BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048C05

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784886.1|  PREDICTED: probable leucine-rich repeat rece...    268   8e-82   Nicotiana sylvestris
ref|XP_009605195.1|  PREDICTED: probable leucine-rich repeat rece...    272   3e-81   Nicotiana tomentosiformis
gb|EYU33236.1|  hypothetical protein MIMGU_mgv1a021943mg                266   6e-79   Erythranthe guttata [common monkey flower]
ref|XP_009605193.1|  PREDICTED: probable leucine-rich repeat rece...    265   2e-78   Nicotiana tomentosiformis
gb|EYU33238.1|  hypothetical protein MIMGU_mgv1a025286mg                262   2e-77   Erythranthe guttata [common monkey flower]
ref|XP_004230391.1|  PREDICTED: probable leucine-rich repeat rece...    261   3e-77   Solanum lycopersicum
ref|XP_006358482.1|  PREDICTED: probable leucine-rich repeat rece...    258   5e-76   Solanum tuberosum [potatoes]
emb|CDO97682.1|  unnamed protein product                                257   9e-76   Coffea canephora [robusta coffee]
ref|XP_009803111.1|  PREDICTED: probable leucine-rich repeat rece...    256   2e-75   Nicotiana sylvestris
ref|XP_007023745.1|  Leucine-rich repeat protein kinase family pr...    253   3e-75   
gb|EYU33237.1|  hypothetical protein MIMGU_mgv1a000884mg                255   4e-75   Erythranthe guttata [common monkey flower]
ref|XP_007023744.1|  Leucine-rich repeat protein kinase family pr...    254   9e-75   
ref|XP_009784887.1|  PREDICTED: probable leucine-rich repeat rece...    249   1e-74   Nicotiana sylvestris
ref|XP_007023743.1|  Leucine-rich repeat protein kinase family pr...    254   1e-74   
ref|XP_004230392.1|  PREDICTED: probable leucine-rich repeat rece...    254   2e-74   Solanum lycopersicum
ref|XP_011092239.1|  PREDICTED: probable leucine-rich repeat rece...    253   4e-74   Sesamum indicum [beniseed]
gb|EPS63997.1|  hypothetical protein M569_10784                         240   1e-73   Genlisea aurea
gb|KHG19770.1|  hypothetical protein F383_03980                         249   2e-73   Gossypium arboreum [tree cotton]
gb|AES64685.2|  LRR receptor-like kinase                                249   9e-73   Medicago truncatula
gb|KJB68018.1|  hypothetical protein B456_010G221900                    246   1e-72   Gossypium raimondii
gb|KJB68015.1|  hypothetical protein B456_010G221900                    246   1e-72   Gossypium raimondii
gb|KJB68014.1|  hypothetical protein B456_010G221900                    246   8e-72   Gossypium raimondii
ref|XP_006431373.1|  hypothetical protein CICLE_v10000176mg             246   1e-71   Citrus clementina [clementine]
gb|KDO40686.1|  hypothetical protein CISIN_1g002189mg                   246   1e-71   Citrus sinensis [apfelsine]
ref|XP_011028448.1|  PREDICTED: probable leucine-rich repeat rece...    245   2e-71   Populus euphratica
ref|XP_011028446.1|  PREDICTED: probable leucine-rich repeat rece...    245   2e-71   Populus euphratica
ref|XP_010252241.1|  PREDICTED: probable leucine-rich repeat rece...    244   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_002519381.1|  Serine/threonine-protein kinase PBS1, putative     244   3e-71   Ricinus communis
ref|XP_006470792.1|  PREDICTED: probable leucine-rich repeat rece...    244   3e-71   Citrus sinensis [apfelsine]
ref|XP_006385116.1|  leucine-rich repeat family protein                 244   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_006358480.1|  PREDICTED: probable leucine-rich repeat rece...    244   4e-71   
gb|KCW62551.1|  hypothetical protein EUGRSUZ_G00043                     244   4e-71   Eucalyptus grandis [rose gum]
ref|XP_010065204.1|  PREDICTED: probable leucine-rich repeat rece...    244   5e-71   Eucalyptus grandis [rose gum]
ref|XP_006358481.1|  PREDICTED: probable leucine-rich repeat rece...    244   5e-71   Solanum tuberosum [potatoes]
ref|XP_010657900.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    243   9e-71   
ref|XP_010521415.1|  PREDICTED: probable leucine-rich repeat rece...    243   1e-70   Tarenaya hassleriana [spider flower]
gb|KJB68016.1|  hypothetical protein B456_010G221900                    242   2e-70   Gossypium raimondii
ref|XP_004486417.1|  PREDICTED: probable leucine-rich repeat rece...    242   2e-70   Cicer arietinum [garbanzo]
ref|XP_002303227.1|  hypothetical protein POPTR_0003s03700g             230   5e-70   
gb|KEH37006.1|  LRR receptor-like kinase                                240   9e-70   Medicago truncatula
ref|XP_010682082.1|  PREDICTED: probable leucine-rich repeat rece...    240   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010065205.1|  PREDICTED: probable leucine-rich repeat rece...    240   2e-69   
