL T+ P F
Sbjct  35   NPFTPKASLVRYWNKEIRNVSPRSEFLISKASPLNAVDSATFSKLAAT--NSLPTRFPDF  92

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS+ANL CFPDL  SLEKH  +V F++Y  KNFTNYG+ RAGG DSFKNY+ + N+  DS
Sbjct  93   CSAANLFCFPDLGASLEKHEDDVKFSTYDQKNFTNYGSGRAGGADSFKNYSKDANVVTDS  152

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYSR++ GH+D+F+ Y  + NVV++ FN+YGT  TGG G+F+NY   VN P  RFT+Y
Sbjct  153  FRRYSRNAAGHDDKFTVYGESSNVVEEGFNSYGTFGTGGAGEFTNYQNNVNNPTSRFTAY  212

Query  675  S  677
            S
Sbjct  213  S  213



>ref|XP_010471031.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
Length=624

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 139/192 (72%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG  S E  NPFTPKA L+RYW K+I ++  +  FL++KASPLNA   A +SK+AA  
Sbjct  25   LIGGGFSAE-QNPFTPKASLVRYWNKEIRSESPRSEFLISKASPLNAVDSATFSKLAAT-  82

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
              SL T+ P FCS+ANL CFPDL  SLEKH  +V F++Y  KNFTNYG+ R GG DSFKN
Sbjct  83   -NSLPTRFPDFCSAANLFCFPDLGTSLEKHEEDVKFSTYEQKNFTNYGSGRPGGGDSFKN  141

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRYSR+  GH+D+FS Y  + NVV++ FN+YGTS TGG G+F+NY   
Sbjct  142  YSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNN  201

Query  642  VNVPDMRFTSYS  677
            VN P  RFT+YS
Sbjct  202  VNNPTSRFTAYS  213


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+NYG +     D+F +Y  + N+P ++F+ Y       +D FSNY    NV D SF++Y
Sbjct  266  FSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNYRDKANVGDDSFSSY  325

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S+  K KF NYG   N    +FT Y
Sbjct  326  AKDSSNEKVKFVNYGQSFNPGSEKFTGY  353



>ref|XP_010471032.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=624

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 139/192 (72%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG  S E  NPFTPKA L+RYW K+I ++  +  FL++KASPLNA   A +SK+AA  
Sbjct  25   LIGGGFSAE-QNPFTPKASLVRYWNKEIRSESPRSEFLISKASPLNAVDSATFSKLAAT-  82

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
              SL T+ P FCS+ANL CFPDL  SLEKH  +V F++Y  KNFTNYG+ R GG DSFKN
Sbjct  83   -NSLPTRFPDFCSAANLFCFPDLGTSLEKHEEDVKFSTYEQKNFTNYGSGRPGGGDSFKN  141

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRYSR+  GH+D+FS Y  + NVV++ FN+YGTS TGG G+F+NY   
Sbjct  142  YSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNN  201

Query  642  VNVPDMRFTSYS  677
            VN P  RFT+YS
Sbjct  202  VNNPTSRFTAYS  213


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (51%), Gaps = 6/102 (6%)
 Frame = +3

Query  387  FASYSFKN------FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNY  548
            FASY   +      F+NYG +     D+F +Y  + N+P ++F+ Y       +D FSNY
Sbjct  252  FASYGVSSNVVGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNY  311

Query  549  APNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
                NV D SF++Y   S+  K KF NYG   N    +FT Y
Sbjct  312  RDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGY  353



>gb|AAB39546.1| polygalacturonase isoenzyme 1 beta subunit homolog [Arabidopsis 
thaliana]
Length=626

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = +3

Query  90   NVIGIMGGEDSG----ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAG  257
            NV+ I+GG   G       NPFTPKA L+RYW K+I     +  FL++KASPLNA   A 
Sbjct  17   NVV-IVGGRTFGGGFSAEENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNAVDSAT  75

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRA  437
            +SK+AA    SL T+ P FCS+ANL CFPDL  SLEKH  +V F+ Y  KNFTNYG  RA
Sbjct  76   FSKLAA--ANSLPTRFPDFCSAANLFCFPDLGASLEKHDDDVKFSVYDQKNFTNYGNARA  133

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG DSFKNY+ + N+  DSFRRYSR++ GH+D+F+ Y  N NVV++ FN+YGT  TGG G
Sbjct  134  GGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAG  193

Query  618  kFSNYGPEVNVPDMRFTSYS  677
             F+NY   VN P  RFT+YS
Sbjct  194  DFTNYQNNVNNPTSRFTAYS  213



>ref|NP_177194.1| polygalacturonase 2 [Arabidopsis thaliana]
 ref|NP_001185361.1| polygalacturonase 2 [Arabidopsis thaliana]
 sp|P92990.2|JP650_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP650; AltName: Full=Aromatic-rich glycoprotein JP650; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC18803.1| Identical to polygalacuronase isoenzyme 1 beta subunit homolog 
mRNA gb|U63373. EST gb|AA404878 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAE98965.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35050.1| polygalacturonase 2 [Arabidopsis thaliana]
 gb|AEE35051.1| polygalacturonase 2 [Arabidopsis thaliana]
Length=626

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = +3

Query  90   NVIGIMGGEDSG----ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAG  257
            NV+ I+GG   G       NPFTPKA L+RYW K+I     +  FL++KASPLNA   A 
Sbjct  17   NVV-IVGGRTFGGGFSAEENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNAVDSAT  75

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRA  437
            +SK+AA    SL T+ P FCS+ANL CFPDL  SLEKH  +V F+ Y  KNFTNYG  RA
Sbjct  76   FSKLAA--ANSLPTRFPDFCSAANLFCFPDLGASLEKHDDDVKFSVYDQKNFTNYGNARA  133

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG DSFKNY+ + N+  DSFRRYSR++ GH+D+F+ Y  N NVV++ FN+YGT  TGG G
Sbjct  134  GGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAG  193

Query  618  kFSNYGPEVNVPDMRFTSYS  677
             F+NY   VN P  RFT+YS
Sbjct  194  DFTNYQNNVNNPTSRFTAYS  213



>ref|XP_010460151.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 131/182 (72%), Gaps = 2/182 (1%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +NPFTPKA L+RYW KQI N      FLL+KASPL A   A ++K+A+    SL  +LP 
Sbjct  36   TNPFTPKASLVRYWNKQIQNKSPGSAFLLSKASPLTAVASATFAKLASQ--NSLPDRLPD  93

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            FCS+ANL CFPDL P+L+KH+ +V F+ Y  +NFTNYGT R GG DSF+ Y+ N N+  D
Sbjct  94   FCSAANLFCFPDLGPTLDKHSNDVKFSVYDQRNFTNYGTTRPGGADSFQKYSQNGNVVTD  153

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSRD+ GH+D F+ YA N NVVD++FN+YGTS+TGG  +F  Y   VN P  RFT+
Sbjct  154  SFRRYSRDAAGHDDSFTGYADNSNVVDENFNSYGTSATGGSDEFKTYQSGVNNPTSRFTA  213

Query  672  YS  677
            YS
Sbjct  214  YS  215


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 44/89 (49%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY    NV D +F++
Sbjct  267  DFSNYGENANAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDTFSS  326

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG   N     FT Y
Sbjct  327  YAKNSNSQKVNFVNYGKSFNPGSESFTGY  355



>ref|XP_006390895.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
 gb|ESQ28181.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
Length=627

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 142/193 (74%), Gaps = 4/193 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLA-KPWFLLNKASPLNAAQYAGYSKMAAD  278
            ++GG  S E  NPFTPKA L+RYW K+I +D + +  FL++KASPLNA   A ++K+AA 
Sbjct  25   LIGGGFSAE-ENPFTPKASLVRYWNKEIRSDKSLRSEFLISKASPLNAVDSATFAKLAAQ  83

Query  279  GGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
               SL T+LP FCS+ANL CFPDL+PSL KH  +V F+ Y+ KNFTNYG  RAGG DSFK
Sbjct  84   --NSLPTRLPDFCSAANLFCFPDLTPSLNKHDDDVKFSVYNQKNFTNYGNARAGGADSFK  141

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
             Y+ + N+  DSFRRYSR + GH+D+F+ Y+ N NVV+++FN+YGT  TGG G+F+NY  
Sbjct  142  TYSKDGNVVTDSFRRYSRGAAGHDDKFTVYSDNSNVVEENFNSYGTFGTGGAGEFTNYQN  201

Query  639  EVNVPDMRFTSYS  677
             VN P  RFT+YS
Sbjct  202  GVNNPTSRFTAYS  214


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+NYG       DSF NY ++ N+P ++F+ Y        D FSNY    NV D SF++Y
Sbjct  267  FSNYGEKGNAANDSFTNYGNDGNVPQNNFKNYGASGNAAVDTFSNYRDKANVGDDSFSSY  326

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S  GK  F NYG   N     FT Y
Sbjct  327  AKDSNSGKVNFVNYGQSFNPGSESFTGY  354



>ref|XP_010498883.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=633

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 131/182 (72%), Gaps = 2/182 (1%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +NPFTPKA L+RYW KQI N      FLL+KASPL A   A ++K+A+    SL  +LP 
Sbjct  46   TNPFTPKASLVRYWNKQIQNQSPGSAFLLSKASPLTAVASATFAKLASQ--NSLPDRLPD  103

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            FCS+ANL CFPDL P+LEKH+ +V F+ Y  +NFTNYGT R GG DSF+ Y+ N N+  D
Sbjct  104  FCSAANLFCFPDLGPTLEKHSNDVKFSVYDQRNFTNYGTTRPGGADSFEKYSQNGNVVTD  163

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSRD+ GH+D F+ YA N NVVD++F +YGTS+TGG G+F  Y   VN P  RFT+
Sbjct  164  SFRRYSRDAAGHDDSFTGYADNSNVVDENFKSYGTSATGGSGEFKAYQSGVNNPTSRFTA  223

Query  672  YS  677
            YS
Sbjct  224  YS  225


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 44/89 (49%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY    NV D +F++
Sbjct  277  DFSNYGENANAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDTFSS  336

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG   N     FT Y
Sbjct  337  YAKNSNSEKVGFVNYGKSFNPGSESFTGY  365



>ref|XP_006303930.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
 gb|EOA36828.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
Length=623

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 132/182 (73%), Gaps = 3/182 (2%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +NPFTPKA L+RYW KQI N      FLL+KASPL A   A ++K+A+    SL  +LP 
Sbjct  37   TNPFTPKASLVRYWNKQIQNQSPGSAFLLSKASPLTAVASATFAKLASQ--NSLPDRLPD  94

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            FCS+ANL CFPDL P+LEKH+ +V F+ Y  +NFTNYG+   GG DSF+ Y+ + N+  D
Sbjct  95   FCSAANLFCFPDLGPTLEKHSDDVKFSVYDQRNFTNYGS-HPGGADSFEKYSQDGNVVTD  153

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSRD+ GH+D F+ YA N NVVD+SFNTYGTS+TGG  +F +Y  EVN P  RFT+
Sbjct  154  SFRRYSRDAAGHDDTFTGYADNSNVVDESFNTYGTSATGGSDEFKSYQSEVNNPTSRFTA  213

Query  672  YS  677
            YS
Sbjct  214  YS  215



>emb|CDX68345.1| BnaA07g23850D [Brassica napus]
Length=618

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 137/193 (71%), Gaps = 4/193 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLA-KPWFLLNKASPLNAAQYAGYSKMAAD  278
            ++GG  S E  NPFTPKA L+RYW K+IS D + +  FL++KASPLNA   A ++K+AA 
Sbjct  25   LIGGGLSAE-ENPFTPKASLVRYWNKEISADKSLRSEFLISKASPLNAVDSATFAKLAAQ  83

Query  279  GGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
               SL T+LP FCS+ANL CFPDL+PSLEKH  NV F+ Y  KNFT+YG  RA G DSFK
Sbjct  84   --NSLPTRLPDFCSAANLFCFPDLTPSLEKHDDNVKFSVYDQKNFTSYGNARAAGADSFK  141

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
             Y+   N   DSFRRYSR++ GHED+F+ Y   GNV ++ FN+YGT + GG G F+NY  
Sbjct  142  TYSKGNNGAFDSFRRYSRNAAGHEDKFTVYGERGNVDEKDFNSYGTFAAGGAGDFTNYQN  201

Query  639  EVNVPDMRFTSYS  677
            +VN P  RFT+YS
Sbjct  202  DVNDPMSRFTAYS  214


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 51/107 (48%), Gaps = 9/107 (8%)
 Frame = +3

Query  363  EKHAGNVNFASYS---------FKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRD  515
            E++A    F SY+         FKN+ +YG      VD+F NY D  N+  DSF  Y++D
Sbjct  273  EENAAKDTFTSYASGGNVPLNNFKNYGDYGVSGNDAVDTFANYRDKANVGDDSFSGYAKD  332

Query  516  SVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPD  656
            S     +F+NY  + N   +SF  YG  S G K  F  Y P     D
Sbjct  333  SNAGTVKFTNYGQSYNPGSESFTGYGKGSEGHKISFKTYTPNSTFKD  379



>ref|NP_173788.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
 sp|P92982.2|JP630_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP630; AltName: Full=Aromatic-rich glycoprotein JP630; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC98031.1| Identical to gb|ATU59467 aromatic rich glycoprotein which is 
strongly similar to gb|U63373 polygalacturonase isozyme 1 from 
Arabidopsis thaliana. EST gb|AA395212 comes from this gene 
[Arabidopsis thaliana]
 gb|AEE30429.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
Length=622

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 137/199 (69%), Gaps = 7/199 (4%)
 Frame = +3

Query  96   IGIMGGE--DSGELS---NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGY  260
            + I GGE   +G  S   NPFTPKA L+RYW KQI +      FLL+KASPL A   A +
Sbjct  18   VVIAGGERLTNGGFSPEINPFTPKASLVRYWNKQIHHQSPGSAFLLSKASPLTAVASATF  77

Query  261  SKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG  440
            +K+A++   +L  +LP FCS+ANL CFPDL P+LEKH+ +V F+ Y  +NFTNYGT   G
Sbjct  78   AKLASE--NALPDRLPDFCSAANLFCFPDLGPTLEKHSNDVKFSVYDQRNFTNYGTIHPG  135

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G DSFK Y+ N N   DSFRRYSRD+ GHED+F+ YA N NVV++ FN+YGTS+TGG G 
Sbjct  136  GADSFKKYSQNGNAVTDSFRRYSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGD  195

Query  621  FSNYGPEVNVPDMRFTSYS  677
            F NY   VN P  RF +YS
Sbjct  196  FKNYQSGVNNPTTRFKAYS  214


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY  N NV D SF++
Sbjct  266  DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  325

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  326  YAKNSNFEKVDFVNYGKSINPGSESFSGY  354



>dbj|BAE99852.1| putative polygalacuronase isoenzyme 1 beta subunit [Arabidopsis 
thaliana]
Length=622

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 137/199 (69%), Gaps = 7/199 (4%)
 Frame = +3

Query  96   IGIMGGE--DSGELS---NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGY  260
            + I GGE   +G  S   NPFTPKA L+RYW KQI +      FLL+KASPL A   A +
Sbjct  18   VVIAGGERLTNGGFSPEINPFTPKASLVRYWNKQIHHQSPGSAFLLSKASPLTAVASATF  77

Query  261  SKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG  440
            +K+A++   +L  +LP FCS+ANL CFPDL P+LEKH+ +V F+ Y  +NFTNYGT   G
Sbjct  78   AKLASE--NALPDRLPDFCSAANLFCFPDLGPTLEKHSNDVKFSVYDQRNFTNYGTIHPG  135

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G DSFK Y+ N N   DSFRRYSRD+ GHED+F+ YA N NVV++ FN+YGTS+TGG G 
Sbjct  136  GADSFKKYSQNGNAVTDSFRRYSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGD  195

Query  621  FSNYGPEVNVPDMRFTSYS  677
            F NY   VN P  RF +YS
Sbjct  196  FKNYQSGVNNPTTRFKAYS  214


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ +        D F NY  N NV D SF++
Sbjct  266  DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSHGASGNAAVDTFLNYRDNANVGDDSFSS  325

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  326  YAKNSNFEKVDFVNYGKSINPGSESFSGY  354



>gb|AAB39538.1| aromatic rich glycoprotein JP630 [Arabidopsis thaliana]
Length=622

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 137/199 (69%), Gaps = 7/199 (4%)
 Frame = +3

Query  96   IGIMGGE--DSGELS---NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGY  260
            + I GGE   +G  S   NPFTPKA L+RYW KQI +      FLL+KASPL A   A +
Sbjct  18   VVIAGGERLTNGGFSPEINPFTPKASLVRYWNKQIHHQSPGSAFLLSKASPLTAVASATF  77

Query  261  SKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAG  440
            +K+A++   +L  +LP FCS+ANL CFPDL P+LEKH+ +V F+ Y  +NFTNYGT   G
Sbjct  78   AKLASE--NALPDRLPDFCSAANLFCFPDLGPTLEKHSNDVKFSVYDQRNFTNYGTIHPG  135

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G DSFK Y+ N N   DSFRRYSRD+ GHED+F+ YA N NVV++ FN+YGTS+TGG G 
Sbjct  136  GADSFKKYSQNGNAVTDSFRRYSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGD  195

Query  621  FSNYGPEVNVPDMRFTSYS  677
            F NY   VN P  RF +YS
Sbjct  196  FKNYQSGVNNPTTRFKAYS  214


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY  N NV D SF++
Sbjct  266  DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  325

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  326  YAKNSNFEKVDFVNYGKSINPGSESFSGY  354



>ref|XP_010427809.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
 ref|XP_010427810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=625

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 137/192 (71%), Gaps = 3/192 (2%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG  S E  NPFTPKA L+RYW K+I ++  +  FL++KASPLNA   A +SK+AA  
Sbjct  25   LIGGGFSAE-QNPFTPKASLVRYWNKEIRSESPRSEFLISKASPLNAVDSATFSKLAAT-  82

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
              SL T+ P FCS+ANL CFPDL  SLEKH  +V F++Y  KNFTNYG+ R GG DSFKN
Sbjct  83   -NSLPTRFPDFCSAANLFCFPDLGTSLEKHEEDVKFSTYDQKNFTNYGSGRPGGGDSFKN  141

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRYSR+  GH+D+FS Y  + NVV++ FN+YGT  TGG G+F+NY   
Sbjct  142  YSKDGNVETDSFRRYSRNGAGHDDKFSVYGESSNVVEEGFNSYGTFGTGGAGEFTNYQNN  201

Query  642  VNVPDMRFTSYS  677
            VN P   FT+YS
Sbjct  202  VNNPTSTFTAYS  213


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+NYG +     D+F +Y  + N+P ++F+ Y       +D FSNY    NV D SF++Y
Sbjct  266  FSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNYRDKANVGDDSFSSY  325

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S+  K KF NYG   N    +FT Y
Sbjct  326  AKDSSNEKVKFVNYGQSFNPGSEKFTGY  353



>ref|XP_010477679.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 130/183 (71%), Gaps = 3/183 (2%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISND-LAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLP  308
            +NPFTPKA L+RYW KQI N  L    FLL+KASPL A   A ++K+A+    SL  +LP
Sbjct  35   TNPFTPKASLVRYWNKQIQNQSLPGSAFLLSKASPLTAVASATFAKLASQ--NSLPDRLP  92

Query  309  GFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
             FCS+ANL CFPDL P+LEKH+ +V F+ Y  +NFTNYGT R GG DSF+ Y+ N N+  
Sbjct  93   DFCSAANLFCFPDLGPTLEKHSNDVKFSVYDQRNFTNYGTTRPGGADSFEKYSQNGNVVT  152

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            DSFRRYSRD+ GH+D F  YA N NVVD++FN+YG S+TGG G+F  Y    N P  RFT
Sbjct  153  DSFRRYSRDAAGHDDSFKGYADNSNVVDENFNSYGRSATGGSGEFKTYQSGDNNPTSRFT  212

Query  669  SYS  677
            +YS
Sbjct  213  AYS  215


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY    NV D +F++Y
Sbjct  268  FSNYGQNANSANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDTFSSY  327

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N     FT Y
Sbjct  328  AKNSNSEKVDFVNYGKSFNPGSESFTGY  355



>gb|KCW86731.1| hypothetical protein EUGRSUZ_B03343 [Eucalyptus grandis]
Length=610

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKAYL+RYW ++++NDL KP FLL+KASPL AA    ++K+AA G  ++S  LP F
Sbjct  13   NPFTPKAYLVRYWNQRVTNDLPKPPFLLSKASPLTAADAVAFAKLAARG--AISDHLPSF  70

Query  315  CSSANLLCFPDL-SPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            C++A LLC PDL S  +E+H  + NFA+YS KNFT YG +  G  DSFK Y+ +EN+PV 
Sbjct  71   CAAARLLCLPDLPSAIVERHDRDSNFAAYSNKNFTAYGANGVGRRDSFKGYSVDENLPVS  130

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSR S  H D FS Y   GNV DQSFN+YG +STGG G+F  Y  +VN+P++ F +
Sbjct  131  SFRRYSRGSTIHRDEFSTYGAQGNVADQSFNSYGVASTGGHGEFIEYNKDVNIPNLNFNN  190

Query  672  Y  674
            Y
Sbjct  191  Y  191


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 42/89 (47%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            NF NYG+   G   SF  YT+  N   ++F  YSR+       F+ YA + N V   F+ 
Sbjct  187  NFNNYGSSGEGRSHSFSGYTEGTNAGAETFTTYSRNGNRAPSEFTAYATDSNTVGSGFSA  246

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y     G    F++YG   N P  RF SY
Sbjct  247  YSQGGDGANNSFTSYGFNGNNPHNRFNSY  275



>ref|XP_010044636.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=621

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKAYL+RYW ++++NDL KP FLL+KASPL AA    ++K+AA G  ++S  LP F
Sbjct  24   NPFTPKAYLVRYWNQRVTNDLPKPPFLLSKASPLTAADAVAFAKLAARG--AISDHLPSF  81

Query  315  CSSANLLCFPDL-SPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            C++A LLC PDL S  +E+H  + NFA+YS KNFT YG +  G  DSFK Y+ +EN+PV 
Sbjct  82   CAAARLLCLPDLPSAIVERHDRDSNFAAYSNKNFTAYGANGVGRRDSFKGYSVDENLPVS  141