ref|XP_006385112.1|  hypothetical protein POPTR_0004s24030g             239   2e-69   Populus trichocarpa [western balsam poplar]
emb|CBI29612.3|  unnamed protein product                                243   3e-69   Vitis vinifera
gb|KCW62549.1|  hypothetical protein EUGRSUZ_G00041                     239   4e-69   Eucalyptus grandis [rose gum]
ref|XP_010067941.1|  PREDICTED: probable leucine-rich repeat rece...    239   4e-69   
gb|KCW62550.1|  hypothetical protein EUGRSUZ_G00041                     238   5e-69   Eucalyptus grandis [rose gum]
ref|XP_011088111.1|  PREDICTED: probable leucine-rich repeat rece...    238   5e-69   
ref|XP_010682075.1|  PREDICTED: probable leucine-rich repeat rece...    238   8e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682077.1|  PREDICTED: probable leucine-rich repeat rece...    238   8e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010533231.1|  PREDICTED: probable leucine-rich repeat rece...    238   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_011092237.1|  PREDICTED: probable leucine-rich repeat rece...    238   1e-68   Sesamum indicum [beniseed]
ref|XP_010065206.1|  PREDICTED: probable leucine-rich repeat rece...    236   5e-68   
gb|KCW62548.1|  hypothetical protein EUGRSUZ_G00040                     235   5e-68   Eucalyptus grandis [rose gum]
ref|XP_011092240.1|  PREDICTED: probable leucine-rich repeat rece...    233   5e-67   
ref|XP_007023753.1|  Leucine-rich repeat protein kinase family pr...    233   5e-67   
emb|CDX83185.1|  BnaA03g23210D                                          218   6e-67   
ref|XP_011092238.1|  PREDICTED: probable leucine-rich repeat rece...    232   8e-67   Sesamum indicum [beniseed]
ref|XP_006836951.1|  hypothetical protein AMTR_s00099p00159710          232   9e-67   
gb|KCW62545.1|  hypothetical protein EUGRSUZ_G00037                     231   1e-66   Eucalyptus grandis [rose gum]
ref|XP_010088710.1|  putative leucine-rich repeat receptor-like p...    231   2e-66   
ref|XP_003594434.1|  Somatic embryogenesis receptor-like kinase         230   5e-66   
ref|XP_007156284.1|  hypothetical protein PHAVU_003G273700g             229   6e-66   Phaseolus vulgaris [French bean]
ref|XP_010252252.1|  PREDICTED: probable leucine-rich repeat rece...    229   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010682076.1|  PREDICTED: probable leucine-rich repeat rece...    228   2e-65   
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...    228   3e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010065203.1|  PREDICTED: probable leucine-rich repeat rece...    227   5e-65   
ref|XP_007019716.1|  Leucine-rich repeat protein kinase family pr...    227   6e-65   
emb|CDY68959.1|  BnaCnng61190D                                          216   9e-65   Brassica napus [oilseed rape]
gb|KHN40742.1|  Putative leucine-rich repeat receptor-like protei...    226   2e-64   Glycine soja [wild soybean]
ref|XP_011464972.1|  PREDICTED: probable leucine-rich repeat rece...    224   6e-64   Fragaria vesca subsp. vesca
gb|EPS73565.1|  hypothetical protein M569_01189                         224   7e-64   Genlisea aurea
ref|XP_003530535.1|  PREDICTED: probable leucine-rich repeat rece...    223   1e-63   Glycine max [soybeans]
gb|KFK27543.1|  hypothetical protein AALP_AA8G397000                    214   1e-63   Arabis alpina [alpine rockcress]
ref|XP_008366930.1|  PREDICTED: probable leucine-rich repeat rece...    209   2e-63   
gb|KJB29748.1|  hypothetical protein B456_005G116800                    221   2e-63   Gossypium raimondii
gb|KHN40734.1|  Putative leucine-rich repeat receptor-like protei...    222   3e-63   Glycine soja [wild soybean]
gb|KEH20269.1|  LRR receptor-like kinase                                221   5e-63   Medicago truncatula
gb|KJB29747.1|  hypothetical protein B456_005G116800                    221   5e-63   Gossypium raimondii
ref|XP_006402242.1|  hypothetical protein EUTSA_v10012589mg             221   1e-62   Eutrema salsugineum [saltwater cress]
ref|XP_011464973.1|  PREDICTED: probable leucine-rich repeat rece...    220   1e-62   Fragaria vesca subsp. vesca
emb|CDY21455.1|  BnaC03g27420D                                          220   1e-62   Brassica napus [oilseed rape]
ref|XP_003547844.1|  PREDICTED: probable leucine-rich repeat rece...    220   2e-62   Glycine max [soybeans]
ref|XP_010671953.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    220   2e-62   
ref|XP_010065202.1|  PREDICTED: probable leucine-rich repeat rece...    220   2e-62   Eucalyptus grandis [rose gum]
emb|CDX83184.1|  BnaA03g23220D                                          219   2e-62   
gb|KDO70764.1|  hypothetical protein CISIN_1g002121mg                   219   2e-62   Citrus sinensis [apfelsine]
ref|XP_010930348.1|  PREDICTED: probable leucine-rich repeat rece...    219   4e-62   
ref|XP_009118911.1|  PREDICTED: probable leucine-rich repeat rece...    219   4e-62   Brassica rapa
ref|XP_008782739.1|  PREDICTED: probable leucine-rich repeat rece...    218   7e-62   Phoenix dactylifera
ref|XP_009134023.1|  PREDICTED: probable leucine-rich repeat rece...    218   8e-62   Brassica rapa
ref|XP_009593371.1|  PREDICTED: probable leucine-rich repeat rece...    218   1e-61   Nicotiana tomentosiformis
emb|CDY61244.1|  BnaCnng37500D                                          218   1e-61   Brassica napus [oilseed rape]
gb|EEE52938.1|  hypothetical protein OsJ_35570                          217   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066400.1|  Os12g0210400                                       217   1e-61   
ref|XP_010252249.1|  PREDICTED: probable leucine-rich repeat rece...    217   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_006481666.1|  PREDICTED: probable leucine-rich repeat rece...    217   2e-61   Citrus sinensis [apfelsine]
gb|AAF68126.1|AC010793_21  F20B17.5                                     217   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252248.1|  PREDICTED: probable leucine-rich repeat rece...    217   3e-61   Nelumbo nucifera [Indian lotus]
ref|NP_178080.2|  putative serine/threonine kinase                      217   3e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42372.1|  hypothetical protein AALP_AA2G247300                    217   3e-61   Arabis alpina [alpine rockcress]
ref|XP_002889259.1|  hypothetical protein ARALYDRAFT_477135             216   3e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_009377697.1|  PREDICTED: probable leucine-rich repeat rece...    207   4e-61   Pyrus x bretschneideri [bai li]
emb|CDX83183.1|  BnaA03g23230D                                          215   5e-61   
ref|XP_009134024.1|  PREDICTED: probable leucine-rich repeat rece...    215   7e-61   Brassica rapa
ref|XP_010441110.1|  PREDICTED: probable leucine-rich repeat rece...    202   8e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004137665.1|  PREDICTED: probable leucine-rich repeat rece...    215   9e-61   Cucumis sativus [cucumbers]
ref|XP_010275979.1|  PREDICTED: probable leucine-rich repeat rece...    215   1e-60   Nelumbo nucifera [Indian lotus]
ref|XP_007147540.1|  hypothetical protein PHAVU_006G133200g             214   1e-60   Phaseolus vulgaris [French bean]
ref|XP_006389866.1|  hypothetical protein EUTSA_v10018176mg             213   1e-60   
ref|XP_006852584.1|  hypothetical protein AMTR_s00021p00213800          214   1e-60   Amborella trichopoda
dbj|BAA98164.1|  receptor protein kinase-like                           214   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802221.1|  PREDICTED: probable leucine-rich repeat rece...    214   2e-60   
gb|KJB57523.1|  hypothetical protein B456_009G167900                    214   2e-60   Gossypium raimondii
gb|KFK26616.1|  hypothetical protein AALP_AA8G271800                    214   2e-60   Arabis alpina [alpine rockcress]
ref|NP_199787.2|  leucine-rich repeat protein kinase-like protein       214   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002269419.1|  PREDICTED: probable leucine-rich repeat rece...    214   2e-60   Vitis vinifera
ref|XP_010441081.1|  PREDICTED: probable leucine-rich repeat rece...    214   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010930467.1|  PREDICTED: probable leucine-rich repeat rece...    214   3e-60   
ref|XP_009128375.1|  PREDICTED: probable leucine-rich repeat rece...    214   3e-60   Brassica rapa
ref|XP_011028445.1|  PREDICTED: probable leucine-rich repeat rece...    213   3e-60   Populus euphratica
ref|XP_009387132.1|  PREDICTED: probable leucine-rich repeat rece...    213   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008442305.1|  PREDICTED: probable leucine-rich repeat rece...    213   4e-60   Cucumis melo [Oriental melon]
ref|XP_010442445.1|  PREDICTED: probable leucine-rich repeat rece...    213   4e-60   
ref|XP_010417632.1|  PREDICTED: probable leucine-rich repeat rece...    213   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002864013.1|  leucine-rich repeat family protein                 206   5e-60   
ref|XP_011012973.1|  PREDICTED: probable leucine-rich repeat rece...    213   5e-60   Populus euphratica
ref|XP_002323702.2|  leucine-rich repeat transmembrane protein ki...    213   9e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009387702.1|  PREDICTED: probable leucine-rich repeat rece...    212   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864014.1|  leucine-rich repeat family protein                 212   1e-59   