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSR S  H D FS Y   GNV DQSFN+YG +STGG G+F  Y  +VN+P++ F +
Sbjct  142  SFRRYSRGSTIHRDEFSTYGAQGNVADQSFNSYGVASTGGHGEFIEYNKDVNIPNLNFNN  201

Query  672  Y  674
            Y
Sbjct  202  Y  202


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 42/89 (47%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            NF NYG+   G   SF  YT+  N   ++F  YSR+       F+ YA + N V   F+ 
Sbjct  198  NFNNYGSSGEGRSHSFSGYTEGTNAGAETFTTYSRNGNRAPSEFTAYATDSNTVGSGFSA  257

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y     G    F++YG   N P  RF SY
Sbjct  258  YSQGGDGANNSFTSYGFNGNNPHNRFNSY  286



>ref|XP_010925453.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 132/181 (73%), Gaps = 1/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGG-ESLSTQLPG  311
            NPFT KA LIRYW +++ N    P FL++K SPL+A   A +S +AA GG  +LS +LP 
Sbjct  37   NPFTAKAALIRYWNRKVPNGRPHPDFLVSKLSPLSALDTASFSSLAASGGGAALSPRLPA  96

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
             C++A LLC P LS S   H  +  FA+Y+  NF+NYGTDRAGG DSFKNY+ +EN+PVD
Sbjct  97   LCAAARLLCSPSLSTSTASHPSDSAFATYADSNFSNYGTDRAGGADSFKNYSASENLPVD  156

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            +FRRYSRDS GH+D F+ Y P+GNVV  +F +Y +++TGG G FS+Y  E NVP+++FT+
Sbjct  157  TFRRYSRDSAGHDDSFAVYQPDGNVVTANFTSYASAATGGAGDFSSYAHEGNVPNLKFTN  216

Query  672  Y  674
            Y
Sbjct  217  Y  217


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++F  YG    G   SF +Y +N N+    F  Y  D  G  D F+NY  NGNV + +F 
Sbjct  240  QSFAGYGKHGNGIPLSFTSYGNNSNVINSDFNNYGEDGNGANDTFTNYGENGNVPENNFR  299

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            +YG+    G  +FSNY  + NV D  FTSY+
Sbjct  300  SYGSGGNAGSEEFSNYRDQANVGDDTFTSYA  330


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 42/89 (47%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F NYG D  G  D+F NY +N N+P ++FR Y        + FSNY    NV D +F +
Sbjct  269  DFNNYGEDGNGANDTFTNYGENGNVPENNFRSYGSGGNAGSEEFSNYRDQANVGDDTFTS  328

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y      G   F NYG   N     F  Y
Sbjct  329  YAKGENAGSADFKNYGNSFNQGSDSFKGY  357


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 52/106 (49%), Gaps = 6/106 (6%)
 Frame = +3

Query  375  GNVNFASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDR  536
            G  +F+SY+ +       FTNY  D  G V  F  Y+D+ N    SF  Y +   G    
Sbjct  196  GAGDFSSYAHEGNVPNLKFTNYDADADGRVQKFSRYSDDTNSGDQSFAGYGKHGNGIPLS  255

Query  537  FSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F++Y  N NV++  FN YG    G    F+NYG   NVP+  F SY
Sbjct  256  FTSYGNNSNVINSDFNNYGEDGNGANDTFTNYGENGNVPENNFRSY  301



>ref|XP_010520580.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=614

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 134/189 (71%), Gaps = 10/189 (5%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GGE        F+ +A L+RYW K+I  +  +  FLL+KASPLNA   A ++K+AA  
Sbjct  24   LIGGE--------FSAEASLVRYWIKEIRGESPRSEFLLSKASPLNAVDSATFAKLAAR-  74

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
              SLST+LP FCS+A L CFPDL PSLE+HA +V+F+ Y  KNFTNYGT   GGVDSFKN
Sbjct  75   -NSLSTRLPEFCSAAKLFCFPDLDPSLEQHAEDVSFSVYDQKNFTNYGTSSVGGVDSFKN  133

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRYSRDS  H+D FSNYA + NV +++FN+YG S+ GG G FSNY  +
Sbjct  134  YSQDGNVVTDSFRRYSRDSADHDDEFSNYATSSNVAEENFNSYGHSTAGGSGTFSNYQFD  193

Query  642  VNVPDMRFT  668
            VN P  RFT
Sbjct  194  VNDPTSRFT  202



>emb|CDY59986.1| BnaC06g43610D [Brassica napus]
Length=611

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 142/194 (73%), Gaps = 5/194 (3%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLA--KPWFLLNKASPLNAAQYAGYSKMAA  275
            ++GG  S +  NPFTPKA L+RYW K+I +D +  +  FL++KASPLNA + A ++K+AA
Sbjct  25   LIGGGFSAQ-ENPFTPKASLVRYWNKEIRSDKSSIRSEFLISKASPLNAVESATFAKLAA  83

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
                SL T+ P FCS+ANL CFPDLSPSLE+H  +V F+ Y  KNFTNYG   AGGVDSF
Sbjct  84   Q--NSLPTRFPDFCSAANLFCFPDLSPSLEQHNADVKFSVYDQKNFTNYGNAAAGGVDSF  141

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            K Y+ + N+  DSFRRYSR++ GH+D+F+ Y  + NVV+++FN+YGT  TGG G+F+NY 
Sbjct  142  KTYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSYGTFGTGGTGEFTNYQ  201

Query  636  PEVNVPDMRFTSYS  677
              VN P  RFT+YS
Sbjct  202  NGVNNPTSRFTAYS  215


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+NYG       DSF +Y  + N+P ++F+ Y        D F+NY    NV D SF++Y
Sbjct  268  FSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGASGNAASDTFANYRDKSNVGDDSFSSY  327

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S  G  KF+NYG   N     FT Y
Sbjct  328  AKDSNSGTAKFTNYGQSFNPGSETFTGY  355



>ref|XP_009105700.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Brassica rapa]
Length=627

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 142/194 (73%), Gaps = 5/194 (3%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLA--KPWFLLNKASPLNAAQYAGYSKMAA  275
            ++GG  S +  NPFTPKA L+RYW K+I +D +  +  FL++KASPLNA + A ++K+AA
Sbjct  25   LIGGGYSAQ-ENPFTPKASLVRYWNKEIRSDKSSIRSEFLISKASPLNAVESATFAKLAA  83

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
                SL T+LP FCS+ANL CFPDLSPSLE+H  +V F+ Y  KNFTNYG   AGG DSF
Sbjct  84   Q--NSLPTRLPDFCSAANLFCFPDLSPSLEQHNADVKFSVYDQKNFTNYGNAAAGGTDSF  141

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            K Y+ + N+  DSFRRYSR++ GH+D+F+ Y  + NVV+++FN+YGT  TGG G+F+NY 
Sbjct  142  KTYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSYGTFGTGGTGEFTNYQ  201

Query  636  PEVNVPDMRFTSYS  677
              VN P  RFT+YS
Sbjct  202  NGVNNPTSRFTAYS  215


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+NYG       DSF +Y  + N+P ++F+ Y        D F+NY    NV D SF++Y
Sbjct  268  FSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGASGNAASDTFANYRDKSNVGDDSFSSY  327

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S  G  KF+NYG   N     FT Y
Sbjct  328  AKDSNSGTAKFNNYGQSFNPGSETFTGY  355



>ref|XP_002890594.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66853.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 131/182 (72%), Gaps = 3/182 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA L+RYW KQI +      FLL+KASPL A   A ++K+A++   +L  +LP F
Sbjct  36   NPFTPKASLVRYWNKQIQHQSPGSAFLLSKASPLTAVASATFAKLASE--NALPDRLPDF  93

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYG-TDRAGGVDSFKNYTDNENIPVD  491
            CS+ANL CFPDL P+LEKH+ +V F+ Y  +NFTNYG T   GG DSFK Y+ N N+  D
Sbjct  94   CSAANLFCFPDLGPTLEKHSNDVKFSVYDQRNFTNYGGTIHPGGADSFKKYSQNGNVVTD  153

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSRD+ GHED+F+ YA N NVV+++FN+YGTS+TGG G F NY   VN P  RF +
Sbjct  154  SFRRYSRDAAGHEDKFTGYADNSNVVEENFNSYGTSATGGSGDFKNYQSGVNNPTSRFKA  213

Query  672  YS  677
            YS
Sbjct  214  YS  215


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 44/89 (49%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY    NV D SF +
Sbjct  267  DFSNYGENSNAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDSFAS  326

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     FT Y
Sbjct  327  YAKNSNFEKVDFVNYGKSINPGSESFTGY  355



>emb|CDY57845.1| BnaA07g38770D [Brassica napus]
Length=627

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 142/194 (73%), Gaps = 5/194 (3%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLA--KPWFLLNKASPLNAAQYAGYSKMAA  275
            ++GG  S +  NPFTPKA L+RYW K+I +D +  +  FL++KASPLNA + A ++K+AA
Sbjct  25   LIGGGYSAQ-ENPFTPKASLVRYWNKEIRSDKSSIRSEFLISKASPLNAVESATFAKLAA  83

Query  276  DGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSF  455
                SL T+LP FCS+ANL CFPDLSPSLE+H  +V F+ Y  KNFTNYG   AGG DSF
Sbjct  84   Q--NSLPTRLPDFCSAANLFCFPDLSPSLEQHNADVKFSVYDEKNFTNYGNAAAGGTDSF  141

Query  456  KNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            K Y+ + N+  DSFRRYSR++ GH+D+F+ Y  + NVV+++FN+YGT  TGG G+F+NY 
Sbjct  142  KTYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSYGTFGTGGTGEFTNYQ  201

Query  636  PEVNVPDMRFTSYS  677
              VN P  RFT+YS
Sbjct  202  NGVNNPTSRFTAYS  215


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F+NYG       DSF +Y  + N+P ++F+ Y        D F+NY    NV D SF++Y
Sbjct  268  FSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGASGNAASDTFANYRDKSNVGDDSFSSY  327

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S  G  KF+NYG   N     FT Y
Sbjct  328  AKDSNSGTAKFTNYGQSFNPGSETFTGY  355



>ref|XP_004509821.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=624

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 141/182 (77%), Gaps = 3/182 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA++IRYW + I N+L KP F+++KASPL+A+  A ++K AA    +LST+LP F
Sbjct  30   NPFTPKAFVIRYWDRVIKNNLPKPSFIISKASPLSASDAAAFTKHAAA--NTLSTKLPEF  87

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYS-FKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CS+A+LLCFPD++PSL KH  +  FA Y+  +NFTNYGT+R GG+DSFKNY+++ +  V+
Sbjct  88   CSAAHLLCFPDVNPSLAKHTKDAKFAVYNDAQNFTNYGTNRPGGIDSFKNYSNDFSSEVN  147

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
             FR+YSR S GH+D F+NYA   NVVDQ+FNTYGT + GG G+F  Y  + NVP++RFT+
Sbjct  148  EFRQYSRSSAGHKDSFTNYAIESNVVDQNFNTYGTGAAGGSGEFKEYSKDSNVPNLRFTT  207

Query  672  YS  677
            YS
Sbjct  208  YS  209



>emb|CDY23501.1| BnaC06g24700D [Brassica napus]
Length=625

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLA-KPWFLLNKASPLNAAQYAGYSKMAADGG  284
            GG  +GE  NPFTPKA LIRYW K+IS D + +  FL++KASPLNA   A ++K+AA   
Sbjct  28   GGFSAGE--NPFTPKASLIRYWNKEISADKSLRSEFLISKASPLNAVDSATFAKLAAQ--  83

Query  285  ESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNY  464
             SL T+L  FCS+ANL CFPDL+PSLEKH  NV F+ Y  KNF+ YG  RA G DSFK Y
Sbjct  84   NSLPTRLSDFCSAANLFCFPDLTPSLEKHDDNVKFSVYDQKNFSTYGDARAAGADSFKTY  143

Query  465  TDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEV  644
            +   N  +D+FRRYSR++ GHED+F+ Y   GNV ++ FN+YGT   GG G F+NY  +V
Sbjct  144  SKGNNGAMDTFRRYSRNAAGHEDKFTVYGERGNVDEKDFNSYGTFGAGGAGDFTNYQNDV  203

Query  645  NVPDMRFTSYS  677
            N P  RFT+YS
Sbjct  204  NDPMSRFTAYS  214


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = +3

Query  363  EKHAGNVNFASYS---------FKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRD  515
            E++A    F SY+         FKN+ +YG    G VD+F NY D  N+  DSF  Y++D
Sbjct  273  EENAAKDTFTSYASGGNVLLNNFKNYGDYGVSGNGAVDTFANYRDKANVGDDSFSGYAKD  332

Query  516  SVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPD  656
            S     +F+NY  + N   +SF +YG  S G K  F  Y P     D
Sbjct  333  SNSGTVKFTNYGQSYNPGSESFTSYGKGSEGQKISFKTYTPNSTFKD  379



>gb|KFK41456.1| hypothetical protein AALP_AA2G132700 [Arabis alpina]
Length=617

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW K+I     +  FL++KASPL   + A +SK+AA    SL T+ P F
Sbjct  25   NPFTPKASLIRYWNKEIHGQSLRSEFLISKASPLTTIESATFSKLAA--ANSLQTRFPDF  82

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS+ANL CFPDL+ SLEKH G+  F+ Y  KNFTNYG  RAGG DSFK Y+ + N+  DS
Sbjct  83   CSAANLFCFPDLTASLEKHDGDSKFSVYDQKNFTNYGNARAGGTDSFKAYSKDGNVVTDS  142

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRY R++  H+++F+ YA   NVV+++FN+YGT  TGG G+F+NY   VN P  RFT+Y
Sbjct  143  FRRYGRNAAAHDEKFTVYAEGSNVVEENFNSYGTGGTGGAGEFTNYQNGVNNPTSRFTAY  202

Query  675  S  677
            S
Sbjct  203  S  203


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 42/88 (48%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG       D+F +Y  + N+P ++F+ Y  +     D F+NY    NV D SF +Y
Sbjct  256  FANYGESGNAANDTFTSYGSDGNVPQNNFKNYGAEGNSAVDTFTNYRDAANVGDDSFTSY  315

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S   K  F NYG   N     FTSY
Sbjct  316  AKDSNAEKVNFVNYGQSFNPGSETFTSY  343


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 57/131 (44%), Gaps = 6/131 (5%)
 Frame = +3

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSF------KNFTNYGTDRAGG  443
            G  L  +   +  SAN++     +     +A N  F SY         NF NYG +    
Sbjct  235  GNGLPNEFASYGVSANVIGSGFANYGESGNAANDTFTSYGSDGNVPQNNFKNYGAEGNSA  294

Query  444  VDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkF  623
            VD+F NY D  N+  DSF  Y++DS   +  F NY  + N   ++F +YG  +   K  F
Sbjct  295  VDTFTNYRDAANVGDDSFTSYAKDSNAEKVNFVNYGQSFNPGSETFTSYGKEAVNHKISF  354

Query  624  SNYGPEVNVPD  656
              Y P     D
Sbjct  355  KTYTPNSTFKD  365



>ref|XP_006392169.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
 gb|ESQ29455.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
Length=622

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW K+I+ DL  P F L+KASPL A +   ++ +A+    +L T+   F
Sbjct  35   NPFTPKASLIRYWNKRINGDLPNPSFFLSKASPLTAVESTRFASLASR--HALHTRPSEF  92

Query  315  CSSANLLCFPDLSPS--LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            CS+A L CFP+L+     +KH  +V+F  YS KNFTNYG+DR  GVDSFKNY+  +NI V
Sbjct  93   CSAAKLFCFPELAAHSIADKHGDDVSFVVYSRKNFTNYGSDRLSGVDSFKNYSGGDNIAV  152

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            DSFRRYSRDS GH D FSNYA + NV DQSF TY T STGG G F++Y    N P+ RFT
Sbjct  153  DSFRRYSRDSAGHGDGFSNYAGDVNVADQSFTTYATESTGGSGDFTSYHTNANQPNGRFT  212

Query  669  SYS  677
            SYS
Sbjct  213  SYS  215


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  D+F +Y  N N+PV+ F++Y  +  G    F NY    N+   SF++Y
Sbjct  267  FTGYGETENGANDTFTSYGGNGNLPVNDFKKYGEEGNGAVYGFKNYRDQSNIGVDSFSSY  326

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S   K  F NYG   N+    FT Y
Sbjct  327  AKDSNNEKVNFVNYGKSFNLGSDNFTGY  354



>gb|KFK44451.1| hypothetical protein AALP_AA1G258600 [Arabis alpina]
Length=621

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA L+RYW ++I +      FLL+KASPL A   A ++K+A++   SL  +LP F
Sbjct  35   NPFTPKASLVRYWNREIQSQSPGSEFLLSKASPLTAVASAVFAKLASE--NSLPDRLPDF  92

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            C +ANL CFPDL PSLE+H  NV F+ Y  +NFTNYGT RAGG DSFK Y+ + N+  DS
Sbjct  93   CFAANLFCFPDLGPSLERHGNNVKFSVYDQRNFTNYGTVRAGGDDSFKKYSQDGNVVTDS  152

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FR+YSR+  GH+++F  Y  N NVV+++FN+YG ++TGG G F +Y   VN P  RFTSY
Sbjct  153  FRQYSREGAGHDEKFKGYGGNSNVVEENFNSYGKAATGGSGDFRSYQTGVNNPTSRFTSY  212

Query  675  S  677
            S
Sbjct  213  S  213



>ref|XP_011071835.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Sesamum indicum]
Length=635

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            SNPFTP+A ++RYW K ISN+L +P FLL+KASPL+  + A ++K+AA+  ++LS  L  
Sbjct  42   SNPFTPRASVVRYWAKHISNNLPQPSFLLSKASPLSPVESAFFTKLAAE--KALSAHLSA  99

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            FCS+A+L C     P++E H  + NFA Y+ KNF NYG  R GGVD FKNY+D  N    
Sbjct  100  FCSAADLFCLHGSKPAVESHKSDANFAFYTNKNFANYGNARLGGVDQFKNYSDGVNFATG  159

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SF RYSR S GH + F++YA +GNV   +F +YG+S+TGG G F  Y P VNVPD+RFTS
Sbjct  160  SFARYSRGSTGHHEGFASYASDGNVASSNFTSYGSSATGGAGDFKTYMPRVNVPDLRFTS  219

Query  672  Y  674
            Y
Sbjct  220  Y  220



>ref|NP_176242.1| polygalacturonase 1 [Arabidopsis thaliana]
 sp|O80760.1|Y639_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
At1g60390; AltName: Full=Aromatic-rich glycoprotein At1g60390; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24065.1| Strong similarity to AR0GP2 gene gb|1762634 from Lycopersicon 
esculentum [Arabidopsis thaliana]
 dbj|BAE99558.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33681.1| polygalacturonase 1 [Arabidopsis thaliana]
Length=624

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 3/182 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW   I+ D  KP F L+KASPL A     ++ +A++   +L+T    F
Sbjct  38   NPFTPKASLIRYWNNHINGDSPKPSFFLSKASPLTAVDSTRFASLASN--HALNTHHSDF  95

Query  315  CSSANLLCFPDLSP-SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CS+A L CFP+L+  SLEKH  +VNFA+YS KNFTNYG+DR  G DSFKNY+  +NI VD
Sbjct  96   CSAAKLFCFPELAAHSLEKHGDDVNFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIAVD  155

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSR+S GH+D F+NYA   NV DQSF TY T +TGG G+F+NY  + N P+ RFTS
Sbjct  156  SFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATGTTGGSGEFTNYNTDANEPNGRFTS  215

Query  672  YS  677
            YS
Sbjct  216  YS  217


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  DSF +Y +N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  269  FTKYGESANGANDSFTSYGENGNVPVNEFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  329  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  356



>ref|XP_006586545.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=411

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            GG + G+  NPFTPKAY+ RYW K + N+L KP FLL+KAS ++A+    ++K+AA    
Sbjct  6    GGRNLGD-KNPFTPKAYVARYWDKHVLNNLPKPSFLLSKASSMSASDTTSFAKLAA--AN  62

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYS-FKNFTNYGTDRAGGVDSFKNY  464
             LST+LP FCS+A+LLCF ++ PSLEKH  +  F +Y+  +NFTNYG   AGG+D+FKNY
Sbjct  63   KLSTRLPEFCSAAHLLCFQEVRPSLEKHTEDAGFETYNDGQNFTNYGIYFAGGIDAFKNY  122

Query  465  TDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEV  644
            +  + I V+ FRRYSR S GH + F+ Y  + NV D+SF+TY T++ GG G+F NY    
Sbjct  123  S--KTILVNDFRRYSRSSAGHGESFTGYGEDTNVADKSFHTYSTNAGGGSGEFKNYSSNS  180

Query  645  NVPDMRFTSY  674
            NVPD+RF +Y
Sbjct  181  NVPDVRFATY  190



>emb|CDY53059.1| BnaA09g14240D [Brassica napus]
Length=623

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW K+I+     P F L+KASPL       ++ +A+    +L T+L  F
Sbjct  36   NPFTPKASLIRYWNKRINGGSPPPSFFLSKASPLTTVDSTRFASLASR--HALDTRLSDF  93

Query  315  CSSANLLCFPDLSPS--LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            C++A L CFP+L+     EKH  +V F+ YS KNFTNYG+DR  G D+FKNY+  +NI V
Sbjct  94   CTAAKLFCFPELAAHSVTEKHGDDVGFSVYSDKNFTNYGSDRLAGADTFKNYSGGDNIGV  153

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            DSFRRYSRDS GH+D F+NYA   NV DQSF TY T STGG G F+NY    N P+ RFT
Sbjct  154  DSFRRYSRDSAGHDDGFTNYAGEVNVADQSFTTYATGSTGGSGDFTNYHTNANQPNGRFT  213

Query  669  SYS  677
            SYS
Sbjct  214  SYS  216



>ref|XP_009113216.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Brassica rapa]
Length=623

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW K+I+     P F L+KASPL       ++ +A+    +L T+L  F
Sbjct  36   NPFTPKASLIRYWNKRINGGSPPPSFFLSKASPLTTVDSTRFASLASR--HALDTRLSDF  93

Query  315  CSSANLLCFPDLSPS--LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            C++A L CFP+L+     EKH  +V F+ YS KNFTNYG+DR  G D+FKNY+  +NI V
Sbjct  94   CTAAKLFCFPELAAHSVTEKHGDDVGFSVYSDKNFTNYGSDRLAGADTFKNYSGGDNIGV  153