emb|CDM81495.1|  unnamed protein product                                212   1e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006300598.1|  hypothetical protein CARUB_v10019721mg             212   1e-59   
emb|CDM81501.1|  unnamed protein product                                212   1e-59   Triticum aestivum [Canadian hard winter wheat]
emb|CDY49740.1|  BnaA02g19320D                                          214   2e-59   Brassica napus [oilseed rape]
gb|KHN40741.1|  Putative leucine-rich repeat receptor-like protei...    211   2e-59   Glycine soja [wild soybean]
emb|CDY22287.1|  BnaC02g25910D                                          214   2e-59   Brassica napus [oilseed rape]
ref|XP_006402241.1|  hypothetical protein EUTSA_v10012584mg             211   2e-59   
gb|KHG12756.1|  hypothetical protein F383_03913                         211   2e-59   Gossypium arboreum [tree cotton]
dbj|BAJ89467.1|  predicted protein                                      211   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94480.1|  predicted protein                                      211   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008804684.1|  PREDICTED: probable leucine-rich repeat rece...    206   4e-59   
emb|CDP08081.1|  unnamed protein product                                210   6e-59   Coffea canephora [robusta coffee]
ref|XP_003535032.1|  PREDICTED: probable leucine-rich repeat rece...    209   9e-59   Glycine max [soybeans]
ref|XP_010484994.1|  PREDICTED: probable leucine-rich repeat rece...    209   1e-58   
ref|XP_010482269.1|  PREDICTED: probable leucine-rich repeat rece...    209   1e-58   Camelina sativa [gold-of-pleasure]
gb|KCW47574.1|  hypothetical protein EUGRSUZ_K01321                     209   1e-58   Eucalyptus grandis [rose gum]
ref|XP_010038738.1|  PREDICTED: probable leucine-rich repeat rece...    209   1e-58   Eucalyptus grandis [rose gum]
ref|XP_010429861.1|  PREDICTED: probable leucine-rich repeat rece...    209   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010688349.1|  PREDICTED: probable leucine-rich repeat rece...    208   2e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010921260.1|  PREDICTED: probable leucine-rich repeat rece...    205   3e-58   
ref|XP_004960772.1|  PREDICTED: probable leucine-rich repeat rece...    208   3e-58   Setaria italica
ref|XP_008804670.1|  PREDICTED: probable leucine-rich repeat rece...    208   3e-58   
ref|XP_010938089.1|  PREDICTED: probable leucine-rich repeat rece...    208   3e-58   Elaeis guineensis
ref|XP_010044506.1|  PREDICTED: probable leucine-rich repeat rece...    207   5e-58   Eucalyptus grandis [rose gum]
ref|XP_010441071.1|  PREDICTED: probable leucine-rich repeat rece...    207   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010922852.1|  PREDICTED: probable leucine-rich repeat rece...    207   6e-58   Elaeis guineensis
ref|XP_007206754.1|  hypothetical protein PRUPE_ppa025198mg             200   6e-58   
ref|XP_010113026.1|  putative leucine-rich repeat receptor-like p...    207   6e-58   Morus notabilis
ref|XP_010442444.1|  PREDICTED: probable leucine-rich repeat rece...    207   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_011012970.1|  PREDICTED: probable leucine-rich repeat rece...    207   7e-58   Populus euphratica
ref|XP_011012972.1|  PREDICTED: probable leucine-rich repeat rece...    207   8e-58   Populus euphratica
emb|CDY12940.1|  BnaA09g13340D                                          207   8e-58   Brassica napus [oilseed rape]
ref|XP_006358564.1|  PREDICTED: probable leucine-rich repeat rece...    207   9e-58   Solanum tuberosum [potatoes]
gb|KGN59773.1|  hypothetical protein Csa_3G844910                       206   1e-57   Cucumis sativus [cucumbers]
ref|NP_199786.2|  Leucine-rich repeat (LRR) family protein              201   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417853.1|  PREDICTED: probable leucine-rich repeat rece...    206   1e-57   
ref|XP_004249557.1|  PREDICTED: probable leucine-rich repeat rece...    207   1e-57   Solanum lycopersicum
ref|XP_010482274.1|  PREDICTED: probable leucine-rich repeat rece...    205   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010314121.1|  PREDICTED: probable leucine-rich repeat rece...    206   2e-57   Solanum lycopersicum
emb|CDY21452.1|  BnaC03g27450D                                          206   2e-57   Brassica napus [oilseed rape]
ref|XP_009417851.1|  PREDICTED: probable leucine-rich repeat rece...    206   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417852.1|  PREDICTED: probable leucine-rich repeat rece...    206   2e-57   
ref|XP_009417849.1|  PREDICTED: probable leucine-rich repeat rece...    206   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009761326.1|  PREDICTED: probable leucine-rich repeat rece...    206   2e-57   Nicotiana sylvestris
ref|XP_010482273.1|  PREDICTED: probable leucine-rich repeat rece...    206   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010482272.1|  PREDICTED: probable leucine-rich repeat rece...    206   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010482271.1|  PREDICTED: probable leucine-rich repeat rece...    206   3e-57   
ref|XP_006664421.1|  PREDICTED: probable leucine-rich repeat rece...    205   3e-57   
ref|XP_009600216.1|  PREDICTED: probable leucine-rich repeat rece...    205   3e-57   Nicotiana tomentosiformis
ref|XP_011461103.1|  PREDICTED: probable leucine-rich repeat rece...    205   3e-57   Fragaria vesca subsp. vesca
gb|KHN40213.1|  Putative leucine-rich repeat receptor-like protei...    204   5e-57   Glycine soja [wild soybean]
ref|XP_009370844.1|  PREDICTED: probable leucine-rich repeat rece...    205   5e-57   Pyrus x bretschneideri [bai li]
ref|XP_006584124.1|  PREDICTED: probable leucine-rich repeat rece...    204   7e-57   Glycine max [soybeans]
ref|XP_006584125.1|  PREDICTED: probable leucine-rich repeat rece...    204   9e-57   Glycine max [soybeans]
ref|XP_006338928.1|  PREDICTED: probable leucine-rich repeat rece...    204   1e-56   Solanum tuberosum [potatoes]
ref|XP_009761610.1|  PREDICTED: probable leucine-rich repeat rece...    204   1e-56   Nicotiana sylvestris
ref|XP_007154094.1|  hypothetical protein PHAVU_003G0900000g            202   1e-56   Phaseolus vulgaris [French bean]
ref|XP_007154093.1|  hypothetical protein PHAVU_003G0900000g            202   2e-56   Phaseolus vulgaris [French bean]
gb|KJB57522.1|  hypothetical protein B456_009G167900                    202   3e-56   Gossypium raimondii
ref|XP_009337850.1|  PREDICTED: probable leucine-rich repeat rece...    202   4e-56   Pyrus x bretschneideri [bai li]
ref|XP_009113087.1|  PREDICTED: probable leucine-rich repeat rece...    202   4e-56   
ref|XP_009416032.1|  PREDICTED: probable leucine-rich repeat rece...    202   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP16125.1|  unnamed protein product                                198   6e-56   Coffea canephora [robusta coffee]
ref|XP_002467924.1|  hypothetical protein SORBIDRAFT_01g036470          202   6e-56   
ref|XP_002519985.1|  receptor protein kinase, putative                  202   7e-56   Ricinus communis
ref|XP_003593681.1|  Somatic embryogenesis receptor-like kinase         201   8e-56   Medicago truncatula
ref|NP_199788.1|  putative leucine-rich repeat receptor-like prot...    201   9e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...    201   1e-55   Populus euphratica
ref|XP_009365989.1|  PREDICTED: probable leucine-rich repeat rece...    201   1e-55   
ref|XP_002308292.2|  leucine-rich repeat transmembrane protein ki...    201   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_007208371.1|  hypothetical protein PRUPE_ppa000921mg             201   2e-55   Prunus persica
emb|CDY12939.1|  BnaA09g13350D                                          200   2e-55   Brassica napus [oilseed rape]
ref|XP_009365988.1|  PREDICTED: probable leucine-rich repeat rece...    201   2e-55   Pyrus x bretschneideri [bai li]
emb|CDY19539.1|  BnaC09g13640D                                          200   2e-55   Brassica napus [oilseed rape]
ref|XP_011077100.1|  PREDICTED: probable leucine-rich repeat rece...    200   2e-55   Sesamum indicum [beniseed]
gb|EYU33251.1|  hypothetical protein MIMGU_mgv1a021972mg                200   2e-55   Erythranthe guttata [common monkey flower]
emb|CDO97683.1|  unnamed protein product                                200   2e-55   Coffea canephora [robusta coffee]
ref|XP_010537840.1|  PREDICTED: probable leucine-rich repeat rece...    200   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_008465342.1|  PREDICTED: probable leucine-rich repeat rece...    200   3e-55   Cucumis melo [Oriental melon]
ref|XP_006651341.1|  PREDICTED: probable leucine-rich repeat rece...    199   4e-55   
ref|XP_010653092.1|  PREDICTED: probable leucine-rich repeat rece...    199   5e-55   Vitis vinifera
ref|XP_004485853.1|  PREDICTED: probable leucine-rich repeat rece...    199   6e-55   Cicer arietinum [garbanzo]
ref|XP_006385115.1|  hypothetical protein POPTR_0004s24060g             189   7e-55   
ref|XP_006279556.1|  hypothetical protein CARUB_v10025735mg             201   9e-55   