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            DSFRRYSRDS GH+D F+NYA   NV DQSF TY T STGG G F+NY    N P+ RFT
Sbjct  154  DSFRRYSRDSAGHDDGFTNYAGEVNVADQSFTTYATGSTGGSGDFTNYHTNANQPNGRFT  213

Query  669  SYS  677
            SYS
Sbjct  214  SYS  216



>gb|KEH20007.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=627

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA+ IRYW + I N L KP F+LNKASPL+A + A ++K AA    +LST+LP F
Sbjct  31   NPFTAKAFAIRYWDRVIKNKLPKPTFILNKASPLSATETAAFAKHAAA--NTLSTKLPEF  88

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYS-FKNFTNYGTDRAGGVDSFKNYTDN-ENIPV  488
            CS+A+LLCFP+++P+L KH+ +  F+ Y+  +NFTNYGT+R GG+DSFKNY++  EN P+
Sbjct  89   CSAAHLLCFPEVTPNLAKHSQDGKFSVYNDGQNFTNYGTERPGGLDSFKNYSNGFENNPI  148

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            + FR+YSR S GH D F+NYA   NV DQ+FNTYG+ + GG G F  Y    NVP++RFT
Sbjct  149  NEFRQYSRSSAGHNDSFTNYALETNVADQNFNTYGSGAAGGSGDFKAYAKGTNVPNLRFT  208

Query  669  SYS  677
            +YS
Sbjct  209  TYS  211


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++F NYG D AG  + F  Y  + N+    F  Y+    G++D F NY  N N   ++F 
Sbjct  233  QSFGNYGKDSAGAENKFTAYGTDSNVASSGFSSYADQGTGNKDTFVNYGVNMNNPTENFK  292

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
             Y + S G   KFSNY  + NV    FTSY+
Sbjct  293  NYASGSLGAAEKFSNYRDQANVGADSFTSYA  323


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 45/89 (51%), Gaps = 0/89 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT Y    AG    F +Y++  N    SF  Y +DS G E++F+ Y  + NV    F++Y
Sbjct  207  FTTYSVGVAGRQQEFTSYSEAGNAGDQSFGNYGKDSAGAENKFTAYGTDSNVASSGFSSY  266

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSYS  677
                TG K  F NYG  +N P   F +Y+
Sbjct  267  ADQGTGNKDTFVNYGVNMNNPTENFKNYA  295



>emb|CDY47228.1| BnaC09g14770D [Brassica napus]
Length=623

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW K+I+     P F L+KASPL       ++ +A+    +L T+L  F
Sbjct  36   NPFTPKASLIRYWNKRINGGSPPPSFFLSKASPLTTVDSTRFATLASR--HALDTRLYDF  93

Query  315  CSSANLLCFPDLSPS--LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            C++A L CFP+L+     EKH  +V F+ YS KNFTNYG+DR  G D+FKNY+  +NI V
Sbjct  94   CTAAKLFCFPELAAHSVTEKHGDDVGFSVYSDKNFTNYGSDRLAGADTFKNYSGGDNIGV  153

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            DSFRRYSRDS GH+D FSNYA   NV DQSF TY T STGG G F+NY    N P+ RFT
Sbjct  154  DSFRRYSRDSAGHDDGFSNYAGEVNVADQSFTTYATGSTGGAGDFTNYHTNANQPNGRFT  213

Query  669  SYS  677
            SYS
Sbjct  214  SYS  216



>ref|XP_006300871.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
 gb|EOA33769.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
Length=628

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 131/183 (72%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISN-DLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            NPFTPKA L+RYW   I+  D  KP F ++KASPL   +   ++ +A++   +L T+   
Sbjct  41   NPFTPKASLLRYWNNHINGGDSPKPSFFISKASPLTHVEATRFASLASN--HALHTRSSY  98

Query  312  FCSSANLLCFPDLSP-SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            FCS+A L CFP+LS  SLEKH  +V+FA+YS KNFTNYG+DR  G DSFKNY+  +NI V
Sbjct  99   FCSAAKLFCFPELSSHSLEKHGDDVDFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIAV  158

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            DSFRRYSR+S GH+D F+NYA + NV DQSF+TY T +TGG G+F++Y    N P+  FT
Sbjct  159  DSFRRYSRNSAGHDDGFTNYAGDVNVADQSFSTYATGTTGGSGEFASYNTNANEPNGIFT  218

Query  669  SYS  677
            SYS
Sbjct  219  SYS  221


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG +  G  DSF +Y  N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  273  FTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  332

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  333  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  360



>gb|EPS60630.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=595

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 124/184 (67%), Gaps = 1/184 (1%)
 Frame = +3

Query  126  ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQL  305
            E +NPFTPK YL+RYWK  I  + A P FLL KASPL AAQ A ++++A DG   LS +L
Sbjct  2    EGANPFTPKGYLLRYWKAHILGESAFPEFLLEKASPLTAAQNAAFAEIAGDGSR-LSAKL  60

Query  306  PGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIP  485
            P FC+ A L CFPDLS S EKH  N +FA+Y  +NF++YG  R+ G DSF++Y ++    
Sbjct  61   PEFCAQAGLFCFPDLSQSPEKHDRNADFATYLDRNFSSYGDKRSYGTDSFQHYAEHGTTA  120

Query  486  VDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRF  665
            V++FR YSR+S  H D+F +Y  + NV DQSF+TYG  +  G G F NY   VN  ++RF
Sbjct  121  VNAFRSYSRESFSHFDKFDSYGTDNNVADQSFDTYGKEANTGAGTFENYNNRVNDQNLRF  180

Query  666  TSYS  677
             +YS
Sbjct  181  ATYS  184


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  GNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAP  554
            G  N A+    NF +Y  +  GG D+F +Y +N N P ++FR Y     G  D F+ Y  
Sbjct  222  GYANGANSVTSNFNSYDRNGNGGNDTFSSYGENGNNPTNNFRNYDSQGNGGTDSFTTYRN  281

Query  555  NGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
              N+ + +FN+YGT S G    F++YG   N     FT+Y
Sbjct  282  QSNIGNDNFNSYGTKSNGLTIGFAHYGESYNQGTDNFTTY  321



>ref|XP_006438393.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
 gb|ESR51633.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
Length=618

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
             G D     NPFTPKAYL+RYW K I N L K  FLL+KASPL+A   + ++K+A  G  
Sbjct  12   AGHDVNAKENPFTPKAYLMRYWDKTIHNSLPKSPFLLSKASPLDAVDSSRFAKLAEQG--  69

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYT  467
            +LST LP FCSSANL CFPDLSPS   H  + +FA Y+ KNFTNYG+ + GGVDSFKNY+
Sbjct  70   TLSTALPSFCSSANLFCFPDLSPS-SNHNTDSDFAVYNNKNFTNYGSGKVGGVDSFKNYS  128

Query  468  DNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN  647
            D E +P  SF RYS +S  H D+F++Y+  G  ++Q F+ YG+S+T G G FS Y P+ N
Sbjct  129  DGEPVPNLSFHRYSGESTSHNDKFNSYSSQGQFINQRFDKYGSSATDGAGDFSTYNPDNN  188

Query  648  VPDM-RFTSYS  677
               + +F +YS
Sbjct  189  DLGLSQFATYS  199



>ref|XP_010682558.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 128/188 (68%), Gaps = 11/188 (6%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKAY IRYW  +I   + +P FLL+KASPL+++  A ++++A+    SLST L  F
Sbjct  45   NPFTPKAYAIRYWNNKIYK-VPRPQFLLSKASPLSSSDSARFTQLAST--NSLSTHLTTF  101

Query  315  CSSANLLCFPD--------LSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTD  470
            C  ANLLCFPD         S S +KH  +  F++YS  NFTNY T  AGG++SF NY+ 
Sbjct  102  CKLANLLCFPDPTTFSLSSTSSSSKKHPSDAKFSAYSDNNFTNYATGAAGGLNSFTNYSA  161

Query  471  NENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNV  650
             EN P+DSFRRYSRDS GH D F NYA +GNV+ Q+FNTY   +TGG G FS+Y   VN 
Sbjct  162  EENEPLDSFRRYSRDSAGHNDEFINYAKDGNVISQTFNTYAAGATGGAGSFSSYADNVNA  221

Query  651  PDMRFTSY  674
            P ++FTSY
Sbjct  222  PGLQFTSY  229


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 57/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  360  LEKHAGNVN-FASYSF------KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDS  518
            L++  G VN F SYS       + F NYG +  G ++ F  Y +N N+   +F  YS+  
Sbjct  230  LDEANGRVNSFKSYSTEANAGDQGFGNYGKNGNGLINGFSRYGENTNVVGSTFSGYSQTG  289

Query  519  VGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
                D F++Y  NGNV +  FN+Y      G   FS+Y  + NV D  F SY+
Sbjct  290  NSGNDSFTSYGFNGNVPENKFNSYADGGNAGVESFSSYRDQSNVGDDVFKSYA  342


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 3/107 (3%)
 Frame = +3

Query  357  SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDR  536
            S   +A NVN     F   T+Y  +  G V+SFK+Y+   N     F  Y ++  G  + 
Sbjct  211  SFSSYADNVNAPGLQF---TSYLDEANGRVNSFKSYSTEANAGDQGFGNYGKNGNGLING  267

Query  537  FSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            FS Y  N NVV  +F+ Y  +   G   F++YG   NVP+ +F SY+
Sbjct  268  FSRYGENTNVVGSTFSGYSQTGNSGNDSFTSYGFNGNVPENKFNSYA  314



>ref|XP_006484316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630-like 
[Citrus sinensis]
Length=632

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
             G D     NPFTPKAYL+RYW K I N L K  FLL+KASPL+A   + ++K+A  G  
Sbjct  26   AGHDVNAKENPFTPKAYLMRYWDKTIHNSLPKSPFLLSKASPLDAVDSSRFAKLAEQG--  83

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYT  467
            +LST LP FCSSANL CFPDLSPS   H  + +FA Y+ KNFTNYG+ + GGVDSFKNY+
Sbjct  84   TLSTALPSFCSSANLFCFPDLSPS-SNHNTDSDFAVYNNKNFTNYGSGKVGGVDSFKNYS  142

Query  468  DNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN  647
            D E +P  SF RYS +S  H D+F++Y+  G  ++Q F+ YG+S+T G G FS Y P+ N
Sbjct  143  DGEPVPNLSFHRYSGESTSHNDKFNSYSSQGQFINQRFDKYGSSATDGAGDFSTYNPDNN  202

Query  648  VPDM-RFTSYS  677
               + +F +YS
Sbjct  203  DLGLSQFATYS  213



>ref|XP_002318036.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
 gb|EEE96256.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
Length=637

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 120/181 (66%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+P+A LIRYW K ISN L KP FLL+KASPL+A   A  +K+A     SLS  L  F
Sbjct  45   NPFSPRASLIRYWNKHISNSLPKPLFLLSKASPLSAIDSAILTKLATQ--NSLSLHLDSF  102

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS ANL CF D   SL  H  + NFA YS K F NYG  R  GVDSFKNY++  N   DS
Sbjct  103  CSLANLFCFFDTKQSLRNHDQDSNFALYSNKRFANYGGSRLSGVDSFKNYSNGLNTVADS  162

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F RYSR+S GH + F+NY  +GNV + +F  YG+++TGG G F NY   VNVP +RFT+Y
Sbjct  163  FIRYSRESTGHSETFTNYGNDGNVANATFGNYGSAATGGSGTFKNYDNRVNVPGLRFTTY  222

Query  675  S  677
            +
Sbjct  223  A  223



>emb|CCD74525.1| polygalacturonase 1 [Arabidopsis halleri subsp. halleri]
Length=626

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 128/184 (70%), Gaps = 5/184 (3%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW   I+ D  KP F L+KASPL A     ++ +A++   +L T+   F
Sbjct  38   NPFTPKASLIRYWNNHINGDSPKPSFFLSKASPLTAVDSTRFASLASN--HALHTRHSDF  95

Query  315  CSSANLLCFPDLSPSL---EKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIP  485
            CS+A L CFP+L+ +    +KH  +V FA+YS KNFTNYG+DR  G DSFKNY+  +NI 
Sbjct  96   CSAAKLFCFPELANAHSISDKHGDDVTFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIA  155

Query  486  VDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRF  665
            VDSFRRYSR+S GH+D F+NYA   NV DQSF TY T +TGG G+F+NY    N P+ RF
Sbjct  156  VDSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATGTTGGSGEFTNYNTNANEPNGRF  215

Query  666  TSYS  677
            TSYS
Sbjct  216  TSYS  219


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  DSF +Y +N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  271  FTKYGETANGANDSFTSYGENGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  330

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  331  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  358



>ref|XP_002886622.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62881.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW   I+ D  KP F L+KASPL A     ++ +A+     L T+   F
Sbjct  38   NPFTPKASLIRYWNNHINGDSPKPSFFLSKASPLTAVDSTRFASLAST--HVLHTRHSDF  95

Query  315  CSSANLLCFPDLS--PSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            CS+A L CFP+L+   S++KH  +V+FA+YS KNFTNYG+DR  G DSFKNY+  +NI V
Sbjct  96   CSAAKLFCFPELANAHSVDKHGDDVSFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIAV  155

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            DSFRRYSR+S GH+D F+NYA   NV DQSF TY T +TGG G+F++Y    N P+ RFT
Sbjct  156  DSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATGTTGGSGEFTSYNTNANEPNGRFT  215

Query  669  SYS  677
            SYS
Sbjct  216  SYS  218


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  DSF +Y +N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  270  FTKYGETANGANDSFTSYGENGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  329

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  330  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  357



>gb|KDO69698.1| hypothetical protein CISIN_1g0378482mg, partial [Citrus sinensis]
Length=495

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 120/180 (67%), Gaps = 2/180 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NP+T KA LIRYW   ISN+L KP F+L+KASPLNA   A  + +AA    +LS+ LP F
Sbjct  74   NPYTAKASLIRYWNNHISNNLPKPEFILSKASPLNAIHLAKLTILAAQ--NTLSSHLPAF  131

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS ANL+C  +          + +FA YS KNF NYG  + GG+DSFKNY+   N P DS
Sbjct  132  CSLANLICTLEFDDQSSSSIRDASFAVYSNKNFANYGDSKLGGIDSFKNYSQALNTPNDS  191

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F++YSR+S GH + F++YA +GNV +++F +Y  ++  G G F+NY   VNVP++RF SY
Sbjct  192  FKKYSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFTNYAERVNVPNLRFASY  251



>ref|XP_010553600.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Tarenaya hassleriana]
Length=626

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 130/185 (70%), Gaps = 7/185 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPW-FLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            NPFTPKA L+RYW K+I  D  KP  F L+KASPL+A     +  +A+    +L T+L  
Sbjct  37   NPFTPKASLVRYWDKRIDGDSTKPTPFFLSKASPLSAVDSTRFVSLASR--HALHTRLRD  94

Query  312  FCSSANLLCFPDLS--PSLEKHAGNVNFASYSFKNFTNYGTDR-AGGVDSFKNYTDNENI  482
            FC++A L CFP+L+  P+ ++H G+VNF+ Y+ KNFTNYG++R AG  D FKNY+  +NI
Sbjct  95   FCTAAVLFCFPELANFPA-KQHDGDVNFSVYTNKNFTNYGSNRLAGAGDEFKNYSTGDNI  153

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
             +DSFRRYSRDS GH D FS YA + NV DQSFNTYG  STGG G F+ Y   VN P+ R
Sbjct  154  AIDSFRRYSRDSAGHSDGFSTYADDANVADQSFNTYGAGSTGGSGDFTAYLAGVNGPNGR  213

Query  663  FTSYS  677
            FTSYS
Sbjct  214  FTSYS  218


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT+Y  D  G   SF +Y+ + N  V +F  YS++  G  + FS Y    NVV   F+ Y
Sbjct  214  FTSYSDDANGRSQSFTSYSSDANAGVQAFTSYSKNGNGAPNEFSGYGTGSNVVQSDFSGY  273

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
            G ++ G    F++YG + N+P   F SY
Sbjct  274  GQTANGENDTFTSYGTDGNIPVNNFRSY  301



>ref|XP_011044316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=637

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 120/181 (66%), Gaps = 2/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+P+A LIRYW K ISN L KP FLL+KASPL+A   A  +K+A     SLS  L  F
Sbjct  45   NPFSPRASLIRYWNKHISNSLPKPLFLLSKASPLSAVDSAILTKLATQ--NSLSLHLDSF  102

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS ANL CF D   SL  H  + NFA YS K F NYG  R  GVDSFKNY++  N   DS
Sbjct  103  CSLANLFCFFDPKQSLRNHDHDSNFALYSNKRFANYGASRLSGVDSFKNYSNGLNSVADS  162

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F RYSR+S G  + F+NY  +GNV + +F  YG+++TGG G F NY  +VNVP +RFT+Y
Sbjct  163  FIRYSRESTGQSETFTNYGNDGNVANATFGNYGSAATGGSGTFKNYDSQVNVPGLRFTTY  222

Query  675  S  677
            +
Sbjct  223  A  223



>ref|XP_010555103.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=602

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 127/198 (64%), Gaps = 11/198 (6%)
 Frame = +3

Query  102  IMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG  281
            ++GG  + E  NPFTPKA L+RYW K+I  +  +  FLL+KASPL A + A ++K+AA  
Sbjct  25   LIGGGFAAE-ENPFTPKASLVRYWNKEIRRESHRSEFLLSKASPLTAVESASFAKLAAV-  82

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
             +SLST+LP FCS+ANL CFPDL PSLEKH  +V+F+ Y  KNFTNYGT RAGGVDSFKN
Sbjct  83   -DSLSTRLPEFCSAANLFCFPDLGPSLEKHTDDVSFSVYDQKNFTNYGTSRAGGVDSFKN  141

Query  462  YTDNENIPVDSFRRYSRDS------VGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkF  623
            Y+ + N+  DSFRRYSR+S       G    FSNY    N     F +Y + S+     F
Sbjct  142  YSLDGNVVADSFRRYSRNSTCGRSATGGGGDFSNYQTGVNNPTSRFTSY-SDSSIRSQTF  200

Query  624  SNYGPEVNV-PDMRFTSY  674
              Y  E N  P   FTSY
Sbjct  201  KTYSHEANAGPGQSFTSY  218


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++FT+YG    G  + F +Y  + N+    F  Y+    G  D F++Y  +GNV   +F 
Sbjct  213  QSFTSYGKHGNGAANEFSSYAVSSNVVGSGFSNYAEHGNGANDTFTSYGSDGNVPQNNFR  272

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
             YG +   G   FSNY    NV D  F+SY+
Sbjct  273  NYGAAGNAGVEAFSNYRDTANVGDDSFSSYA  303



>ref|XP_006439797.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
 gb|ESR53037.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
Length=608

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 120/180 (67%), Gaps = 2/180 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NP+T KA LIRYW   ISN+L KP F+L+KASPLNA   A  + +AA    +LS+ LP F
Sbjct  36   NPYTAKASLIRYWNNHISNNLPKPEFILSKASPLNAIHLAKLTILAAQ--NTLSSHLPAF  93

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS ANL+C  +          + +FA YS KNF NYG  + GG+DSFKNY+   N P DS
Sbjct  94   CSLANLICTLEFDDQSSSSIRDASFAVYSNKNFANYGDSKLGGIDSFKNYSQALNTPNDS  153

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F++YSR+S GH + F++YA +GNV +++F +Y  ++  G G F+NY   VNVP++RF SY
Sbjct  154  FKKYSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFTNYAERVNVPNLRFASY  213



>ref|XP_009394250.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=646

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA ++RYW ++++ +  +P FLL+K SPL+A  YA +S +AA G  +LS +LP  
Sbjct  43   NPFTAKAAVMRYWNRKVTANRPQPAFLLSKLSPLSALDYATFSSLAAAGPSALSPRLPAL  102

Query  315  CSSANLLCFP----DLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            C++A LLCFP      + +     G  +FA+Y   NF+NY T   GG  SF+NY+++ N+
Sbjct  103  CAAARLLCFPTRFESYASATTARDGPSDFATYQTSNFSNYATGAVGGTQSFENYSESLNV  162

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
            PVD+FRRYSRDS GH D F++YAP GNVV   F +Y +S+TGG G F++YG + N P+++
Sbjct  163  PVDTFRRYSRDSAGHNDSFASYAPGGNVVTAKFTSYASSATGGTGDFTSYGDDTNNPELK  222

Query  663  FTSY  674
            FT+Y
Sbjct  223  FTNY  226


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++F  YG D  G V +F +Y ++ N+    F  Y   +    D F+NY  NGNV + +F 
Sbjct  249  QSFAGYGKDGNGVVSAFASYANDSNVIGSGFAGYGEGANAARDSFTNYGFNGNVPENNFR  308

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            +YG    GG  +FS+Y  E NV D  FTSY+
Sbjct  309  SYGDRGNGGSERFSSYRDESNVGDDSFTSYA  339


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 66/145 (46%), Gaps = 10/145 (7%)
 Frame = +3

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKN------FTN  419
            YS+ +A   +S ++  PG     N++     S +     G  +F SY          FTN
Sbjct  170  YSRDSAGHNDSFASYAPG----GNVVTAKFTSYASSATGGTGDFTSYGDDTNNPELKFTN  225

Query  420  YGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgts  599
            Y     G   SF +Y+D+ N    SF  Y +D  G    F++YA + NV+   F  YG  
Sbjct  226  YDAQANGRHQSFGSYSDDANSGDQSFAGYGKDGNGVVSAFASYANDSNVIGSGFAGYGEG  285

Query  600  stggkgkFSNYGPEVNVPDMRFTSY  674
            +   +  F+NYG   NVP+  F SY
Sbjct  286  ANAARDSFTNYGFNGNVPENNFRSY  310


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 41/88 (47%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F  YG       DSF NY  N N+P ++FR Y     G  +RFS+Y    NV D SF +Y
Sbjct  279  FAGYGEGANAARDSFTNYGFNGNVPENNFRSYGDRGNGGSERFSSYRDESNVGDDSFTSY  338

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               S  G  +F NYG   N     F  Y
Sbjct  339  AKGSNAGTAEFDNYGNSFNPGSDSFKGY  366



>ref|XP_010678748.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=628

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 127/189 (67%), Gaps = 12/189 (6%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+ KA LIRYW   ISN+  KP FLL+KASPLNA   A ++K+ A+   +L+T+L  F
Sbjct  35   NPFSAKASLIRYWNTHISNNHPKPSFLLSKASPLNAIDTAVFTKLVAE--HALNTRLTSF  92