ref|XP_002311479.2|  hypothetical protein POPTR_0008s12450g             192   9e-55   
ref|XP_002864015.1|  hypothetical protein ARALYDRAFT_495037             198   1e-54   
ref|XP_009364675.1|  PREDICTED: probable leucine-rich repeat rece...    197   2e-54   
ref|XP_009391655.1|  PREDICTED: probable leucine-rich repeat rece...    197   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010682227.1|  PREDICTED: probable leucine-rich repeat rece...    197   2e-54   
ref|XP_009365992.1|  PREDICTED: probable leucine-rich repeat rece...    197   2e-54   
ref|XP_006279961.1|  hypothetical protein CARUB_v10025827mg             197   3e-54   Capsella rubella
ref|XP_006371696.1|  hypothetical protein POPTR_0018s002601g            184   3e-54   
emb|CAQ58615.1|  ATP binding / kinase/ protein serine / threonine...    197   3e-54   Vitis vinifera
ref|XP_009391654.1|  PREDICTED: probable leucine-rich repeat rece...    196   4e-54   
gb|KHN40214.1|  Putative leucine-rich repeat receptor-like protei...    196   4e-54   Glycine soja [wild soybean]
ref|NP_001242669.1|  probable leucine-rich repeat receptor-like p...    194   6e-54   Glycine max [soybeans]
ref|XP_008359275.1|  PREDICTED: probable leucine-rich repeat rece...    185   8e-54   
gb|EMT14100.1|  Putative LRR receptor-like serine/threonine-prote...    195   9e-54   
ref|XP_007208107.1|  hypothetical protein PRUPE_ppa000924mg             196   1e-53   Prunus persica
ref|XP_008345657.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    197   1e-53   
ref|XP_011088110.1|  PREDICTED: probable leucine-rich repeat rece...    196   1e-53   Sesamum indicum [beniseed]
gb|KHN48167.1|  Putative leucine-rich repeat receptor-like protei...    194   3e-53   Glycine soja [wild soybean]
ref|XP_006588460.1|  PREDICTED: probable leucine-rich repeat rece...    194   3e-53   Glycine max [soybeans]
ref|XP_011084699.1|  PREDICTED: probable leucine-rich repeat rece...    194   3e-53   Sesamum indicum [beniseed]
ref|XP_002441283.1|  hypothetical protein SORBIDRAFT_09g023790          192   5e-53   
ref|XP_008227086.1|  PREDICTED: probable leucine-rich repeat rece...    193   6e-53   Prunus mume [ume]
ref|XP_008643850.1|  PREDICTED: uncharacterized protein LOC100382...    193   8e-53   Zea mays [maize]
ref|XP_010252250.1|  PREDICTED: probable leucine-rich repeat rece...    193   8e-53   Nelumbo nucifera [Indian lotus]
gb|ABF95747.1|  Protein kinase domain containing protein, expressed     193   9e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002864016.1|  predicted protein                                  193   1e-52   
ref|XP_011461107.1|  PREDICTED: probable leucine-rich repeat rece...    192   1e-52   Fragaria vesca subsp. vesca
ref|XP_003561670.2|  PREDICTED: probable leucine-rich repeat rece...    193   1e-52   Brachypodium distachyon [annual false brome]
ref|XP_010482266.1|  PREDICTED: probable leucine-rich repeat rece...    192   1e-52   
ref|XP_008643846.1|  PREDICTED: uncharacterized protein LOC100382...    193   1e-52   
gb|EEC75182.1|  hypothetical protein OsI_11410                          193   1e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_004972229.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   
ref|XP_004295860.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Fragaria vesca subsp. vesca
ref|XP_011461106.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Fragaria vesca subsp. vesca
gb|EMT31021.1|  Putative LRR receptor-like serine/threonine-prote...    192   2e-52   
gb|EYU39493.1|  hypothetical protein MIMGU_mgv1a025586mg                192   2e-52   Erythranthe guttata [common monkey flower]
ref|XP_003593682.1|  Somatic embryogenesis receptor-like kinase         191   2e-52   
gb|KFK31438.1|  hypothetical protein AALP_AA6G111800                    191   3e-52   Arabis alpina [alpine rockcress]
ref|XP_003541454.1|  PREDICTED: probable leucine-rich repeat rece...    191   4e-52   Glycine max [soybeans]
ref|XP_003578779.1|  PREDICTED: probable leucine-rich repeat rece...    191   4e-52   Brachypodium distachyon [annual false brome]
ref|XP_011461097.1|  PREDICTED: probable leucine-rich repeat rece...    190   7e-52   Fragaria vesca subsp. vesca
ref|XP_010690203.1|  PREDICTED: probable leucine-rich repeat rece...    190   7e-52   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAA98166.1|  receptor protein kinase-like                           191   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007212514.1|  hypothetical protein PRUPE_ppa017853mg             190   9e-52   
emb|CBI31129.3|  unnamed protein product                                190   1e-51   Vitis vinifera
ref|XP_011466378.1|  PREDICTED: probable leucine-rich repeat rece...    189   2e-51   Fragaria vesca subsp. vesca
ref|XP_007147542.1|  hypothetical protein PHAVU_006G133400g             189   3e-51   Phaseolus vulgaris [French bean]
dbj|BAJ96239.1|  predicted protein                                      187   4e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...    188   5e-51   Eucalyptus grandis [rose gum]
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...    188   6e-51   Eucalyptus grandis [rose gum]
ref|XP_008782792.1|  PREDICTED: probable leucine-rich repeat rece...    187   8e-51   
gb|EYU39755.1|  hypothetical protein MIMGU_mgv1a000835mg                187   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_006655431.1|  PREDICTED: probable leucine-rich repeat rece...    187   2e-50   Oryza brachyantha
ref|XP_007208219.1|  hypothetical protein PRUPE_ppa018586mg             187   2e-50   
ref|XP_008649802.1|  PREDICTED: probable leucine-rich repeat rece...    187   2e-50   Zea mays [maize]
ref|XP_009406445.1|  PREDICTED: probable leucine-rich repeat rece...    187   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009335437.1|  PREDICTED: probable leucine-rich repeat rece...    185   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_003593677.1|  Receptor-like protein kinase                       181   6e-50   Medicago truncatula
gb|EMT33703.1|  Putative LRR receptor-like serine/threonine-prote...    184   8e-50   
emb|CDP15606.1|  unnamed protein product                                185   8e-50   Coffea canephora [robusta coffee]
ref|XP_008366451.1|  PREDICTED: probable leucine-rich repeat rece...    184   8e-50   
ref|XP_003566120.1|  PREDICTED: probable leucine-rich repeat rece...    184   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...    184   3e-49   Eucalyptus grandis [rose gum]
ref|XP_007148093.1|  hypothetical protein PHAVU_006G180200g             183   3e-49   Phaseolus vulgaris [French bean]
ref|XP_011028453.1|  PREDICTED: probable leucine-rich repeat rece...    181   8e-49   Populus euphratica
ref|XP_002440790.1|  hypothetical protein SORBIDRAFT_09g006630          181   9e-49   
ref|XP_011028452.1|  PREDICTED: probable leucine-rich repeat rece...    181   9e-49   
ref|XP_009406444.1|  PREDICTED: probable leucine-rich repeat rece...    182   1e-48   
ref|XP_011028451.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   
ref|XP_011028450.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   
ref|XP_010067427.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   
ref|NP_001176022.1|  Os10g0145700                                       172   2e-48   
ref|XP_010044552.1|  PREDICTED: probable leucine-rich repeat rece...    181   2e-48   
ref|XP_009417854.1|  PREDICTED: probable leucine-rich repeat rece...    180   4e-48   
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...    180   4e-48   
ref|XP_010690267.1|  PREDICTED: probable leucine-rich repeat rece...    180   5e-48   
ref|XP_010690261.1|  PREDICTED: probable leucine-rich repeat rece...    180   5e-48   
ref|XP_010690246.1|  PREDICTED: probable leucine-rich repeat rece...    180   5e-48   
ref|XP_010690238.1|  PREDICTED: probable leucine-rich repeat rece...    180   5e-48   
ref|XP_006385109.1|  hypothetical protein POPTR_0004s240001g            178   6e-48   
ref|XP_008227090.1|  PREDICTED: probable leucine-rich repeat rece...    179   6e-48   
ref|XP_010252247.1|  PREDICTED: probable leucine-rich repeat rece...    179   7e-48   
ref|XP_010252245.1|  PREDICTED: probable leucine-rich repeat rece...    178   9e-48   
ref|XP_010690253.1|  PREDICTED: probable leucine-rich repeat rece...    179   1e-47   
ref|XP_010252243.1|  PREDICTED: probable leucine-rich repeat rece...    178   1e-47   
ref|XP_002441998.1|  hypothetical protein SORBIDRAFT_08g006710          178   2e-47   
ref|XP_006282275.1|  hypothetical protein CARUB_v10028556mg             178   2e-47   
ref|XP_010233532.1|  PREDICTED: probable leucine-rich repeat rece...    178   2e-47   
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...    178   2e-47   
ref|XP_011461108.1|  PREDICTED: probable leucine-rich repeat rece...    177   3e-47   
ref|XP_006655430.1|  PREDICTED: probable leucine-rich repeat rece...    177   6e-47   
gb|EAZ13939.1|  hypothetical protein OsJ_03866                          176   9e-47   
gb|EAY76270.1|  hypothetical protein OsI_04206                          176   9e-47   
gb|EMT13742.1|  Putative LRR receptor-like serine/threonine-prote...    176   1e-46   
gb|EEC79425.1|  hypothetical protein OsI_20397                          176   1e-46   
ref|NP_001055877.1|  Os05g0486100                                       176   1e-46   