Query  315  CSSANLLCFPDLSPSLEKHAG--------NVNFASYSFKNFTNYGTDRAGGVDSFKNYTD  470
            CS+ANL C  D   SL+            + NF SY+ K FT YG  R GGVDSFKNY+D
Sbjct  93   CSAANLYC--DFDTSLQDQINRPAPPRKEDANFISYTNKQFTTYGRSRGGGVDSFKNYSD  150

Query  471  NENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNV  650
            N N+PV+SF RYS +S GH ++F+NYA NGNV + SF +YG   TGG G+F NY   VNV
Sbjct  151  NINMPVNSFTRYSSNSAGHGEKFANYADNGNVANDSFMSYGAGGTGGLGEFKNYESNVNV  210

Query  651  PDMRFTSYS  677
            P++ F+SYS
Sbjct  211  PNLHFSSYS  219



>ref|XP_006476763.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390-like 
[Citrus sinensis]
Length=624

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 124/183 (68%), Gaps = 8/183 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NP+T KA LIRYW   ISN+L KP F+L+KASPLNA   A  + +AA    +LS+ LP F
Sbjct  38   NPYTAKASLIRYWNNHISNNLPKPEFILSKASPLNAIHLAKLTILAAQ--NTLSSHLPAF  95

Query  315  CSSANLLC---FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIP  485
            CS ANL+C   F D S S  + A   +FA YS KNF NYG  + GG+DSFKNY+   N P
Sbjct  96   CSLANLICTFEFDDQSSSSIRDA---SFAVYSNKNFANYGDSKLGGIDSFKNYSQALNTP  152

Query  486  VDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRF  665
             DSF++YSR+S GH + F++YA +GNV +++F +Y  ++  G G F+NY   VNVP++RF
Sbjct  153  NDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFNNYAERVNVPNLRF  212

Query  666  TSY  674
             SY
Sbjct  213  ASY  215



>ref|XP_010510953.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=626

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW   I+ D  KP F ++KASPL       ++ +A++   SL T+   F
Sbjct  40   NPFTPKASLIRYWNNHINGDSPKPSFFISKASPLTPVDSTRFASLASN--HSLHTRHSDF  97

Query  315  CSSANLLCFPDLSP-SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CS+A L CFP+L+  SLEKH  +V+FASYS KNFTNYG+DR  G DSFKNY+  +NI VD
Sbjct  98   CSAAKLFCFPELAAHSLEKHGDDVDFASYSGKNFTNYGSDRLSGADSFKNYSGGDNIAVD  157

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSR+S GH++ F+ YA + NV DQ+F TY T +TGG G+F++Y    N P+ RFTS
Sbjct  158  SFRRYSRNSAGHDEGFTTYAGDVNVADQTFTTYATGTTGGSGEFTSYNTNANEPNGRFTS  217

Query  672  YS  677
            YS
Sbjct  218  YS  219



>gb|KDP31113.1| hypothetical protein JCGZ_11489 [Jatropha curcas]
Length=627

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 121/187 (65%), Gaps = 2/187 (1%)
 Frame = +3

Query  114  EDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESL  293
            +DS    NPF+PKA LIRYW K ISN L  P FL +KASPL A   A +SK+A     SL
Sbjct  33   QDSPTPLNPFSPKASLIRYWNKHISNSLPNPPFLFSKASPLTAIDSAFFSKLATH--NSL  90

Query  294  STQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDN  473
            S+    FCSSANL C  D    L  H  + NFA YS K F+NYG  R+GGVDSFKNY++ 
Sbjct  91   SSHFDSFCSSANLFCSFDSKAELANHNKDANFALYSNKRFSNYGGSRSGGVDSFKNYSNG  150

Query  474  ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVP  653
             N   DSF +YSRD  GH + F+NYA + NV + +F  YGT +TGG G+F NY   VNVP
Sbjct  151  LNSVTDSFIKYSRDGTGHSETFTNYAADANVANATFGNYGTGATGGSGEFKNYDDRVNVP  210

Query  654  DMRFTSY  674
             +RFT+Y
Sbjct  211  GLRFTTY  217



>ref|XP_010417970.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=628

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW   I+ D  KP F ++KASPL       ++ +A++   SL T+   F
Sbjct  41   NPFTPKASLIRYWNNHINGDSPKPLFFISKASPLTPVDSTRFASLASN--HSLHTRHSDF  98

Query  315  CSSANLLCFPDLSP-SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CS+A L CFP+L+  SLEKH  +V+FA+YS KNFTNYG+DR  G DSFKNY+  +NI VD
Sbjct  99   CSAAKLFCFPELAAHSLEKHGDDVDFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIAVD  158

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRYSR+S GH++ F+ YA + NV DQ+F TY T +TGG G+F++Y    N P+ RFTS
Sbjct  159  SFRRYSRNSAGHDEGFTTYAGDVNVADQTFTTYATGTTGGSGEFTSYNTNANEPNGRFTS  218

Query  672  YS  677
            YS
Sbjct  219  YS  220



>ref|XP_010924225.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA-ADGGESLSTQLPG  311
            NPFT KA LIRYW +++ N    P FL++K SPL+A   A +S +A + GG +LS++LP 
Sbjct  38   NPFTAKAALIRYWNRKVPNGRPHPSFLVSKLSPLSALDTASFSSLATSGGGAALSSRLPA  97

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
             C++A LLC P LS S   H  +  FA YS  NF+NYGTDR GG DSFKNY+ +EN P+D
Sbjct  98   LCAAARLLCSPSLSSSAAFHPSDSAFAGYSNSNFSNYGTDRGGGADSFKNYSASENTPID  157

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            +FRRYSRDSV H+D F+ Y P+GNVV  +F +Y T++TGG G FS+Y  E NVPD++FT+
Sbjct  158  TFRRYSRDSVDHDDSFALYQPDGNVVTTNFTSYATAATGGAGDFSSYAHEGNVPDLKFTN  217

Query  672  Y  674
            Y
Sbjct  218  Y  218


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 42/91 (46%), Gaps = 0/91 (0%)
 Frame = +3

Query  402  FKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSF  581
              +F NYG D  G  D+F NY  N N+P ++FR Y        ++FSNY    NV D SF
Sbjct  268  LSDFNNYGEDGNGANDTFTNYGRNGNVPENNFRSYGAGGNAASEKFSNYRDQANVGDDSF  327

Query  582  NTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             +Y      G   F NYG   N     F  Y
Sbjct  328  ASYAKQGNAGAADFENYGNSFNEGSDSFNGY  358


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++F  YG    G   SF +Y +N N+ +  F  Y  D  G  D F+NY  NGNV + +F 
Sbjct  241  QSFAGYGKHGNGIPLSFTSYGNNSNVILSDFNNYGEDGNGANDTFTNYGRNGNVPENNFR  300

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            +YG        KFSNY  + NV D  F SY+
Sbjct  301  SYGAGGNAASEKFSNYRDQANVGDDSFASYA  331


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 65/145 (45%), Gaps = 10/145 (7%)
 Frame = +3

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFK------NFTN  419
            YS+ + D  +S +   P      N++     S +     G  +F+SY+ +       FTN
Sbjct  162  YSRDSVDHDDSFALYQP----DGNVVTTNFTSYATAATGGAGDFSSYAHEGNVPDLKFTN  217

Query  420  YGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgts  599
            Y  D  G V  F  Y+D+ N    SF  Y +   G    F++Y  N NV+   FN YG  
Sbjct  218  YEADANGRVQKFSRYSDDTNSGGQSFAGYGKHGNGIPLSFTSYGNNSNVILSDFNNYGED  277

Query  600  stggkgkFSNYGPEVNVPDMRFTSY  674
              G    F+NYG   NVP+  F SY
Sbjct  278  GNGANDTFTNYGRNGNVPENNFRSY  302



>ref|XP_007036187.1| Polygalacturonase 2, putative [Theobroma cacao]
 gb|EOY20688.1| Polygalacturonase 2, putative [Theobroma cacao]
Length=628

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 132/191 (69%), Gaps = 7/191 (4%)
 Frame = +3

Query  111  GEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGES  290
            G+ S E  +PFT +A LIRYW KQISN+L KP FL++KASPLNA   A  +K+A+   +S
Sbjct  26   GKKSKE--SPFTARASLIRYWNKQISNNLPKPPFLISKASPLNAIDLAKLTKLASQ--KS  81

Query  291  LSTQLPGFCSSANLLCFPDLSP---SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
            LS+ +  FCS ANL C  + S    ++ K   + NFA YS K+FT YGT R GGVDSFKN
Sbjct  82   LSSHIESFCSLANLFCLLEDSSEPDAVGKRDQDANFAVYSSKSFTGYGTSRLGGVDSFKN  141

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+D  N P +SF++YSR S GH + F++YA + NV   +F  YGTS+TGG G F+NY   
Sbjct  142  YSDELNTPNESFKKYSRGSNGHREEFTSYAKDANVATDNFTNYGTSATGGSGGFNNYQER  201

Query  642  VNVPDMRFTSY  674
            VNVP++RFT+Y
Sbjct  202  VNVPNLRFTTY  212



>emb|CBI15046.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 124/180 (69%), Gaps = 2/180 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA LIRYW KQISN L KP FLL+KASPLNA   A  +K+A     +LS+ L  F
Sbjct  40   NPFTAKASLIRYWNKQISNKLPKPSFLLSKASPLNAVDSAVLTKLATQ--NALSSHLSSF  97

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CSSANL C  D SP+ EK   + NFA YS + F NYG  R GGVDSFKNY+D  N+P  S
Sbjct  98   CSSANLFCVFDSSPTSEKQVKDANFAFYSNRGFANYGDSRIGGVDSFKNYSDGLNMPSGS  157

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYS DS  H + F++YA +GNV   SF  YG+ +TGG G+F+NY P VNVP + FT+Y
Sbjct  158  FRRYSGDSTDHHEEFTSYARDGNVATGSFAGYGSGATGGSGEFTNYDPLVNVPHLEFTTY  217


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG       DSFK Y  + N P ++F+ YS       D FSNY    NV D SF +Y
Sbjct  270  FTAYGQLANSQNDSFKAYGHSSNNPHNNFKSYSLGGNAATDTFSNYRDGANVGDDSFQSY  329

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              SS   +  F+NYG   NV +  F  Y
Sbjct  330  ARSSNSAEVNFANYGRTFNVGNDTFKEY  357



>ref|XP_002279813.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=633

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 124/180 (69%), Gaps = 2/180 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA LIRYW KQISN L KP FLL+KASPLNA   A  +K+A     +LS+ L  F
Sbjct  40   NPFTAKASLIRYWNKQISNKLPKPSFLLSKASPLNAVDSAVLTKLATQ--NALSSHLSSF  97

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CSSANL C  D SP+ EK   + NFA YS + F NYG  R GGVDSFKNY+D  N+P  S
Sbjct  98   CSSANLFCVFDSSPTSEKQVKDANFAFYSNRGFANYGDSRIGGVDSFKNYSDGLNMPSGS  157

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYS DS  H + F++YA +GNV   SF  YG+ +TGG G+F+NY P VNVP + FT+Y
Sbjct  158  FRRYSGDSTDHHEEFTSYARDGNVATGSFAGYGSGATGGSGEFTNYDPLVNVPHLEFTTY  217



>ref|XP_008800877.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=637

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGG-ESLSTQLPG  311
            NPFT KA LIRYW +++ N    P FL++K SPL+A   A +S +AA GG  +LS +LP 
Sbjct  39   NPFTAKAALIRYWNRKVPNGRPLPAFLVSKLSPLSALDTASFSSLAASGGGAALSPRLPD  98

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
             C++A LLC P LS S   H  +  FA YS  NF+NYG DRAGG DSFKNY+ +EN P+D
Sbjct  99   LCAAARLLCSPSLSSSNASHPSDSAFAGYSNSNFSNYGADRAGGADSFKNYSASENSPID  158

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            +FRRYSRDSVGH+D F+ Y P+GN+   +F +Y T++TGG G FS+Y  E NVPD++FT+
Sbjct  159  TFRRYSRDSVGHDDSFALYQPDGNIDTANFTSYATAATGGAGDFSSYAHEGNVPDLKFTN  218

Query  672  Y  674
            Y
Sbjct  219  Y  219


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 42/89 (47%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F NYG D  G  D+F NY  N N+P ++FR Y        ++FSNY    NV D SF +
Sbjct  271  DFNNYGEDGNGANDTFTNYGQNGNVPENNFRSYGAAGNAASEKFSNYRDQANVGDDSFTS  330

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y      G   F NYG   N     F  Y
Sbjct  331  YAKEDNAGAADFKNYGNSFNQGTDSFKGY  359


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 82/187 (44%), Gaps = 18/187 (10%)
 Frame = +3

Query  144  TPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGFCSS  323
            +P     RY +  + +D    + L      ++ A +  Y+  A  G          F S 
Sbjct  155  SPIDTFRRYSRDSVGHD--DSFALYQPDGNIDTANFTSYATAATGGAGD-------FSSY  205

Query  324  ANLLCFPDLS-PSLEKHA-GNVN-FASYS------FKNFTNYGTDRAGGVDSFKNYTDNE  476
            A+    PDL   + E  A G V  F+SYS       ++F  YG    G   SF +Y  N 
Sbjct  206  AHEGNVPDLKFTNYEADANGRVQKFSSYSDDTNSGGQSFAGYGKHGNGIPLSFTSYGSNS  265

Query  477  NIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPD  656
            N+    F  Y  D  G  D F+NY  NGNV + +F +YG +      KFSNY  + NV D
Sbjct  266  NVMNSDFNNYGEDGNGANDTFTNYGQNGNVPENNFRSYGAAGNAASEKFSNYRDQANVGD  325

Query  657  MRFTSYS  677
              FTSY+
Sbjct  326  DSFTSYA  332



>ref|XP_010436291.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=209

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA L+RYW K+I ++  +  FL++KASPLN      +SK A     SL T+ P F
Sbjct  17   NPFTPKASLVRYWNKEIRSESPRSEFLISKASPLNVVDSTTFSKPATTN--SLPTRFPDF  74

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS+AN+ CFPDL  SLEKH  +V F++Y  KNFTNYG+ R  G +SFK Y  + N+  DS
Sbjct  75   CSAANIFCFPDLGTSLEKHDEDVKFSTYDQKNFTNYGSGRPEGDESFKYYAKDGNVVTDS  134

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            FRRYS +S  H+D+F+ Y  N NV+DQ FN 
Sbjct  135  FRRYSHNSAAHDDKFTVYGENSNVIDQGFNV  165



>ref|XP_010473218.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=629

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 126/182 (69%), Gaps = 3/182 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW   I+ D  KP F ++KASPL       ++ +A+    SL T+   F
Sbjct  43   NPFTPKASLIRYWNNHINGDSPKPSFFISKASPLTPVDSTRFASLASY--HSLHTRHSDF  100

Query  315  CSSANLLCFPDLSP-SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CS+A L CFP+L+  SLEKH  +V FA+YS KNFTNYG+DR  G DSFKNY+  +NI VD
Sbjct  101  CSAAKLFCFPELAAHSLEKHGDDVEFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIAVD  160

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRY R+S GH++ F+ YA + NV DQ+F TY T +TGG G+F++Y    N P+ RFTS
Sbjct  161  SFRRYGRNSAGHDEGFTTYAGDVNVADQTFTTYATGTTGGSGEFTSYNTNANEPNGRFTS  220

Query  672  YS  677
            YS
Sbjct  221  YS  222



>ref|XP_009593470.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana tomentosiformis]
Length=636

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 118/181 (65%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA L+RYW K+ISN L  P FL +KASPL+A   A Y+ +A    +SLS  LP F
Sbjct  43   NPFTVKASLVRYWNKKISNKLPIPSFLFSKASPLSAVDAAFYTSLATQ--KSLSGHLPSF  100

Query  315  CSSANLLCFPDLSPSLEKH-AGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CSSA L CF D  P L+   + + NFA Y+ K F+NYG+ R GG D+FKNY+D  N    
Sbjct  101  CSSAKLFCFFDSKPYLDASPSKDANFAVYNNKKFSNYGSSRLGGGDNFKNYSDGVNFATG  160

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
             F +YSR S GH + F++YA +GNV   +F +Y   +TGG G F NY P VNVPD+RF S
Sbjct  161  DFTKYSRSSTGHREDFNSYAADGNVASGNFTSYAAGATGGGGTFQNYMPRVNVPDLRFAS  220

Query  672  Y  674
            Y
Sbjct  221  Y  221



>ref|XP_010419424.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=195

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA LIRYW   I+ D  KP F ++KASPL       ++ +A++   SL T+   F
Sbjct  41   NPFTPKASLIRYWNNHINGDSPKPSFFISKASPLTPVDSTRFASLASN--HSLHTRHSDF  98

Query  315  CSSANLLCFPDLSP-SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CS+A L CFP+L+  SLEKH  +V+FA+YS KNFTNYG+DR  G DSFKNY+  +NI VD
Sbjct  99   CSAAKLFCFPELAAHSLEKHGDDVDFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIAVD  158

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            SFRRYSR+S GH++ F+ YA + NV+ +S NT
Sbjct  159  SFRRYSRNSAGHDEGFTTYAGDVNVM-KSHNT  189



>ref|XP_009415276.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 3/187 (2%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            G  +NPFT +A LIRYWK+ +  +  +  FLL K SPL+A   A +S + A    +LS +
Sbjct  34   GAAANPFTARAALIRYWKRMVPTNRPQADFLLAKLSPLSALDSATFSSLVAADPSALSRR  93

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVN---FASYSFKNFTNYGTDRAGGVDSFKNYTDN  473
            LP  C++A LLC P  + +    A   +   FASY   NF++YGT  AGG  SFKNY+D+
Sbjct  94   LPAICAAARLLCSPATANTYSAAARKDDSSAFASYQNSNFSDYGTGAAGGRSSFKNYSDD  153

Query  474  ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVP  653
             N+PVD+FRRYSRDS GH D F++Y+P GNVV  +F +YG+S+TGG G F++Y  E NVP
Sbjct  154  LNVPVDTFRRYSRDSTGHNDSFASYSPEGNVVTANFTSYGSSATGGAGDFASYDHESNVP  213

Query  654  DMRFTSY  674
            D++FT+Y
Sbjct  214  DLKFTNY  220


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++F  YG D  G   SF +Y DN N+   SF  Y   + G  D F++Y  NGNV + +F 
Sbjct  243  QSFAGYGKDGNGVPTSFTSYADNSNVIGSSFAGYGEGANGANDSFASYGFNGNVPENNFR  302

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            +YG     G  +F++Y  + NV D RFTSY+
Sbjct  303  SYGDGGNSGSERFTSYRDQSNVGDDRFTSYA  333


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 55/106 (52%), Gaps = 6/106 (6%)
 Frame = +3

Query  375  GNVNFASYSFKN------FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDR  536
            G  +FASY  ++      FTNY  D  G   SF +Y+D+ N    SF  Y +D  G    
Sbjct  199  GAGDFASYDHESNVPDLKFTNYDADATGRRRSFSSYSDDTNAGDQSFAGYGKDGNGVPTS  258

Query  537  FSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F++YA N NV+  SF  YG  + G    F++YG   NVP+  F SY
Sbjct  259  FTSYADNSNVIGSSFAGYGEGANGANDSFASYGFNGNVPENNFRSY  304



>ref|XP_009393062.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 127/183 (69%), Gaps = 3/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT +A +IRYW +++     +P FLL K SPL+A   A +S +AA    +LST+LP  
Sbjct  38   NPFTARAAVIRYWNRKVPMSRPQPAFLLAKLSPLSAVDSATFSSLAAADPSALSTRLPAL  97

Query  315  CSSANLLCFPDLSPSLEKHAGNVN---FASYSFKNFTNYGTDRAGGVDSFKNYTDNENIP  485
            C++A LLC P  + +    A   +   FASY   NF++YGT  +GG  +FK+Y+D+ N+P
Sbjct  98   CAAARLLCSPAQANTYSAAARKDDSSAFASYQNSNFSDYGTGASGGRSAFKHYSDDLNVP  157

Query  486  VDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRF  665
            VD+FRRYSRDS GH D F++YAP+GNVV  +F +YG+S+TGG G F++Y  E NVPD++F
Sbjct  158  VDTFRRYSRDSTGHNDSFASYAPDGNVVTANFTSYGSSATGGAGDFASYDHESNVPDLKF  217

Query  666  TSY  674
            T+Y
Sbjct  218  TNY  220


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 54/106 (51%), Gaps = 6/106 (6%)
 Frame = +3

Query  375  GNVNFASYSFKN------FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDR  536
            G  +FASY  ++      FTNY  D  G   SF +Y+D+ N    SF  Y +D       
Sbjct  199  GAGDFASYDHESNVPDLKFTNYDADATGRRRSFSSYSDDTNAGDQSFAGYGKDGDRVPTS  258

Query  537  FSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F++YA N NV+  SF  YG  + G    F++YG   NVP+  F SY
Sbjct  259  FTSYANNSNVIGSSFAGYGEGAKGANDSFASYGFNGNVPENNFRSY  304



>gb|KHG12475.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=649

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 129/199 (65%), Gaps = 6/199 (3%)
 Frame = +3

Query  90   NVIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKM  269
            NV+ + G   S    NPFT KA LIRYW   ISN+L KP FL++KASPLNA   A  +++
Sbjct  49   NVVQVFGTGRSEGKENPFTAKASLIRYWNNHISNNLPKPPFLISKASPLNAIDLAKLTQL  108

Query  270  AADGGESLSTQLPGFCSSANLLC-FPDLSPSLE---KHAGNVNFASYSFKNFTNYGTDRA  437
            A     SLS+ +  FCS ANL C F + S  L+   K  G+ NFA YS KNF  YG+   
Sbjct  109  ANH--NSLSSHIESFCSLANLFCSFQEESSKLDAVGKGKGDANFAVYSSKNFKGYGSLSR  166

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG+DSFKNY+D  N P +SF++YSR S  H + F++YA + NV   +F  YG+S+TGG G
Sbjct  167  GGIDSFKNYSDGLNTPNESFKKYSRGSSAHSEDFTSYAKDANVAIDNFTNYGSSATGGSG  226

Query  618  kFSNYGPEVNVPDMRFTSY  674
             F+NY   VNVP++RFTSY
Sbjct  227  GFNNYQDRVNVPNLRFTSY  245



>gb|KJB30299.1| hypothetical protein B456_005G136300 [Gossypium raimondii]
Length=649

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 129/198 (65%), Gaps = 6/198 (3%)
 Frame = +3

Query  93   VIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA  272
            V+ + G   S    NPFT KA LIRYW   ISN+L KP FL++KASPLNA   A  +++A
Sbjct  50   VVLVFGTGRSEGKENPFTAKASLIRYWNNHISNNLPKPPFLISKASPLNAIDLAKLTQLA  109

Query  273  ADGGESLSTQLPGFCSSANLLC-FPDLSPSLE---KHAGNVNFASYSFKNFTNYGTDRAG  440
                 SLS+ +  FCS ANL C F + S  L+   K  G+ NFA YS KNF  YG+ R G
Sbjct  110  NH--NSLSSHIESFCSLANLFCSFQEDSSKLDAVVKGKGDANFAVYSSKNFKGYGSLRRG  167

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G+DSFKNY+D  N P +SF++YSR S  H + F++YA + NV   +F  YG+S+TGG G 
Sbjct  168  GIDSFKNYSDGLNTPNESFKKYSRGSNAHSEDFTSYAKDANVAIDNFTNYGSSTTGGSGG  227

Query  621  FSNYGPEVNVPDMRFTSY  674
            F+NY   VNVP++RFTSY
Sbjct  228  FNNYQERVNVPNLRFTSY  245



>ref|XP_009775426.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana sylvestris]
Length=638

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 115/181 (64%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA L+RYW KQISN L  P FL +KASPL+A   A ++ +A    +SLS  +  F
Sbjct  45   NPFTVKASLVRYWNKQISNKLPIPSFLFSKASPLSAVDAAFFTSLATQ--KSLSGHISSF  102

Query  315  CSSANLLCFPDLSPSLEKHAG-NVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CSSA L CF D  P L    G + NFA Y+ K F +YG+ R GG D+FKNY+D  N    
Sbjct  103  CSSAKLFCFFDSKPYLAPSPGKDANFAVYNNKKFADYGSSRLGGGDNFKNYSDGVNFASG  162

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
             F +YSR S GH + F++YA +GNV   +F +Y   +TGG G F NY P VNVPD+RF S
Sbjct  163  DFTKYSRSSTGHREDFNSYASDGNVASGNFTSYAAGATGGGGTFQNYMPRVNVPDLRFAS  222

Query  672  Y  674
            Y
Sbjct  223  Y  223



>gb|KEH20006.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=644

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 132/204 (65%), Gaps = 11/204 (5%)
 Frame = +3

Query  93   VIGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMA  272
             +G+    +  +  NPFTPKAY+IRYW + I N+L KP F+L+KASPL+A + A ++K A
Sbjct  23   TVGLAINHEKEKNQNPFTPKAYVIRYWDRVIKNNLPKPSFILSKASPLSATEAATFTKHA  82

Query  273  ADGGESLSTQLPGFCSSANLLCFPDLS------PS-LEKHAGNVNFASYSF-KNFTNYGT  428
            A    +LST+LP FCS+A+L CFP+L+      PS    +  + NF  YS  +NFT YGT
Sbjct  83   A--ANTLSTKLPEFCSAAHLFCFPELTKQRPFDPSHFTVYETDQNFTFYSLGENFTTYGT  140

Query  429  DRAGGVDSFKNYTDNE-NIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsst  605
             +  G+D+FKNY++   N   + F RYS+ S GH D F NYA N N   Q+FN+YGT S 
Sbjct  141  HKLNGIDAFKNYSNGLYNEKHNEFARYSKISTGHNDSFKNYALNNNEGVQTFNSYGTKSM  200

Query  606  ggkgkFSNYGPEVNVPDMRFTSYS  677
             G G+F  Y  E N+P+++FT+Y+
Sbjct  201  AGFGEFKAYSEESNIPNLKFTTYT  224



>ref|XP_008776735.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=641

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 2/182 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNA--AQYAGYSKMAADGGESLSTQLP  308
            NPFT KA LIRYW +++ N    P FL++K SPL+A           ++ G  +LS +LP
Sbjct  37   NPFTAKAALIRYWNRKVPNGRPHPDFLVSKLSPLSALDTASFSSLAASSGGSSALSPRLP  96

Query  309  GFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
              C++A LLC P LS S   H  +  FA+YS  NFTNYGTDRAGG DSFKNY+ +EN+P+
Sbjct  97   ALCAAARLLCSPSLSSSTASHPSDSGFAAYSDSNFTNYGTDRAGGADSFKNYSASENLPI  156

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            D+FRRYSRDS GH+D F+ Y P+GNVV  +F +Y +++TGG G FS+Y  EVNVP+++FT
Sbjct  157  DTFRRYSRDSAGHDDSFAVYQPDGNVVTANFTSYASAATGGAGDFSSYASEVNVPNLKFT  216

Query  669  SY  674
            +Y
Sbjct  217  NY  218


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 42/89 (47%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F NYG D  G  D+F NY +N N+P  +FR Y        ++FSNY    NV D SF +
Sbjct  270  DFNNYGEDGNGANDTFTNYGENGNVPETTFRSYGSSGNAGSEKFSNYRDQANVGDDSFTS  329

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y      G   F NYG   N     F  Y
Sbjct  330  YTKGGNAGSADFKNYGNSFNQGSDSFKGY  358


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = +3

Query  405  KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFN  584
            ++F  YG    G   +F +Y +N N+    F  Y  D  G  D F+NY  NGNV + +F 
Sbjct  241  QSFAGYGKHGNGIPLTFISYGNNSNVINSDFNNYGEDGNGANDTFTNYGENGNVPETTFR  300

Query  585  TYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            +YG+S   G  KFSNY  + NV D  FTSY+
Sbjct  301  SYGSSGNAGSEKFSNYRDQANVGDDSFTSYT  331


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 67/146 (46%), Gaps = 12/146 (8%)
 Frame = +3

Query  258  YSKMAADGGESLSTQLP-GFCSSANLLCFPDLSPSLEKHAGNVNFASYSFK------NFT  416
            YS+ +A   +S +   P G   +AN   +   +       G  +F+SY+ +       FT
Sbjct  162  YSRDSAGHDDSFAVYQPDGNVVTANFTSYASAAT-----GGAGDFSSYASEVNVPNLKFT  216

Query  417  NYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgt  596
            NY  D  G V  F +Y+D+ N    SF  Y +   G    F +Y  N NV++  FN YG 
Sbjct  217  NYDADANGRVQRFSSYSDDTNAGDQSFAGYGKHGNGIPLTFISYGNNSNVINSDFNNYGE  276

Query  597  sstggkgkFSNYGPEVNVPDMRFTSY  674
               G    F+NYG   NVP+  F SY
Sbjct  277  DGNGANDTFTNYGENGNVPETTFRSY  302



>ref|XP_004236111.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Solanum lycopersicum]
Length=636

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 116/181 (64%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+ KA L+RYW KQISN L KP FL +KASPL+A   A ++ +A    +SLS  +  F
Sbjct  46   NPFSVKASLVRYWNKQISNKLPKPDFLFSKASPLSAVDAAFFTNLATQ--KSLSGHISTF  103

Query  315  CSSANLLCFPDLSPSLEKH-AGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CSSA L CF + +P L+K  + +  FA Y+ K F  YG+ R GG D FKNY+D  N    
Sbjct  104  CSSAKLFCFSESNPYLDKTPSTDAKFAVYNNKKFATYGSGRLGGGDDFKNYSDGINFATG  163

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
             F +YSR S GH + F++YA +GNV   +F +Y   +TGG G F +Y P VNVPD+RF S
Sbjct  164  EFTKYSRSSTGHHEDFTSYAADGNVATGNFTSYAAGATGGGGTFQSYMPRVNVPDLRFAS  223

Query  672  Y  674
            Y
Sbjct  224  Y  224



>ref|XP_010101197.1| hypothetical protein L484_015001 [Morus notabilis]
 gb|EXB87871.1| hypothetical protein L484_015001 [Morus notabilis]
Length=637

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 118/190 (62%), Gaps = 3/190 (2%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            G E   +  NPFT KA LIRYW KQISN+L KP FLL+KASPL   + A   K+A    +
Sbjct  39   GSESINKNKNPFTAKASLIRYWNKQISNNLPKPNFLLSKASPLGPTETAILIKLATQ--K  96

Query  288  SLSTQLPGFCSSANLLC-FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNY  464
            +LS  L  FCS A+L C F D    +     + NFA+Y+ KNF NYG  R GG DSFKNY
Sbjct  97   NLSAHLESFCSLAHLFCSFDDSKNDVVSSKKDSNFATYANKNFANYGAARLGGGDSFKNY  156

Query  465  TDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEV  644
            +   N P DSFR+YSR S  H + F NYA + NV   +F  YG  +T G G+F  Y  +V
Sbjct  157  SAELNSPNDSFRKYSRGSNSHGEGFDNYAADANVATSTFTNYGADATAGSGEFKTYHRQV  216

Query  645  NVPDMRFTSY  674
            NVP++RF+SY
Sbjct  217  NVPNLRFSSY  226



>ref|XP_007141610.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
 gb|ESW13604.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
Length=611

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 123/185 (66%), Gaps = 6/185 (3%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+PKA+LIRYW  +I+N   KP FLL+KASPL  A+ A ++K+AA+   +LS  LP F
Sbjct  25   NPFSPKAFLIRYWDNKITNKSPKPHFLLSKASPLTVAETATFAKLAAN--NTLSAHLPRF  82

Query  315  CSSANLLCFPD-LSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDN--ENIP  485
            CS+A LLC    LS S ++ + +  FA Y+ +NF++YGT R GG++SFKNY+DN  EN P
Sbjct  83   CSAARLLCHSKPLSLSAQRTSRDAKFAVYNNRNFSDYGTSRLGGLNSFKNYSDNQRENGP  142

Query  486  VDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN-VPDMR  662
             + FR+YS+ SV H D F  Y   GNV++ +F +YG  +T G   + NY   VN   D+ 
Sbjct  143  QNDFRQYSKASVNHSDDFITYGSFGNVINDTFRSYGGGATAGTSSYKNYAEPVNGFDDLE  202

Query  663  FTSYS  677
            F SYS
Sbjct  203  FASYS  207



>ref|XP_004509826.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=636

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA+ IRYW + I N+L KP F+ +KASPL+A   A ++K AA    +LST+LP F
Sbjct  39   NPFTPKAFAIRYWDRVIKNNLPKPSFIFSKASPLSAVDAAAFAKHAAA--NTLSTKLPEF  96

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYS-FKNFTNYGTDRAGGVDSFKNYTDN-ENIPV  488
            CS+A+LLCF D++PSLEK   + +FA Y+  +NFTNYGT + GG+ SFKNY+    +  +
Sbjct  97   CSAAHLLCFQDINPSLEKFPKDTDFAVYNKAENFTNYGTSQPGGLSSFKNYSIGLLSAEL  156

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
            + FR YSRDS  H + F+ YA N N  ++ FNTYGT +  G G F  Y  + NVP++ F 
Sbjct  157  NEFRTYSRDSASHNESFTTYAENTNAAEEKFNTYGTFAAAGSGDFKVYAKDSNVPNLDFN  216

Query  669  SYS  677
            +YS
Sbjct  217  TYS  219



>ref|XP_002511417.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF52019.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=637

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 114/183 (62%), Gaps = 5/183 (3%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+PKA LIRYW K I N L K  FLL+KASPL A   A  S++A     SLS+    F
Sbjct  47   NPFSPKASLIRYWNKHIFNTLPKSPFLLSKASPLTAIDSAFLSRLATQ--NSLSSHFESF  104

Query  315  CSSANLLCFPDLSP---SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIP  485
            CS ANL C  D  P     +    + NFA YS K F NYG  + GGVDSFKNY++  N  
Sbjct  105  CSLANLFCSFDSKPMNLGDKNDNKDANFALYSNKQFANYGRSQLGGVDSFKNYSNGLNSV  164

Query  486  VDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRF  665
             DSF +YSRD+ GH + F+NYA +GNV + +F  YG  +TGG G F NY   VNVP +RF
Sbjct  165  SDSFVKYSRDATGHSEAFTNYATDGNVANATFGNYGAGATGGSGVFKNYDDRVNVPGLRF  224

Query  666  TSY  674
            T+Y
Sbjct  225  TTY  227



>ref|XP_008453099.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=648

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            SNPFTPKA L+RYWK  +S DL  P F L+KASPL++   A  +  AA  G SLS++L  
Sbjct  58   SNPFTPKASLVRYWKTHVSTDLPTPDFFLSKASPLSSVDAAVLATHAA--GASLSSRLES  115

Query  312  FCSSANLLC-FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            FC SANL C F   S        + +F  Y  KNF NYG +R GG DSFKNY+D  N   
Sbjct  116  FCYSANLFCSFDSQSEISVPRFKDADFKLYGNKNFANYGGNRLGGTDSFKNYSDGLNTAE  175

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
             SF+RY  +S  H++ F++YA +GNV + +F +YG  S  G G F+NY   VNVP++RFT
Sbjct  176  HSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAESKSGSGGFTNYDKLVNVPNLRFT  235

Query  669  SY  674
            +Y
Sbjct  236  AY  237



>ref|XP_007210277.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
 gb|EMJ11476.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
Length=613

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 121/189 (64%), Gaps = 11/189 (6%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +NPFTPKA L RYW   ISN+L KP FL +KASPL+    A  +++AA    SL      
Sbjct  10   TNPFTPKASLNRYWDNHISNNLPKPNFLFSKASPLDRVNSAILTQLAAH--NSLPAHFAS  67

Query  312  FCSSANLLCFPDLSPSLEKHAGNV--------NFASYSFKNFTNYGTDRAGGVDSFKNYT  467
            FCS ANL C  D SPS + H  ++        NFA+YS KNF NYG+ + G  DSFKNY+
Sbjct  68   FCSLANLYCSFD-SPSAQTHQQDLVARHFKDANFAAYSNKNFANYGSSQLGDGDSFKNYS  126

Query  468  DNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN  647
            D  N P DSF++YS+D+  H ++F+ YA   NV + SF +YG  S GG G+F++Y  +VN
Sbjct  127  DGLNSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSYGADSAGGSGQFTSYDDQVN  186

Query  648  VPDMRFTSY  674
            VP++RF +Y
Sbjct  187  VPNLRFAAY  195


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  DSFK Y  + N P ++F+ Y        D FSNY    NV D SF +Y
Sbjct  248  FTGYGESGTGQNDSFKGYGQSANNPHNNFKSYGGGGTSGIDGFSNYRSGANVGDDSFQSY  307

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S  GK  FSNYG   N  +  F  Y
Sbjct  308  ARNSNSGKVSFSNYGKSFNPGNDSFKEY  335



>gb|KHN30893.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=541

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 114/184 (62%), Gaps = 1/184 (1%)
 Frame = +3

Query  126  ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQL  305
            EL NPF+PKA LIRYW  ++SN+L  P  LL+KAS L    YA  SK+     +      
Sbjct  15   ELINPFSPKASLIRYWNTRVSNNLPIPHLLLSKASTLTPHHYAILSKLLNQKPKPNENLH  74

Query  306  PGFCSSANLLCFPDLSPSLEKHAGN-VNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
               CSS NLLC  D +P  + H  +  NFA YS K F NYG+ R GGVDSFKNY++  N 
Sbjct  75   HSLCSSPNLLCSFDDTPFAQTHKNDDGNFAVYSNKRFANYGSSRVGGVDSFKNYSNGLNA  134

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
              D+FRRYS  S    ++F NYA NGNV + +F++YG+++     +FSNY   VNVP++ 
Sbjct  135  NNDAFRRYSAASTRRGEQFKNYADNGNVANTNFSSYGSAANQASAEFSNYDKTVNVPNLG  194

Query  663  FTSY  674
            FT+Y
Sbjct  195  FTTY  198



>ref|XP_008346742.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=630

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 116/186 (62%), Gaps = 8/186 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA L RYW   ISN+L KP FL  KAS L+       +K+AA    SLS+    F
Sbjct  29   NPFTPKASLNRYWDXHISNNLPKPAFLFAKASQLDPVNSTILTKLAAQ--NSLSSHFTSF  86

Query  315  CSSANLLCFPDLSPSLE------KHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNE  476
            CS ANL C  D S          +H  N NFA Y+ KNF NYG+ + GGVDSFKNY++  
Sbjct  87   CSLANLCCSFDSSAETHQQDIATRHPKNANFAVYADKNFANYGSSQLGGVDSFKNYSEEL  146

Query  477  NIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPD  656
            N P DSF++YS+ S  H ++F++YA + NV + +F +YG  S GG G+F++Y   VNVP 
Sbjct  147  NSPRDSFKKYSKGSHSHLEKFTSYAHDANVANSNFTSYGADSGGGSGEFTSYDDRVNVPS  206

Query  657  MRFTSY  674
            + FTSY
Sbjct  207  LGFTSY  212



>ref|XP_006578624.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=631

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 114/184 (62%), Gaps = 1/184 (1%)
 Frame = +3

Query  126  ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQL  305
            EL NPF+PKA LIRYW  ++SN+L  P  LL+KAS L    YA  SK+     +      
Sbjct  38   ELINPFSPKASLIRYWNTRVSNNLPIPHLLLSKASTLTPHHYAILSKLLNQKPKPNENLH  97

Query  306  PGFCSSANLLCFPDLSPSLEKHAGN-VNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
               CSS NLLC  D +P  + H  +  NFA YS K F NYG+ R GGVDSFKNY++  N 
Sbjct  98   HSLCSSPNLLCSFDDTPFAQTHKNDDGNFAVYSNKRFANYGSSRVGGVDSFKNYSNGLNA  157

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
              D+FRRYS  S    ++F NYA NGNV + +F++YG+++     +FSNY   VNVP++ 
Sbjct  158  NNDAFRRYSAASTRRGEQFKNYADNGNVANTNFSSYGSTANQASAEFSNYDKTVNVPNLG  217

Query  663  FTSY  674
            FT+Y
Sbjct  218  FTTY  221



>ref|XP_004166494.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
Length=688

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 118/182 (65%), Gaps = 3/182 (2%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            SNPFTPKA L+RYWK  +S DL  P F L+KASPL+A   A  +  AA    SLS++L  
Sbjct  98   SNPFTPKASLVRYWKTHVSTDLPTPDFFLSKASPLSAVDAAALATHAAG--ASLSSRLES  155

Query  312  FCSSANLLC-FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            FC SANL C F   S +    + + +F  Y  KNF NYG +R GG DSFKNY+D  N   
Sbjct  156  FCYSANLFCSFDSQSETSVPRSKDADFKLYGNKNFVNYGGNRLGGTDSFKNYSDGLNTAE  215

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
             SF+RY  +S  H++ F++YA +GNV + +F +YG  S  G G+F+NYG  VNVP++RFT
Sbjct  216  HSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAGSKSGSGEFTNYGKLVNVPNLRFT  275

Query  669  SY  674
            +Y
Sbjct  276  AY  277



>ref|XP_008239752.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=627

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 120/188 (64%), Gaps = 9/188 (5%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +NPFTPK+ L RYW   ISN+L KP FL +KASPL+    A  +++AA    SLS     
Sbjct  24   TNPFTPKSSLNRYWDNHISNNLPKPNFLFSKASPLDRVNSAILTQLAAH--NSLSAHFAS  81

Query  312  FCSSANLLCFPDLSPS-------LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTD  470
            FCS ANL C  D   +       + +H  + NFA+YS KNF NYG+ +  G DSFKNY+D
Sbjct  82   FCSLANLYCSFDSQSAQTHQQDLVARHFKDANFAAYSNKNFANYGSPQPAGGDSFKNYSD  141

Query  471  NENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNV  650
              N P DSF++YS+D+  H ++F+ YA   NV + SF +YG  S GG G+F++Y  +VNV
Sbjct  142  GLNSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSYGADSAGGSGEFTSYDDQVNV  201

Query  651  PDMRFTSY  674
            P++RF +Y
Sbjct  202  PNLRFAAY  209


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  DSFK Y  + N P ++F+ Y        D FSNY    NV D SF +Y
Sbjct  262  FTGYGESGTGQNDSFKGYGQSANNPHNNFKSYGGGGTSGIDGFSNYRSGANVGDDSFQSY  321

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S  GK  FSNYG   N  +  F  Y
Sbjct  322  ARNSNSGKVSFSNYGKSFNPGNDSFKEY  349



>gb|KDP26582.1| hypothetical protein JCGZ_17740 [Jatropha curcas]
Length=625

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 118/180 (66%), Gaps = 2/180 (1%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA L RYW  QI+  L    F+L+KASPL+A     +SK+A+    +LST LP F
Sbjct  42   NPFTPKASLTRYWSNQITTKLPISPFILSKASPLDALTSVSFSKLASQ--NALSTHLPAF  99

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS+A L C+P  SPSL++   + +FA+Y  +NFTNYGT + G   SFK Y+++EN   D+
Sbjct  100  CSAAKLFCYPHSSPSLQEQRKDSDFATYQNQNFTNYGTGQVGLAASFKEYSESENEANDA  159

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            F RYSR +  ++++FS YA   N+   +F TYGT +TGG G F +Y   VN  ++ FTSY
Sbjct  160  FLRYSRSAEDNKEKFSEYAHAANLAVGNFKTYGTGATGGSGDFKSYHNGVNFENLEFTSY  219



>ref|XP_003528153.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=629

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 124/192 (65%), Gaps = 8/192 (4%)
 Frame = +3

Query  114  EDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADG----  281
            + + EL NPF+PKA LIRYW  ++SN+   P FLL+KASPL    YA  +K+  +     
Sbjct  31   QTTHELINPFSPKASLIRYWNTRVSNNNQIPHFLLSKASPLTPQNYAVLNKLLTNQKPRP  90

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLE-KHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
             E+L   L   CSS NLLC  D +P+ + +   + NFA Y+ K F NYG+ R GGVDSFK
Sbjct  91   NENLHHSL---CSSPNLLCSFDDTPNAQTRKNDDANFALYNNKRFANYGSSRVGGVDSFK  147

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NY++  N   D+FRRYS  S    ++F+NYA NGNV + +F++YG+++    G+FSNY  
Sbjct  148  NYSNGLNANNDAFRRYSAASTRRGEQFNNYADNGNVANTNFSSYGSAANQTSGEFSNYDK  207

Query  639  EVNVPDMRFTSY  674
             VNVP++ FT+Y
Sbjct  208  TVNVPNLGFTTY  219



>ref|XP_004138283.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN63588.1| Polygalacturonase-1 non-catalytic subunit beta [Cucumis sativus]
Length=645

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 116/182 (64%), Gaps = 3/182 (2%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            SNPFTPKA L+RYWK  +S DL  P F L+KASPL+A   A  +  AA    SLS++L  
Sbjct  55   SNPFTPKASLVRYWKTHVSTDLPTPDFFLSKASPLSAVDAAALATHAAG--ASLSSRLES  112

Query  312  FCSSANLLC-FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPV  488
            FC SANL C F   S +    + + +F  Y  KNF NYG  R GG DSFKNY+D  N   
Sbjct  113  FCFSANLFCSFDSQSETSVPRSKDADFKLYGNKNFVNYGGSRLGGTDSFKNYSDGLNTAE  172

Query  489  DSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFT  668
             SF+RY  +S  H++ F++YA +GNV + +F +YG  S  G G+F+NY   VNVP++RFT
Sbjct  173  HSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAGSKSGSGEFTNYDKLVNVPNLRFT  232

Query  669  SY  674
            +Y
Sbjct  233  AY  234



>ref|XP_006345047.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Solanum tuberosum]
Length=642

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 116/181 (64%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA L+RYW KQISN L KP FL +KASPL+AA  A ++ +A    +SLS  +  F
Sbjct  48   NPFTVKASLVRYWNKQISNKLPKPDFLFSKASPLSAADAAFFTNLATQ--KSLSGHISTF  105

Query  315  CSSANLLCFPDLSPSLEKH-AGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            CSSA L CF + +P  +   + + +FA Y+ K F  YG+ R GG D FKNY+D  N    
Sbjct  106  CSSAKLFCFSESNPYFDNTPSKDADFAVYNNKKFATYGSGRLGGGDGFKNYSDGINFATG  165

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
             F +YSR S GH + F++YA +GNV   +F +Y   +TGG G F +Y P VNVPD+RF S
Sbjct  166  EFTKYSRSSTGHHEDFTSYAADGNVATGNFTSYAAGATGGGGTFQSYMPRVNVPDLRFAS  225

Query  672  Y  674
            Y
Sbjct  226  Y  226



>emb|CDP12374.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 119/179 (66%), Gaps = 2/179 (1%)
 Frame = +3

Query  138  PFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGFC  317
            P T +A LIRYW K ISN L KP FLL+KASPL+    A ++K+AA   ++LS+ L  FC
Sbjct  62   PLTARASLIRYWNKHISNYLPKPHFLLSKASPLSIVDSAYFTKLAAQ--KALSSHLSSFC  119

Query  318  SSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSF  497
            SSANL C  D   +L     + +FA Y+ K+F NYG+ R GG+D FKNY++  N    SF
Sbjct  120  SSANLFCLFDEKDALTNSKKDADFAFYTNKHFANYGSSRLGGIDMFKNYSNGVNFATGSF  179

Query  498  RRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             RYSR S    + F++YA +GNV + +F +YG+ + GG G+F NY P VNVPD+RFTSY
Sbjct  180  ARYSRSSNDLHEDFTSYADDGNVANANFTSYGSGARGGSGEFKNYLPRVNVPDLRFTSY  238



>ref|XP_007138090.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
 gb|ESW10084.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
Length=627

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 116/187 (62%), Gaps = 4/187 (2%)
 Frame = +3

Query  126  ELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQL  305
            E  NPF+PKA LIRYW  ++++ +  P FLL KASPL    Y   +K+  +  +  + +L
Sbjct  32   ERINPFSPKASLIRYWNTRVTSKVPIPHFLLAKASPLTPQHYGILNKLLNEKPKPYNPKL  91

Query  306  P-GFCSSANLLC-FPDL--SPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDN  473
                CSS NL C F D   +P+L++   + NFA Y+ K+F NYGT R  GVDSFKNY++ 
Sbjct  92   HHSLCSSPNLYCSFDDTPNTPTLQRKNDDANFAVYNNKHFANYGTSRVDGVDSFKNYSNG  151

Query  474  ENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVP  653
             N   D+FRRYS  S    ++F NYA NGNV + +F +YG+++      F+NY   VNVP
Sbjct  152  LNANNDAFRRYSDSSTRRGEQFKNYADNGNVANTNFTSYGSAAAQSSSDFNNYDKTVNVP  211

Query  654  DMRFTSY  674
            ++ FT+Y
Sbjct  212  NLGFTTY  218



>ref|XP_008374449.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=629

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 114/186 (61%), Gaps = 8/186 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFTPKA L RYW   ISN+L KP FL  KAS L+       +K+A+    SLS+    F
Sbjct  28   NPFTPKASLNRYWDIHISNNLPKPAFLFAKASQLDPVNSTILTKVASQ--NSLSSHFTSF  85

Query  315  CSSANLLCFPDLSPSLE------KHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNE  476
            CS ANL C  D S          +H    NFA Y+ KNF NYG+ + GGVDSFKNY++  
Sbjct  86   CSLANLCCSFDSSAETHQQDIATRHPKIANFAVYADKNFANYGSSQLGGVDSFKNYSEEL  145

Query  477  NIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPD  656
            N P DSF++YS+ S  H ++F++YA + NV + +F +YG  S GG G+F++Y   VNV  
Sbjct  146  NSPRDSFKKYSKGSHSHLEKFTSYAQDANVANANFTSYGADSGGGSGEFTSYDDRVNVHS  205

Query  657  MRFTSY  674
            + FTSY
Sbjct  206  LGFTSY  211



>gb|EPS68955.1| hypothetical protein M569_05812, partial [Genlisea aurea]
Length=592

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 116/181 (64%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF+P+A+LIRYW  +I +D     FLL+KASPL AA+ A +S M +   ++L ++LP F
Sbjct  2    NPFSPRAHLIRYWGNRIKSDRPMSEFLLSKASPLTAAETAMFSGMVSR--DTLFSRLPEF  59

Query  315  CSSANLLCFPD-LSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            C++A+L C  +  +   E+H  + NF+ Y  KNF NYG  R  GVD FKNY++  N    
Sbjct  60   CAAADLFCPAEGEAVGTERHDEDSNFSFYGNKNFANYGNGRLNGVDQFKNYSNGVNYAGG  119

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
             F RY R++ G+ + F++Y  + NV   +F +YG  +TGG G F NY P VNVP++RF S
Sbjct  120  GFSRYGREATGNREGFASYGDDSNVAGANFTSYGGGATGGGGDFRNYMPRVNVPNLRFGS  179

Query  672  Y  674
            Y
Sbjct  180  Y  180



>ref|XP_004300895.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 107/184 (58%), Gaps = 6/184 (3%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT +A LIRYW   +SN L  P FL +K+S LN    A  +K+AA    SL +    F
Sbjct  33   NPFTHRASLIRYWDTHVSNHLPIPTFLFSKSSTLNPVDSAILTKLAAQ--NSLPSHFTSF  90

Query  315  CSSANLLCFPDLSPS----LEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            CS ANL C  D S      L   +   NFA Y+ KNF  YGT + GG DSFKNY+ + N 
Sbjct  91   CSLANLYCSFDASSQSDQLLTSRSKGSNFAGYANKNFATYGTSQLGGADSFKNYSGDLNS  150

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
            P DSF +YS+ S  H + F++YA + NV + +F  Y   +  G G F++Y   VNVP++R
Sbjct  151  PHDSFTKYSKTSRSHSEHFTSYAHDANVANDTFTNYAAGAVAGSGDFNSYHDHVNVPNLR  210

Query  663  FTSY  674
            F SY
Sbjct  211  FASY  214



>ref|XP_004501939.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=627

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 114/192 (59%), Gaps = 7/192 (4%)
 Frame = +3

Query  114  EDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESL  293
            E S + +NPF+PKA LIRYW  +ISN L  P F L+K SPL   QYA    +     +  
Sbjct  28   EYSKQKTNPFSPKASLIRYWNTKISNKLPIPNFFLSKVSPLTPYQYANLVNLLKQ--KPF  85

Query  294  STQLP-GFCSSANLLCFPD----LSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFK  458
            S++     CS+  LLC  D    L  +      + NFA YS K F NYG+ + GGVDSFK
Sbjct  86   SSKFHYSLCSTPYLLCSFDHPNKLQQTKTTKRDDANFAVYSNKRFANYGSSQLGGVDSFK  145

Query  459  NYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGP  638
            NY++  N   DSF+RYS  S  H   F++YA NGNV + +F +YG+ ST G G+F NY  
Sbjct  146  NYSNGLNTNNDSFKRYSTTSTRHGGNFNSYAENGNVANTNFTSYGSGSTSGTGEFKNYDK  205

Query  639  EVNVPDMRFTSY  674
             VNVP++ FT+Y
Sbjct  206  LVNVPNLGFTTY  217



>ref|XP_007223063.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
 gb|EMJ24262.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
Length=554

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +3

Query  357  SLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDR  536
            SLEKH  +  F  Y+ KNFTNYGTDR  GVDSFKNY+ +EN+PVDSFRRYS DSV H+D+
Sbjct  33   SLEKHDKDSTFTGYAAKNFTNYGTDRLAGVDSFKNYSIDENLPVDSFRRYSHDSVNHKDQ  92

Query  537  FSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            F+NYA  GNVVDQSFN+Y   +T G G+F  Y   VNVP++RF SYS
Sbjct  93   FTNYASGGNVVDQSFNSYAGGATSGAGEFKKYADSVNVPNLRFNSYS  139


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/220 (29%), Positives = 88/220 (40%), Gaps = 38/220 (17%)
 Frame = +3

Query  111  GEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGES  290
            G + G + NPF+PKAYL+RYW K+      K       A+  N   Y        D  ++
Sbjct  9    GRNLGAVENPFSPKAYLVRYWNKESLEKHDKDSTFTGYAAK-NFTNYGTDRLAGVDSFKN  67

Query  291  LST---------------------QLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFK  407
             S                      Q   + S  N++       S   +AG     +  FK
Sbjct  68   YSIDENLPVDSFRRYSHDSVNHKDQFTNYASGGNVV-----DQSFNSYAGGATSGAGEFK  122

Query  408  N-----------FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAP  554
                        F +Y  D  G   SF +YT+N N    SF  YS++  G  + F+ Y  
Sbjct  123  KYADSVNVPNLRFNSYSDDSNGRAQSFTSYTENGNAGDQSFTSYSKNGNGAPNEFTGYGT  182

Query  555  NGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + NVV   F  YG +  G   KF+NYG ++N P  RF SY
Sbjct  183  SSNVVGSGFTGYGETGNGANDKFNNYGKDMNNPVNRFKSY  222


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG    G  D F NY  + N PV+ F+ Y        + F++Y    NV + SF +Y
Sbjct  191  FTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDGGNAAVETFTSYRDKANVGEDSFQSY  250

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S G K  F+NYG   NV   +FT Y
Sbjct  251  AKNSNGEKINFANYGKSFNVGFDKFTGY  278



>dbj|BAK05386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 103/189 (54%), Gaps = 5/189 (3%)
 Frame = +3

Query  111  GEDSGELS-NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            G  SG  S NPFT KA  IRYW +++ N+   P F ++K SPL AA  A +     D   
Sbjct  22   GNASGAASVNPFTAKAAFIRYWNRKVPNNRPHPAFFVSKLSPLPAADAASFPSSLPD---  78

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYT  467
             +  +LP  CS A LLC        +  A    F  Y   NFTNYG+    G D FKNY+
Sbjct  79   -IRARLPTLCSKAALLCPSSSGSESDVAARKGPFTGYRDANFTNYGSGAGAGTDGFKNYS  137

Query  468  DNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN  647
             + NI  DSFRRY RDS    D FS Y  NGNVV  +F +Y   +TGG G F++Y    N
Sbjct  138  PDVNIAGDSFRRYGRDSSARADLFSTYEANGNVVTANFTSYAGGATGGSGSFTSYAANTN  197

Query  648  VPDMRFTSY  674
            VP+ RFT+Y
Sbjct  198  VPESRFTNY  206



>gb|ABR16440.1| unknown [Picea sitchensis]
Length=666

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 110/191 (58%), Gaps = 10/191 (5%)
 Frame = +3

Query  108  GGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGE  287
            GG D     +PF  KA L+R+W++ + N    P FLL KASPLNA   A ++   A+   
Sbjct  61   GGSD-----HPFAAKASLLRFWRRVLPNARL-PAFLLEKASPLNATSVAVFAGYIAN--H  112

Query  288  SLSTQLPGFCSSANLLCFPDLSPSLEKHA--GNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
            +L   +  FC++A+LLC   ++ + ++ A  G+ +F SY  K+F +Y    + G DSFKN
Sbjct  113  TLPDHIASFCTAADLLCTRRIAVTGDEKAVVGDADFQSYHGKDFKHYKVGASSGTDSFKN  172

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+D +N   D F+RY RD  G    F+NYAP  N+ D+ F TY + ++     F+NYG  
Sbjct  173  YSDGDNEAKDDFKRYGRDGNGRSQVFANYAPQTNIEDEGFATYSSGASAANSDFTNYGSN  232

Query  642  VNVPDMRFTSY  674
             NVPD  F +Y
Sbjct  233  SNVPDHHFKNY  243


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F NYGTD   G+ +FK+Y DN N+  + F  Y +D+ G    FS+YA N NV+  +F  
Sbjct  239  HFKNYGTDSNAGIQNFKSYADNSNVVKNDFASYGKDANGILSGFSSYAENSNVITNNFKG  298

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y     G   +F++Y    NVP   F SY
Sbjct  299  YSEGGNGPLDQFTSYADNGNVPRNEFESY  327


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = +3

Query  363  EKHAGNVNFASYS-----FKN-FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVG  524
            + +AG  NF SY+      KN F +YG D  G +  F +Y +N N+  ++F+ YS    G
Sbjct  246  DSNAGIQNFKSYADNSNVVKNDFASYGKDANGILSGFSSYAENSNVITNNFKGYSEGGNG  305

Query  525  HEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
              D+F++YA NGNV    F +YG++  G    F++Y    NVP   F SY
Sbjct  306  PLDQFTSYADNGNVPRNEFESYGSNGNGALQSFTSYADGANVPQDVFKSY  355


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 52/116 (45%), Gaps = 17/116 (15%)
 Frame = +3

Query  369  HAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNY  548
            +A N N  + +FK ++  G    G +D F +Y DN N+P + F  Y  +  G    F++Y
Sbjct  285  YAENSNVITNNFKGYSEGGN---GPLDQFTSYADNGNVPRNEFESYGSNGNGALQSFTSY  341

Query  549  APNGNVVDQSFNTYgtsstggkgkFSN--------------YGPEVNVPDMRFTSY  674
            A   NV    F +YG  +      F+N              YG   N PDM FTSY
Sbjct  342  ADGANVPQDVFKSYGKDANTPLVTFTNYGNSSNSQQDEFKQYGKGSNSPDMTFTSY  397



>ref|XP_002444270.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
 gb|EES13765.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
Length=658

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 104/185 (56%), Gaps = 9/185 (5%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++ N+   P F + K SPL AA  A +     D    +  +LP  
Sbjct  44   NPFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPTALPD----IRARLPEL  99

Query  315  CSSANLLC-FPDLSPSLEKHA----GNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNEN  479
            C+ A LLC  P  + +    A    G   F  YS  NF+NYGT    G DSF+NY+ + N
Sbjct  100  CTKAALLCPGPATTDAASLAASGPRGGGPFKGYSNANFSNYGTGGVAGADSFRNYSPDLN  159

Query  480  IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDM  659
            I  DSFRRY RDS G  D F++Y  +GNVV  +F +Y   +TGG G F+ Y  E NVPD 
Sbjct  160  IAADSFRRYGRDSSGRADSFASYESDGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDS  219

Query  660  RFTSY  674
             FT+Y
Sbjct  220  TFTNY  224


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 50/104 (48%), Gaps = 6/104 (6%)
 Frame = +3

Query  384  NFASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSN  545
            +FASYS +       F+ YG    G  ++F +Y +  N+    F  Y + + G  D F+ 
Sbjct  234  SFASYSQEANHGENGFSGYGKSGNGVRETFSSYGNESNVLGSGFANYGQSANGATDTFTG  293

Query  546  YAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y   GNV + +F  YG     G   F  Y  + NV D RFTSY+
Sbjct  294  YGVEGNVPENTFRNYGAGGNAGVDTFKKYRDDANVGDDRFTSYA  337



>dbj|BAJ92348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 104/181 (57%), Gaps = 8/181 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGY-SKMAADGGESLSTQLPG  311
            NPFT KA  IRYW +++ N+   P F ++K SPL AA  A + S + A     ++ +LP 
Sbjct  36   NPFTAKAAFIRYWNRKVPNNRPHPAFFVSKLSPLPAADAASFPSSLPA-----ITARLPT  90

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
             CS A LLC      SL    G   F SYS  NFTNYG+    G D F +Y+ + N+  D
Sbjct  91   LCSKAALLCPSSDVSSLADRKGQ--FKSYSNANFTNYGSGAGAGTDGFSSYSPDVNVAGD  148

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRY RDS    D F+ Y  NGNVV  +F +Y   +TGG G FS Y  + NVP+ +FT+
Sbjct  149  SFRRYGRDSSARADSFATYEANGNVVTANFTSYAGGATGGSGSFSAYAADTNVPESQFTN  208

Query  672  Y  674
            Y
Sbjct  209  Y  209



>ref|NP_001146063.1| uncharacterized protein LOC100279594 precursor [Zea mays]
 gb|ACL53138.1| unknown [Zea mays]
 gb|ACN33667.1| unknown [Zea mays]
 gb|AFW62083.1| polygalacturonase-1 non-catalytic beta subunit [Zea mays]
Length=643

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 100/184 (54%), Gaps = 8/184 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++ N+   P F + K SPL AA  A +     D    +   LP  
Sbjct  37   NPFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPD----IRASLPAL  92

Query  315  CSSANLLC----FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            C+ A LLC      D +       G   F  Y+  NF+NYGT    G DSF+ Y+ + NI
Sbjct  93   CTKAALLCPGPATTDAASLTSGRRGGGPFKGYNNANFSNYGTGGVAGTDSFQKYSPDLNI  152

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
              DSFRRY RDS G  D F++Y  +GNVV  +F +Y   +TGG G F+ Y  E NVPD  
Sbjct  153  AADSFRRYGRDSSGRADSFTSYEADGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDST  212

Query  663  FTSY  674
            FT+Y
Sbjct  213  FTNY  216


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 6/104 (6%)
 Frame = +3

Query  384  NFASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSN  545
            +FASYS +       F+ YG +  G  ++FK+Y +  N+    F  Y + + G  D F+ 
Sbjct  226  SFASYSQEANHGENGFSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTG  285

Query  546  YAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y   GNV +  F +YG     G   F NY  + NV D RFTSY+
Sbjct  286  YGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSYA  329


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG    G  D+F  Y    N+P + FR Y        D F NY  +GNV D  F +Y
Sbjct  269  FANYGQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + GG  +F +YG   N     F  Y
Sbjct  329  AKGANGGAAEFQSYGNSANPGSTIFKGY  356



>gb|ACN34141.1| unknown [Zea mays]
Length=643

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 99/184 (54%), Gaps = 8/184 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++ N+   P F + K SPL AA  A +     D    +   LP  
Sbjct  37   NPFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPD----IRASLPAL  92

Query  315  CSSANLLC----FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            C+ A LLC      D +       G   F  Y+  NF+NYGT    G DSF+ Y+ + NI
Sbjct  93   CTKAALLCPGPATTDAASLTSGRRGGGPFKGYNNANFSNYGTGGVAGTDSFQKYSPDLNI  152

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
              DSFRRY RDS G  D F++Y  +GNVV  +F  Y   +TGG G F+ Y  E NVPD  
Sbjct  153  AADSFRRYGRDSSGRADSFTSYEADGNVVTANFTPYAGGATGGSGSFAAYAAETNVPDST  212

Query  663  FTSY  674
            FT+Y
Sbjct  213  FTNY  216


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 6/104 (6%)
 Frame = +3

Query  384  NFASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSN  545
            +FASYS +       F+ YG +  G  ++FK+Y +  N+    F  Y + + G  D F+ 
Sbjct  226  SFASYSQEANHGENGFSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTG  285

Query  546  YAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y   GNV +  F +YG     G   F NY  + NV D RFTSY+
Sbjct  286  YGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSYA  329



>gb|ACG28762.1| polygalacturonase-1 non-catalytic beta subunit precursor [Zea 
mays]
Length=642

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 102/185 (55%), Gaps = 9/185 (5%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++ N+   P F + K SPL AA  A +     D    +   LP  
Sbjct  37   NPFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPD----IRASLPAL  92

Query  315  CSSANLLC-FPDLSPSLEKHA----GNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNEN  479
            CS A LLC  P  + +    A    G   F  Y+  NF+NYGT    G DSF+ Y+ + N
Sbjct  93   CSKAALLCPGPATTDAASLVASGRRGGGPFKGYNNANFSNYGTGGVAGTDSFQKYSPDLN  152

Query  480  IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDM  659
            I  DSFRRY RDS G  D F++Y  +GNVV  +F +Y   +TGG G F+ Y  E NVPD 
Sbjct  153  IAADSFRRYGRDSSGRADSFTSYEDDGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDS  212

Query  660  RFTSY  674
             FT+Y
Sbjct  213  TFTNY  217


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 6/104 (6%)
 Frame = +3

Query  384  NFASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSN  545
            +FASYS +       F+ YG +  G  ++FK+Y +  N+    F  Y + + G  D F+ 
Sbjct  227  SFASYSQEANHGEYGFSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTG  286

Query  546  YAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            Y   GNV +  F +YG     G   F NY  + NV D RFTSY+
Sbjct  287  YGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSYA  330


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG    G  D+F  Y    N+P + FR Y        D F NY  +GNV D  F +Y
Sbjct  270  FANYGQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSY  329

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + GG  +F +YG   N     F  Y
Sbjct  330  AKGANGGAAEFQSYGNSANPGSTIFKGY  357



>ref|XP_010028282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
 gb|KCW83445.1| hypothetical protein EUGRSUZ_B00367 [Eucalyptus grandis]
Length=643

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 111/184 (60%), Gaps = 8/184 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPF PKA  +RYWK Q+S   A P FLL+KASPL+AA  A         G +L++ L  F
Sbjct  44   NPFAPKAAFLRYWKAQLSGGGAPPPFLLSKASPLSAAAAA--QLAKLAAGSTLASHLRLF  101

Query  315  CSSANLLCFPDLSPSLEKHAGNV----NFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            CS A+L C       L +H  +V    NFA Y+ K F  YGT R GG DSFKNY++  N 
Sbjct  102  CSLADLFC--SFDEGLRRHRKDVDEDVNFAVYANKRFAGYGTGRLGGADSFKNYSEGLNT  159

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
            P  SF++Y+++  GH + F+NYA +GNV + SF  Y   + GG G F NY   VNVP++ 
Sbjct  160  PDFSFKKYTKEGSGHSEGFANYATDGNVANSSFANYAFGANGGSGDFKNYHLRVNVPNLL  219

Query  663  FTSY  674
            FT+Y
Sbjct  220  FTTY  223



>ref|XP_003601289.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES71540.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=628

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 109/189 (58%), Gaps = 5/189 (3%)
 Frame = +3

Query  120  SGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLST  299
            S + +NPFTPKA LIR+W  + SN L  P F L+KASPL    YA    +      S S 
Sbjct  31   SKQKTNPFTPKASLIRHWNTKTSNKLPIPNFFLSKASPLTPQHYANLINLFKQKPSS-SN  89

Query  300  QLPGFCSSANLLCFPD----LSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYT  467
                 CS+  L C  D    L  S + +  + NFA YS K F+NYG+ R GGVDSFKNY+
Sbjct  90   LHNTLCSTPYLFCSFDHPNTLYQSTKTNKSDSNFAVYSNKKFSNYGSARLGGVDSFKNYS  149

Query  468  DNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVN  647
            +  N   DSF++YS  S      F++YA NGNV + +F  YG+ S+ G G F +Y   VN
Sbjct  150  NGLNTNSDSFKKYSSGSTRRGGEFNSYAENGNVANTNFTNYGSGSSSGTGNFKSYDKLVN  209

Query  648  VPDMRFTSY  674
            VP++ FT+Y
Sbjct  210  VPNLGFTTY  218


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 54/109 (50%), Gaps = 7/109 (6%)
 Frame = +3

Query  369  HAGNVNFASYSFKN------FTNYGTDRAGGV-DSFKNYTDNENIPVDSFRRYSRDSVGH  527
             +GN +F +Y+  +      FT YG    GG  DSFK Y+ N N P  SF+ Y   SV  
Sbjct  251  RSGNSDFINYAVSSNILQSTFTGYGELGTGGANDSFKAYSFNGNNPKSSFKAYGTGSVSG  310

Query  528  EDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             D F +Y    NV D SF +YG  S  G   F+NYG   N  +  FT Y
Sbjct  311  SDTFVSYRNRANVGDDSFQSYGAKSKAGAASFTNYGQSFNEGNDTFTEY  359



>ref|XP_003574428.1| PREDICTED: BURP domain-containing protein 12 [Brachypodium distachyon]
Length=623

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 103/180 (57%), Gaps = 4/180 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++ N+   P F L+K SPL AA  A +    A    ++  +LP  
Sbjct  26   NPFTAKAAFIRYWNRKVPNNRPHPAFFLSKLSPLPAADAASFPSSPA----AIRARLPTL  81

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS A LLC    + S+        F SY+  NFTNYG+    G D F +Y+ + NI  DS
Sbjct  82   CSRAALLCPSSDTASMGSRRAPGPFKSYNGANFTNYGSGGGAGADGFTSYSPDVNIAADS  141

Query  495  FRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            FRRYSR S G  D F++Y  NGNVV  +F +Y   +TGG G F+ Y    NVPD +FT+Y
Sbjct  142  FRRYSRGSTGRADTFASYEANGNVVTANFTSYAGGATGGSGSFAAYAEGTNVPDSKFTNY  201



>emb|CDP00166.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 107/198 (54%), Gaps = 49/198 (25%)
 Frame = +3

Query  96   IGIMGGEDSGELS----NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYS  263
            +G+ G E  G L     NPFT KA LIR W+ Q++NDL  PWF LNK SPLNA Q A +S
Sbjct  3    VGLSGSETDGGLKLTRENPFTAKASLIRRWRTQVTNDLPMPWFFLNKVSPLNAVQMATFS  62

Query  264  KMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGG  443
            K+  D   S ST LP               P   +   N    S+ F             
Sbjct  63   KLLTD-QNSFSTPLP---------------PRKTRQRFNY---SHDF-------------  90

Query  444  VDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkF  623
                        +P+DSFRRYSR S+GH+D+FS Y  +GN+VDQ+F+TYG + TGG G F
Sbjct  91   ------------LPLDSFRRYSRSSLGHDDKFSTYI-DGNLVDQTFDTYGNTVTGGAGTF  137

Query  624  SNYGPEVNVPDMRFTSYS  677
            +NY   VNVP++ FTSYS
Sbjct  138  TNYQNLVNVPNLNFTSYS  155



>ref|XP_002525381.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
 gb|EEF37019.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
Length=531

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 116/187 (62%), Gaps = 13/187 (7%)
 Frame = +3

Query  117  DSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLS  296
            +S    NPFTPKA L+ +W  QI+ +     FLL++ASPL+A +    S + +     L 
Sbjct  47   ESSPKENPFTPKASLMPHWSNQINTNSPISPFLLSRASPLSALK--TLSPLTSPPSPLL-  103

Query  297  TQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNE  476
              L  F S         +SPS+ KH  N NFA+Y  +NFTNYGT + GGV SF NY+  +
Sbjct  104  --LSAFASR--------ISPSVVKHEKNSNFAAYLNQNFTNYGTGQVGGVGSFNNYSPGD  153

Query  477  NIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPD  656
            N   D+FRRYSR++   +++FS+YAP+ N+   +FNTYGT +TGG+G+F  Y   VN  +
Sbjct  154  NFARDNFRRYSRNAQDRKEKFSSYAPDANLAMTTFNTYGTGATGGEGEFKKYNERVNFQN  213

Query  657  MRFTSYS  677
            +RFTSY+
Sbjct  214  IRFTSYA  220



>ref|XP_006844960.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
 gb|ERN06635.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
Length=583

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 112/182 (62%), Gaps = 4/182 (2%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NP +P+A + RYW+  + N    P FLL+K+SPL+    A +S        SLS+ L  F
Sbjct  37   NPLSPRASVKRYWQSLLPNS-PIPHFLLDKSSPLDHLHTAIFSNFIDK--NSLSSHLSSF  93

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD-SFKNYTDNENIPVD  491
            C +A+L CFP  S +      N +F  Y+ +NF++YGT   GG   SFKNY+D+EN+   
Sbjct  94   CQTAHLFCFPRQSLASHGRTDNFDFKKYTERNFSDYGTGAVGGTGGSFKNYSDSENVVAQ  153

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            +F RYSRD+ GH D F++Y+P+ NV D SF+ YG+ S G   +F NY  + NVP++RF  
Sbjct  154  TFVRYSRDATGHGDSFAHYSPDTNVFDGSFSGYGSGSVGKSSEFVNYAGDANVPELRFNV  213

Query  672  YS  677
            YS
Sbjct  214  YS  215



>ref|XP_003610588.1| BURP domain-containing protein [Medicago truncatula]
 gb|AES92785.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=394

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 83/134 (62%), Gaps = 17/134 (13%)
 Frame = +3

Query  282  GESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
            G  LST+LP FCS+ANLLC P+++ SLEKH G+ NF +YS KNFTNYGT   GG DSFKN
Sbjct  40   GNMLSTRLPEFCSAANLLCLPEVAQSLEKHEGDENFKAYSDKNFTNYGTSLPGGHDSFKN  99

Query  462  YTDNE--NIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYG  635
            Y+D +  +  V+ F RYSR+S GH++ F+NY P     D+               F    
Sbjct  100  YSDGDYSDGEVNDFCRYSRNSAGHKETFTNYTPQTPTSDE---------------FKQCT  144

Query  636  PEVNVPDMRFTSYS  677
             E NVP+  FTSYS
Sbjct  145  TEANVPNEVFTSYS  158


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 51/108 (47%), Gaps = 6/108 (6%)
 Frame = +3

Query  369  HAGNVNFASYS------FKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHE  530
            + G+ +F SY        + FTNYGT        F NY +  N   DSF+ YS D     
Sbjct  176  NGGDQSFTSYGKNGNGHTEEFTNYGTSSNTVGSDFSNYAETSNSGNDSFKGYSVDMNNPT  235

Query  531  DRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + FSNYA  GN   Q+F+TY   +  G   F++Y    N   + F +Y
Sbjct  236  NTFSNYANGGNGAIQTFSTYREDANVGADSFTSYAKTANAAKIGFDNY  283


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT+Y  +  G   SF +YT+N N    SF  Y ++  GH + F+NY  + N V   F+ Y
Sbjct  154  FTSYSDNANGRTQSFNSYTENGNGGDQSFTSYGKNGNGHTEEFTNYGTSSNTVGSDFSNY  213

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSYS  677
              +S  G   F  Y  ++N P   F++Y+
Sbjct  214  AETSNSGNDSFKGYSVDMNNPTNTFSNYA  242



>ref|XP_004973305.1| PREDICTED: BURP domain-containing protein 12-like [Setaria italica]
Length=647

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 103/191 (54%), Gaps = 15/191 (8%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++ N+   P F + K SPL AA  A +     D    +  +LP  
Sbjct  36   NPFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPD----IRARLPAL  91

Query  315  CSSANLLC-----------FPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKN  461
            CS A LLC                 +     G   F  YS  NF+NYG+   GG DSF++
Sbjct  92   CSRAGLLCAGPASSAGADADAASLAAAAGTRGGGPFKGYSNANFSNYGSGGDGGADSFRS  151

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + NI  DSFRRY+RDS    DRF +Y  +GNVV  +F +Y   STGG G F++Y  E
Sbjct  152  YSPDLNIAADSFRRYARDSSDRADRFESYEADGNVVTANFTSYAGGSTGGSGTFASYAAE  211

Query  642  VNVPDMRFTSY  674
             NVPD  FT+Y
Sbjct  212  TNVPDSTFTNY  222


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 6/103 (6%)
 Frame = +3

Query  387  FASYSFK------NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNY  548
            FASY+ +       F+ YG +  G  ++F +Y +  N+   +F  Y     G  D FS+Y
Sbjct  233  FASYAQEANHGENGFSGYGKNGNGVRETFTSYGNESNVMASAFANYGESGNGATDTFSSY  292

Query  549  APNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
               GNV + +F +YG     G   F  Y  + NV D RF+SY+
Sbjct  293  GVEGNVPENTFRSYGAGGNAGVDTFKKYRDDANVGDDRFSSYA  335



>emb|CBI28512.3| unnamed protein product [Vitis vinifera]
Length=125

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  108  GGEDSGEL---SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAAD  278
             GE+SG+     NPFTP+A L+RYW KQI + L K  FLL+KASPL+A + A ++K+AA 
Sbjct  29   AGEESGKPVAGENPFTPRASLLRYWNKQIGSGLPKSTFLLSKASPLSAVESATFTKLAAQ  88

Query  279  GGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFA  392
               +LS  LP FC SANLLCFPDL  SLEKH  + NFA
Sbjct  89   --NALSDNLPAFCKSANLLCFPDLGQSLEKHDASSNFA  124



>ref|XP_003576424.1| PREDICTED: BURP domain-containing protein 14-like [Brachypodium 
distachyon]
Length=775

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 109/199 (55%), Gaps = 22/199 (11%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQI-SNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            NPFT KA  IRYW +++ S+ L  P F   K SPL+A   A +S +AA G   L+++LP 
Sbjct  155  NPFTAKAAFIRYWNRKVHSSRLLHPAFFFAKLSPLSAPDAATFSSLAAAG--QLASRLPA  212

Query  312  FCSSANLLCFPDLSPSL------------------EKHAGNVNFASYSFKNFTNYGTDRA  437
            FC++A++LC P  S ++                     +G   F +Y   NF++YG +  
Sbjct  213  FCAAASILC-PATSDAVWSGSSVAAGDASGNTSPASSGSGTAPFKNYDNGNFSSYGNNGG  271

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG D+F  Y+  +  PVDSFRRY + S+G  D F+ Y   GNV   SFN+Y T +TGG G
Sbjct  272  GGADAFAVYSRGQINPVDSFRRYGKGSLGRNDSFATYEALGNVGTASFNSYTTGATGGAG  331

Query  618  kFSNYGPEVNVPDMRFTSY  674
             F+ Y  E N   + F +Y
Sbjct  332  DFAAYDGETNTAAVTFANY  350


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 42/88 (48%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG       D+F +Y  N N P ++FR Y+  S    D F  Y  N NV D SF +Y
Sbjct  403  FINYGEKANSANDTFASYGLNGNAPENTFRSYASGSNAGADDFKGYRDNANVGDDSFMSY  462

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
             T + G    F +YG  VN   + F  Y
Sbjct  463  ATDANGATADFESYGKSVNPGSVAFKGY  490



>ref|NP_001061692.1| Os08g0380100 [Oryza sativa Japonica Group]
 sp|Q6ZA27.1|BURPC_ORYSJ RecName: Full=BURP domain-containing protein 12; Short=OsBURP12; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05416.1| putative polygalacturonase isoenzyme 1 beta subunit homolog [Oryza 
sativa Japonica Group]
 dbj|BAF23606.1| Os08g0380100 [Oryza sativa Japonica Group]
 dbj|BAG95253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96203.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 102/191 (53%), Gaps = 15/191 (8%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            G   NPFT KA  IRYW +++ N+   P F + K SPL AA  A ++        +L   
Sbjct  25   GARVNPFTAKAAFIRYWNRRVPNNRPHPAFFVAKLSPLQAADAASFAA-------ALPRL  77

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVN-------FASYSFKNFTNYGTDRAGGVDSFKN  461
            LP  C+ A LLC P  S +    +  V        F  YS  NFTNYG+   GG D F  
Sbjct  78   LPPLCARAALLC-PSASDTETAASLAVGGGGGGGPFKGYSNANFTNYGSGGVGGADGFSA  136

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRY RDS    D F++Y   GNVV  +F +Y  ++TGG G FS Y  +
Sbjct  137  YSPDLNVVGDSFRRYGRDSTRRVDTFASYEAEGNVVTANFTSYAGAATGGSGSFSAYAAD  196

Query  642  VNVPDMRFTSY  674
             NVPD  FT+Y
Sbjct  197  TNVPDSTFTNY  207


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    G  D+F  Y    N+P ++FR Y        D F  Y    NV D SF +Y
Sbjct  260  FTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASY  319

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + G   +F NYG   N   + F  Y
Sbjct  320  AKGANGNAAEFQNYGGSFNPGTVTFKGY  347



>dbj|BAJ97940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 102/195 (52%), Gaps = 18/195 (9%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++      P F   K SPL+A     +S +AA G   L ++LP F
Sbjct  140  NPFTAKAAFIRYWNRKVHGSRLHPAFFFAKLSPLSAPDAVAFSNLAAAG--QLGSRLPAF  197

Query  315  CSSANLLCFPDLSPSLEKHAG---------------NVNFASYSFKNFTNYGTDRAGGVD  449
            C++A+++C P  S  +   +G                  F +Y+  NF++YG    GG D
Sbjct  198  CTAASIIC-PSTSGIIWSGSGPSKAGDASGSPASNSTAPFKNYANGNFSSYGNSGGGGAD  256

Query  450  SFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSN  629
            +F  Y+  +  PVDSF RY + S+G  D F+ Y   GNV   SFN+Y   +TGG G+F+ 
Sbjct  257  AFAVYSRGQINPVDSFHRYGKGSLGRNDSFATYEALGNVGTASFNSYTAGATGGTGEFAE  316

Query  630  YGPEVNVPDMRFTSY  674
            Y  E N   + F +Y
Sbjct  317  YDGETNTVAVTFANY  331


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 42/88 (48%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG       D+F +Y  N N P +SFR YS  S G  D F  Y  N NV D SF +Y
Sbjct  384  FINYGDKANSATDTFDSYGLNGNTPENSFRSYSSGSNGGADDFKGYRDNANVGDDSFTSY  443

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + G    F +YG  VN   + F  Y
Sbjct  444  ANDANGATADFQSYGKSVNPGSVAFKGY  471



>ref|XP_002460065.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
 gb|EER96586.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
Length=691

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 109/204 (53%), Gaps = 26/204 (13%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++  +   P FL  K SPL+A   A +S +A+ G   L++++  F
Sbjct  71   NPFTAKAAFIRYWNRKVRGNRPHPAFLFAKLSPLSAPDAATFSTLASAG--KLASRIRDF  128

Query  315  CSSANLLC--FPDLSPSLEKHAGNVN----------------------FASYSFKNFTNY  422
            C++A+LLC   P  S S    + +V+                      F +Y   NF++Y
Sbjct  129  CAAASLLCPSTPAASWSAASSSSSVDGGAAGGVAASSSGGGGAASSAPFKNYENGNFSSY  188

Query  423  GTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtss  602
            G    GG D F  Y+  ++ PVDSF+RY + S+G  D F+NY   GNV   SFN+Y T +
Sbjct  189  GNSGGGGSDQFAVYSSGKSGPVDSFKRYGKGSLGRNDSFTNYEEGGNVGTSSFNSYTTGA  248

Query  603  tggkgkFSNYGPEVNVPDMRFTSY  674
            TGG G+F+ Y  + N   + F +Y
Sbjct  249  TGGAGEFAGYAGQTNTVAVTFATY  272



>ref|XP_004956601.1| PREDICTED: BURP domain-containing protein 14-like [Setaria italica]
Length=683

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 106/198 (54%), Gaps = 20/198 (10%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++ ++   P F   K SPL+A   A +S +A+ G   L++++  F
Sbjct  68   NPFTAKAAFIRYWNRKVRSNRPHPAFFFAKLSPLSAPDAAAFSTLASAG--KLASRIRDF  125

Query  315  CSSANLLCFPDLSPSLEKHAGNVN------------------FASYSFKNFTNYGTDRAG  440
            C++A+LLC    + S    + +V                   F +Y   NF++YG    G
Sbjct  126  CAAASLLCPSTPAASWSASSSSVEDGAAGTASSGGGAGSAAPFKNYENGNFSSYGNSGGG  185

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G D F  Y+  ++ PVDSF+RY + S+G  D F+NY   GNV   SF++Y T +TGG G+
Sbjct  186  GADQFAAYSSGKSGPVDSFKRYGKGSLGRNDSFTNYEAGGNVGTSSFSSYTTGATGGAGE  245

Query  621  FSNYGPEVNVPDMRFTSY  674
            F+ Y  + N     F +Y
Sbjct  246  FAGYAGQTNTVAATFATY  263


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (47%), Gaps = 0/96 (0%)
 Frame = +3

Query  390  ASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVV  569
            A+   + FT+YG       +SFK Y +N N     F  Y   + G  D F++Y  +GN  
Sbjct  281  ANSGVEGFTSYGKAANAAAESFKTYGNNSNTVASGFINYGEKANGLNDTFASYGLDGNAP  340

Query  570  DQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSYS  677
            + +F +Y + S      F  Y    N+ D  FTSY+
Sbjct  341  ENTFRSYASGSNAAVDDFKGYRDAANIGDDSFTSYA  376



>ref|XP_008652571.1| PREDICTED: BURP domain-containing protein 14-like [Zea mays]
 tpg|DAA61067.1| TPA: hypothetical protein ZEAMMB73_635092 [Zea mays]
Length=679

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 107/199 (54%), Gaps = 21/199 (11%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            NPFT KA  IRYW +++S++   P FL  K SPL+A   A +S +A+ G   L++++  F
Sbjct  66   NPFTAKAAFIRYWNRKVSSNRPHPAFLFAKLSPLSAPDAATFSNLASAG--KLASRIHDF  123

Query  315  CSSANLLCFPDLSPSLEKHAGNVN-------------------FASYSFKNFTNYGTDRA  437
            C +A+LLC    + S    + +++                   F  Y   NF++YG    
Sbjct  124  CDAASLLCPSTPAASWSASSTSMDGAAGVASSGGGSGAASAAPFKDYENGNFSSYGNSGG  183

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG D F  Y+  ++ PVDSF+RY + S+G  D F+NY    NV   +FN+Y T +TGG G
Sbjct  184  GGSDQFAIYSSGKSGPVDSFKRYGKGSLGRNDSFANYEEGANVGTSTFNSYTTGATGGAG  243

Query  618  kFSNYGPEVNVPDMRFTSY  674
            +F+ Y  + N   + F +Y
Sbjct  244  EFAGYAGQTNTVAVAFATY  262


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 46/95 (48%), Gaps = 0/95 (0%)
 Frame = +3

Query  390  ASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVV  569
            A+   ++FT YG    G  +SF+ Y +N N     F  Y   S G  D F++Y   GN  
Sbjct  280  ANSGVQSFTGYGKTANGAGESFETYGNNSNTVASGFINYGEKSNGFNDTFTSYGLVGNAP  339

Query  570  DQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            + +F +Y + S  G  +F  Y  E NV D  F SY
Sbjct  340  ENTFRSYASGSNAGVDQFKAYRDEANVGDDSFMSY  374



>ref|XP_010100466.1| hypothetical protein L484_027778 [Morus notabilis]
 gb|EXB82600.1| hypothetical protein L484_027778 [Morus notabilis]
Length=184

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 72/128 (56%), Gaps = 2/128 (2%)
 Frame = +3

Query  291  LSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTD  470
            LST+L GFCSSANLLC  +L  SLEKH  + +F+SY+ KNFTNYG+DR GG DS      
Sbjct  4    LSTRLLGFCSSANLLCSSELGQSLEKHDKDSSFSSYASKNFTNYGSDRLGGADSAGTGAK  63

Query  471  NENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNV  650
              ++P  S    +  + G E+ F +Y  N    + SF +Y   S      F+NYG     
Sbjct  64   TRSVPHSSTTE-TAPTAGVEE-FKSYRENPAQGEDSFQSYAKDSKNEVVTFANYGESFRF  121

Query  651  PDMRFTSY  674
             +  FTSY
Sbjct  122  GEDNFTSY  129



>ref|XP_006661124.1| PREDICTED: LOW QUALITY PROTEIN: BURP domain-containing protein 
14-like [Oryza brachyantha]
Length=505

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 90/181 (50%), Gaps = 35/181 (19%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            ++PFT KA  +RYW +++ ++   P FL  K SPL+A   A +S +AA G   L +++  
Sbjct  71   ASPFTAKAAFVRYWNRKVHSNRPHPAFLFAKLSPLSAPDAAAFSALAAAG--QLGSRIRA  128

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVD  491
            FC++A+LLC                                 GG D F  Y+  E  PVD
Sbjct  129  FCAAASLLC---------------------------------GGADQFAVYSGGETSPVD  155

Query  492  SFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTS  671
            SFRRY + S G  D F++Y   GNV   +F +Y + +TGG G FS Y  E N   + F +
Sbjct  156  SFRRYGKGSQGRNDSFTSYEAGGNVGTANFTSYNSGATGGAGGFSTYAGETNTASVSFAN  215

Query  672  Y  674
            Y
Sbjct  216  Y  216


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG    G  D+F +Y  N N P ++F+ Y  DS    D F  Y  + NV + SF +Y
Sbjct  269  FLNYGDRANGAADTFSSYGVNGNTPENTFKSYGTDSNAGVDDFKGYRDDANVGNDSFTSY  328

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
             +++ G    F +YG  VN   + F  Y
Sbjct  329  ASNANGAAAGFESYGKSVNPGSVTFKGY  356



>emb|CAN81758.1| hypothetical protein VITISV_043391 [Vitis vinifera]
Length=574

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +3

Query  333  LCFPDLSPSLEKHAGNVNFASYSF-KNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYS  509
            +CF +   S     GN   A  S  + F NYG  R GGVDSFKNY+D  N+P  SFRRYS
Sbjct  28   VCFAEGKSST---GGNPFTAKASLIRGFANYGDSRIGGVDSFKNYSDGLNMPSGSFRRYS  84

Query  510  RDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             DS  H + F++YA +GNV   SF  YG+ +TGG G+F+NY P VNVP + FT+Y
Sbjct  85   GDSTDHHEEFTSYARDGNVATGSFAGYGSGATGGSGEFTNYDPLVNVPHLEFTTY  139



>gb|EEC83505.1| hypothetical protein OsI_29064 [Oryza sativa Indica Group]
Length=623

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 92/184 (50%), Gaps = 33/184 (18%)
 Frame = +3

Query  123  GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQ  302
            G   NPFT KA  IRYW +++ N+   P F + K SPL AA  A ++        +L   
Sbjct  26   GARVNPFTAKAAFIRYWNRRVPNNRPHPAFFVAKLSPLQAADAASFAA-------ALPRL  78

Query  303  LPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENI  482
            LP  C+ A LLC     P   +H                    R G + +   Y+ + N+
Sbjct  79   LPPLCARAALLC-----PCRLRH--------------------RDGRLPA-PAYSPDLNV  112

Query  483  PVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMR  662
              DSFRRY+RDS    D F++Y P GNVV  +F +Y  ++TGG G FS Y  + NVPD  
Sbjct  113  VGDSFRRYARDSTRRVDTFASYEPEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPDST  172

Query  663  FTSY  674
            FT+Y
Sbjct  173  FTNY  176


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    G  D+F  Y    N+P ++FR Y        D F  Y    NV D SF +Y
Sbjct  229  FTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASY  288

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + G   +F NYG   N   + F  Y
Sbjct  289  AKGANGNAAEFQNYGGSFNPGTVTFKGY  316



>gb|KEH20005.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=374

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 77/142 (54%), Gaps = 23/142 (16%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            N FTPKAY IRYW + I N+L KP F+L+KASPL+A   A + K AA    +LST+LP F
Sbjct  16   NSFTPKAYAIRYWDRVIKNNLPKPSFILSKASPLSATDAAAFEKHAAAN--TLSTKLPEF  73

Query  315  CSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDS  494
            CS+A+L CFP+++P L +                     R  G + FK Y       VD 
Sbjct  74   CSAAHLFCFPNINPQLCRKP-----------------VLRGLGTNIFKGYGKG----VDL  112

Query  495  FRRYSRDSVGHEDRFSNYAPNG  560
              ++S D+ G  + F +YA  G
Sbjct  113  DNKFSFDNYGFTNPFKDYAKRG  134



>ref|XP_010044626.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
 gb|KCW86719.1| hypothetical protein EUGRSUZ_B03326 [Eucalyptus grandis]
Length=364

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 60/106 (57%), Gaps = 8/106 (8%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +N   PK YL+ YW +QI+N LA P  L++K SPL  A+ A +++  A   ++LS  L  
Sbjct  42   ANSIPPKEYLVHYWNEQITNTLAVPPLLISKVSPLTTAETALFAQFVAK--DALSDHLLS  99

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            FC +A LLCFPDLS       G V      F +F N  T  AGG++
Sbjct  100  FCKAAQLLCFPDLSSHQVGKDGRV------FYDFINGATTLAGGMN  139



>ref|XP_010046641.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=364

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +N   PK YL+ YW +QI+N LA P  L++K SPL  A+ A ++++ A   ++LS     
Sbjct  42   ANSILPKEYLVHYWNEQITNTLAVPPLLISKVSPLTTAETALFAQLVAK--DALSDHPLS  99

Query  312  FCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVD  449
            FC +A LLCFPDLS       G V      F +F N  T   GG++
Sbjct  100  FCKAAQLLCFPDLSSHQVGKDGRV------FYDFINGATTLVGGMN  139



>ref|XP_010046648.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=383

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +N  +PKAYL+ YW KQI+N+L KP  L +KASPL AA    ++++ A G  ++S  L  
Sbjct  44   ANSISPKAYLVHYWNKQITNNLPKPPILFSKASPLTAASATIFAELVAKG--AISDHLLS  101

Query  312  FCSSANLLCF  341
            FC  A LLCF
Sbjct  102  FCEEAQLLCF  111



>ref|XP_010046646.1| PREDICTED: BURP domain-containing protein 16-like [Eucalyptus 
grandis]
Length=538

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +3

Query  93   VIGIMGGEDS--GELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSK  266
            V+    G DS  GE +N  +PKAYL+ YW KQI+N+L KP  L +KASPL AA    +++
Sbjct  23   VVRATPGADSLAGE-ANSISPKAYLVHYWNKQITNNLPKPPILFSKASPLTAASATIFAE  81

Query  267  MAADGGESLSTQLPGFCSSANLLCF  341
            + A G  ++S  L  FC  A LLCF
Sbjct  82   LVAKG--AISDHLLSFCEEAQLLCF  104


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  120  SGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLST  299
            +GE +N   PK YL+RYW +QI+++ A P  L +K SPL AA+   ++++ A    ++S 
Sbjct  388  AGE-ANSIPPKEYLVRYWTEQITSNPAIPPLLTSKVSPLIAAETTLFAQLVAKS--AISD  444

Query  300  QLPGFCSSANLLCFP  344
            +L  FC +A LLCFP
Sbjct  445  RLSSFCRAAQLLCFP  459



>ref|XP_010044627.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010044628.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X2 [Eucalyptus grandis]
Length=372

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +N  +PKAYL+ YW KQI+N+L KP  L  KASPL AA    ++++ A G  ++S  L  
Sbjct  44   ANSISPKAYLVHYWNKQITNNLPKPPILFTKASPLTAASATIFAELVAKG--AISDHLLS  101

Query  312  FCSSANLLCF  341
            FC  A LLCF
Sbjct  102  FCEEAQLLCF  111



>ref|XP_010046642.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=367

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +N  +PKAYL+ YW KQI+N+L KP  L +KASPL  A    ++++ A G  ++S  L  
Sbjct  37   ANSISPKAYLVHYWNKQITNNLPKPPILFSKASPLTTASATIFAELVAKG--AISDHLLS  94

Query  312  FCSSANLLCF  341
            FC  A LLCF
Sbjct  95   FCEEAQLLCF  104



>dbj|BAD23622.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
 dbj|BAD29397.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
Length=690

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 99/213 (46%), Gaps = 34/213 (16%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            ++PFT KA  +RYW +++ ++   P F   K SPL+A   A +S +AA G   L +++  
Sbjct  63   ASPFTAKAAFVRYWNRKVHSNRPHPAFFFAKLSPLSAPDAAAFSTLAAAG--QLGSRIRA  120

Query  312  FCSSANLLC-------------------------FPDLSPSLEKHAGNVNFASYSFKNFT  416
            FC++A+LLC                                     G   F +Y   NF+
Sbjct  121  FCAAASLLCPTTPGSSWSKSSSDGDGAAAAAAPAGGGGGGGGGGDGGAAPFKNYENGNFS  180

Query  417  NYGTDRAGGVDSFKNYTDNEN-------IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQ  575
            +YG    GG D F  Y+  ++         VDSFRRY + S G  D F++Y   GNV   
Sbjct  181  SYGNSGGGGADQFAVYSSGQSNGGGGGGGGVDSFRRYGKGSQGRNDSFTSYEAGGNVGTS  240

Query  576  SFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            SF +Y   +TGG G FS+Y  + N   + F +Y
Sbjct  241  SFTSYNGDATGGAGGFSSYAGDANTVAVSFGNY  273



>ref|NP_001062896.2| Os09g0329000 [Oryza sativa Japonica Group]
 sp|Q6K2M1.2|BURPE_ORYSJ RecName: Full=BURP domain-containing protein 14; Short=OsBURP14; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF24810.2| Os09g0329000 [Oryza sativa Japonica Group]
Length=690

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 99/213 (46%), Gaps = 34/213 (16%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            ++PFT KA  +RYW +++ ++   P F   K SPL+A   A +S +AA G   L +++  
Sbjct  63   ASPFTAKAAFVRYWNRKVHSNRPHPAFFFAKLSPLSAPDAAAFSTLAAAG--QLGSRIRA  120

Query  312  FCSSANLLC-------------------------FPDLSPSLEKHAGNVNFASYSFKNFT  416
            FC++A+LLC                                     G   F +Y   NF+
Sbjct  121  FCAAASLLCPTTPGSSWSKSSSDGDGAAAAAAPAGGGGGGGGGGDGGAAPFKNYENGNFS  180

Query  417  NYGTDRAGGVDSFKNYTDNEN-------IPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQ  575
            +YG    GG D F  Y+  ++         VDSFRRY + S G  D F++Y   GNV   
Sbjct  181  SYGNSGGGGADQFAVYSSGQSNGGGGGGGGVDSFRRYGKGSQGRNDSFTSYEAGGNVGTS  240

Query  576  SFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            SF +Y   +TGG G FS+Y  + N   + F +Y
Sbjct  241  SFTSYNGDATGGAGGFSSYAGDANTVAVSFGNY  273



>gb|EEE68602.1| hypothetical protein OsJ_27135 [Oryza sativa Japonica Group]
Length=703

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 0/96 (0%)
 Frame = +3

Query  387  FASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNV  566
            F  YS  NFTNYG+   GG D F  Y+ + N+  DSFRRY RDS    D F++Y   GNV
Sbjct  88   FKGYSNANFTNYGSGGVGGADGFSAYSPDLNVVGDSFRRYGRDSTRRVDTFASYEAEGNV  147

Query  567  VDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            V  +F +Y  ++TGG G FS Y  + NVPD  FT+Y
Sbjct  148  VTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNY  183


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FTNYG    G  D+F  Y    N+P ++FR Y        D F  Y    NV D SF +Y
Sbjct  236  FTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASY  295

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + G   +F NYG   N   + F  Y
Sbjct  296  AKGANGNAAEFQNYGGSFNPGTVTFKGY  323



>ref|XP_010044635.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Eucalyptus grandis]
Length=358

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            +N   PK Y +RYW +QI+++ A P  L++K SPL AA+   ++++ A G  ++S +L  
Sbjct  42   ANSIPPKEYFVRYWTEQITSNPAIPPLLISKVSPLTAAETTLFAQLVAKG--AISDRLSS  99

Query  312  FCSSANLLCFP  344
            FC +A LLCFP
Sbjct  100  FCRAAQLLCFP  110



>gb|KHN12103.1| Putative polygalacturonase non-catalytic subunit JP650 [Glycine 
soja]
Length=192

 Score = 58.2 bits (139),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +3

Query  96   IGIMGGEDSGELSNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLN  239
            +G  G  D+ E  NPFTPKA+ IRYW K+I + L KP FLL+KA P+N
Sbjct  19   VGFAGAGDAAE-KNPFTPKAFAIRYWDKEIRSGLPKPQFLLSKAPPMN  65


 Score = 33.5 bits (75),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +2

Query  326  ESALLPGFVPQPREARRERQFRVLFFQEFHQLRHRPCR  439
            E+ LLPG   QPREAR+ R+   +  QE HQL +   R
Sbjct  88   EAPLLPGIGVQPREARQRRKLCSVQRQELHQLWNGSTR  125



>ref|XP_010936822.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=615

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 100/179 (56%), Gaps = 8/179 (4%)
 Frame = +3

Query  141  FTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF-C  317
            FT KA  +RYW ++  +    P FLL+K SPL+    A  S        S +T LP F C
Sbjct  30   FTAKAAALRYWHRKNPHHRPLPPFLLSKLSPLSPLSSAALSSAL----SSATTPLPSFLC  85

Query  318  SSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRAGGVDSFKNYTDNENIPVDSF  497
            S+A+LLC    S S    +   N   Y+  NF++YG   +GG D+FK Y+ + N   DSF
Sbjct  86   SAAHLLCSSSHSTSPPSPSDFSN---YNHANFSSYGDSLSGGRDAFKIYSSDANTAADSF  142

Query  498  RRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPEVNVPDMRFTSY  674
             RYS  S    D FS+Y+ + N+   SF++Y  +S+G  G FS+Y    NVPD+RF+SY
Sbjct  143  HRYSLRSSSRPDSFSSYSSDANIAGASFSSYAAASSGASGSFSSYAASANVPDLRFSSY  201



>gb|ABK25588.1| unknown [Picea sitchensis]
Length=145

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  135  NPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPGF  314
            +PF  K+ L+R+W++ + N    P FLL KASPLNA   A ++   A+   +LS  +  F
Sbjct  35   HPFAAKSSLLRFWRRVLPNARLPP-FLLQKASPLNATSVAVFAGYIAN--HTLSDHIASF  91

Query  315  CSSANLLC  338
            C++A+LLC
Sbjct  92   CTAADLLC  99



>gb|EMT26618.1| hypothetical protein F775_18544 [Aegilops tauschii]
Length=560

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 42/88 (48%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG       D+F +Y  N N P ++FR YS  S G  D F  Y  N NV D SF +Y
Sbjct  68   FINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSGSNGGADDFKGYRDNANVGDDSFTSY  127

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + G    F +YG  VN   + F  Y
Sbjct  128  ANDANGATADFQSYGKSVNPGSVGFKGY  155



>gb|EMS64687.1| hypothetical protein TRIUR3_01269 [Triticum urartu]
Length=487

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 41/88 (47%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            F NYG       D+F +Y  N N P ++FR YS  S G  D F  Y  N NV D SF  Y
Sbjct  233  FINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSGSNGGADDFKGYRDNANVGDDSFTAY  292

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
               + G    F +YG  VN   + F  Y
Sbjct  293  ANDANGATADFQSYGKSVNPGSVGFKGY  320


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  441  GVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgk  620
            G  +F  Y+  +  PVDSF RY + S+G  D F+ Y   GNV   SFN+Y   +TGG GK
Sbjct  103  GAGAFAVYSRGQVNPVDSFHRYGKGSLGRNDSFATYQALGNVGTASFNSYTAGATGGAGK  162

Query  621  FSNYGPEVNVPDMRFTSY  674
            F+ Y  E N   + F +Y
Sbjct  163  FAEYDGETNTVAVTFANY  180



>gb|KHN00353.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=437

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +3

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            GG   FK Y D  N+P   F  YS ++ G    FS+Y+ NGN  +Q+F +YG +  G   
Sbjct  50   GGAGEFKRYADETNVPNLGFTSYSDNANGRTQSFSSYSENGNAGEQTFTSYGKNGNGPTN  109

Query  618  kFSNYGPEVNVPDMRFTSYS  677
             F++YG E NV    F++Y+
Sbjct  110  VFASYGTESNVVGSGFSNYA  129



>dbj|BAH57586.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57587.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57588.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57590.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57591.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57592.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57593.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57594.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57595.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57599.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57601.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57602.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57603.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57604.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57605.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57606.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
 dbj|BAH57607.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
Length=196

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY  N NV D SF++
Sbjct  38   DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  97

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  98   YAKNSNFEKVDFVNYGKSINPGSESFSGY  126



>dbj|BAH57597.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY  N NV D SF++
Sbjct  38   DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  97

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  98   YAKNSNFEKVDFVNYGKSINPGSESFSGY  126



>dbj|BAH57598.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57600.1| BURP domain-containing protein, partial [Arabidopsis thaliana]
Length=196

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY  N NV D SF++
Sbjct  38   DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  97

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  98   YAKNSNFEKVDFVNYGKSINPGSESFSGY  126



>dbj|BAH57596.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY  N NV D SF++
Sbjct  38   DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  97

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  98   YAKNSNFEKVDFVNYGKSINPGSESFSGY  126



>dbj|BAH57589.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY  N NV D SF++
Sbjct  38   DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  97

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     F+ Y
Sbjct  98   YAKNSNFEKVDFVNYGKSINPGSESFSGY  126



>ref|XP_006659367.1| PREDICTED: BURP domain-containing protein 12-like, partial [Oryza 
brachyantha]
Length=495

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +3

Query  462  YTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkgkFSNYGPE  641
            Y+ + N+  DSFRRY RDS    D F++Y   GNVV  +F +Y   +TGG G F++Y  +
Sbjct  3    YSPDLNVVGDSFRRYGRDSTRRADTFASYEAEGNVVTANFTSYAGGATGGTGAFASYAAD  62

Query  642  VNVPDMRFTSY  674
             N PD  FT+Y
Sbjct  63   RNGPDPPFTTY  73



>dbj|BAH57581.1| BURP domain-containing protein [Arabidopsis lyrata]
Length=196

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 44/89 (49%), Gaps = 0/89 (0%)
 Frame = +3

Query  408  NFTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNT  587
            +F+NYG +     D+FK Y  + N+P ++F+ Y        D F NY    NV D SF +
Sbjct  38   DFSNYGENSNAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDSFAS  97

Query  588  YgtsstggkgkFSNYGPEVNVPDMRFTSY  674
            Y  +S   K  F NYG  +N     FT Y
Sbjct  98   YAKNSNFEKVDFVNYGKSINPGSESFTGY  126



>gb|AEN81138.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG +  G  DSF +Y  N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  76   FTKYGENGNGANDSFTSYGGNXNVPVNDFKGYGXGGNGAVYGFKNYRDQSNIGVDSFSSY  135

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  136  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>gb|AEN81137.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG +  G  DSF +Y  N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  76   FTKYGENGNGANDSFTSYGGNXNVPVNDFKGYGXGGNGAVYGFKNYRDQSNIGVDSFSSY  135

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  136  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>gb|EEE69479.1| hypothetical protein OsJ_28904 [Oryza sativa Japonica Group]
Length=837

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  132  SNPFTPKAYLIRYWKKQISNDLAKPWFLLNKASPLNAAQYAGYSKMAADGGESLSTQLPG  311
            ++PFT KA  +RYW +++ ++   P F   K SPL+A   A +S +AA G   L +++  
Sbjct  63   ASPFTAKAAFVRYWNRKVHSNRPHPAFFFAKLSPLSAPDAAAFSTLAAAG--QLGSRIRA  120

Query  312  FCSSANLLC  338
            FC++A+LLC
Sbjct  121  FCAAASLLC  129



>gb|EMS58973.1| hypothetical protein TRIUR3_16136 [Triticum urartu]
Length=514

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 60/142 (42%), Gaps = 12/142 (8%)
 Frame = +3

Query  249  YAGYSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGT  428
            +  YS+ A  G  S +    G+  SAN      L  +   + G+ N  S     F NYG 
Sbjct  108  FTSYSQEANHGESSFA----GYGKSAN-----SLRETFTSYGGDTNTLS---SGFANYGE  155

Query  429  DRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstg  608
               G  D+F  Y    N+P ++FR Y        D F  Y  + NV D SF +Y   + G
Sbjct  156  SANGATDTFTGYGVEGNVPENTFRSYGAGGNAGVDTFKGYRGDANVGDDSFASYAKGANG  215

Query  609  gkgkFSNYGPEVNVPDMRFTSY  674
            G  +F +YG   N   + F  Y
Sbjct  216  GAAEFQSYGGSANQGSVAFKGY  237



>gb|AEN81134.1| AT1G60390-like protein, partial [Capsella grandiflora]
 gb|AEN81135.1| AT1G60390-like protein, partial [Capsella grandiflora]
 gb|AEN81142.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81143.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81144.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81145.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81146.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81147.1| AT1G60390-like protein, partial [Capsella rubella]
Length=171

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG +  G  DSF +Y  N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  76   FTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  135

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  136  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>gb|AEN81136.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG +  G  DSF +Y  N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  76   FTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  135

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  136  AKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>gb|AEN81139.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = +3

Query  411  FTNYGTDRAGGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTY  590
            FT YG +  G  DSF +Y  N N+PV+ F+ Y     G    F NY    N+   SF++Y
Sbjct  76   FTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  135

Query  591  gtsstggkgkFSNYGPEVNVPDMRFTSY  674
              +S   K  F NYG   N+    FT Y
Sbjct  136  AKNSNXEKVNFVNYGKSFNLGSDNFTGY  163



>gb|EMT30231.1| hypothetical protein F775_20363 [Aegilops tauschii]
Length=444

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 59/139 (42%), Gaps = 12/139 (9%)
 Frame = +3

Query  258  YSKMAADGGESLSTQLPGFCSSANLLCFPDLSPSLEKHAGNVNFASYSFKNFTNYGTDRA  437
            YS+ A  G  S +    G+  SAN      L  +   + G+ N  S     F NYG    
Sbjct  62   YSQEANHGESSFA----GYGKSAN-----SLRETFTSYGGDTNTLS---SGFANYGESAN  109

Query  438  GGVDSFKNYTDNENIPVDSFRRYSRDSVGHEDRFSNYAPNGNVVDQSFNTYgtsstggkg  617
            G  D+F  Y    N+P ++FR Y        D F  Y  + NV D SF +Y   + GG  
Sbjct  110  GATDTFTGYGVEGNVPENTFRSYGAGGNAGVDTFKGYRDDANVGDDSFASYAKGANGGAA  169

Query  618  kFSNYGPEVNVPDMRFTSY  674
            +F +YG   N   + F  Y
Sbjct  170  EFQSYGGSGNQGSVAFKGY  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240