ref|XP_010682078.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   
ref|XP_006281792.1|  hypothetical protein CARUB_v10027977mg             175   3e-46   
ref|XP_010252242.1|  PREDICTED: probable leucine-rich repeat rece...    174   3e-46   
dbj|BAK05595.1|  predicted protein                                      175   3e-46   
ref|XP_006385111.1|  hypothetical protein POPTR_0004s24020g             174   6e-46   
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                     174   9e-46   
ref|XP_004962484.1|  PREDICTED: probable leucine-rich repeat rece...    173   1e-45   
ref|XP_007213558.1|  hypothetical protein PRUPE_ppa017796mg             172   1e-45   
dbj|BAD82283.1|  putative receptor-like protein kinase 2                173   1e-45   
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                     172   3e-45   
emb|CDM84721.1|  unnamed protein product                                171   7e-45   
ref|XP_008674899.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-44   
ref|XP_003566601.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-44   
ref|XP_006385110.1|  hypothetical protein POPTR_0004s24010g             170   1e-44   
ref|XP_010252244.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-44   
ref|XP_006655181.1|  PREDICTED: probable leucine-rich repeat rece...    170   2e-44   
ref|NP_001131018.1|  uncharacterized LOC100192366 precursor             169   5e-44   
ref|XP_006662853.1|  PREDICTED: probable leucine-rich repeat rece...    168   7e-44   
gb|KDO40687.1|  hypothetical protein CISIN_1g002189mg                   167   1e-43   
ref|XP_011466377.1|  PREDICTED: probable leucine-rich repeat rece...    161   2e-43   
gb|EEE51910.1|  hypothetical protein OsJ_33512                          166   4e-43   
gb|EEC67947.1|  hypothetical protein OsI_35675                          166   4e-43   
dbj|BAJ91189.1|  predicted protein                                      166   5e-43   
ref|XP_009386322.1|  PREDICTED: probable leucine-rich repeat rece...    155   6e-43   
ref|XP_011028449.1|  PREDICTED: probable leucine-rich repeat rece...    164   1e-42   
emb|CDM84720.1|  unnamed protein product                                164   2e-42   
gb|EEE63180.1|  hypothetical protein OsJ_17989                          164   2e-42   
ref|XP_008793425.1|  PREDICTED: probable leucine-rich repeat rece...    163   3e-42   
gb|EEC78946.1|  hypothetical protein OsI_19395                          162   9e-42   
ref|XP_004970368.1|  PREDICTED: probable leucine-rich repeat rece...    161   2e-41   
ref|XP_006429975.1|  hypothetical protein CICLE_v100110352mg            146   5e-40   
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...    154   1e-39   
gb|KEH20270.1|  leucine-rich receptor-like kinase family protein        147   4e-39   
ref|XP_004961712.1|  PREDICTED: probable leucine-rich repeat rece...    153   2e-38   
ref|XP_004961711.1|  PREDICTED: probable leucine-rich repeat rece...    153   2e-38   
gb|AAX92929.1|  At5g49760                                               151   5e-38   
gb|EMT20931.1|  Putative LRR receptor-like serine/threonine-prote...    151   6e-38   
dbj|BAA98163.1|  unnamed protein product                                146   6e-38   
ref|XP_007207226.1|  hypothetical protein PRUPE_ppa000992mg             151   6e-38   
ref|XP_010252233.1|  PREDICTED: probable leucine-rich repeat rece...    145   5e-36   
emb|CDP12546.1|  unnamed protein product                                141   9e-36   
ref|XP_001777494.1|  predicted protein                                  144   2e-35   
ref|XP_008246057.1|  PREDICTED: probable leucine-rich repeat rece...    139   3e-35   
ref|XP_010482267.1|  PREDICTED: probable leucine-rich repeat rece...    144   3e-35   
ref|XP_006385117.1|  hypothetical protein POPTR_0004s24080g             143   3e-35   
gb|AAT01330.1|  putative receptor protein kinase                        143   4e-35   
ref|XP_001760085.1|  predicted protein                                  142   1e-34   
ref|XP_011466379.1|  PREDICTED: probable leucine-rich repeat rece...    130   5e-34   
ref|XP_008245573.1|  PREDICTED: probable leucine-rich repeat rece...    140   6e-34   
tpg|DAA57113.1|  TPA: putative transmembrane protein kinase famil...    137   4e-33   
ref|XP_008465343.1|  PREDICTED: probable leucine-rich repeat rece...    136   1e-32   
gb|KCW62546.1|  hypothetical protein EUGRSUZ_G00038                     135   2e-32   
dbj|BAF79948.1|  receptor-like kinase                                   133   1e-31   
ref|XP_010442449.1|  PREDICTED: probable leucine-rich repeat rece...    132   2e-31   
ref|XP_010252434.1|  PREDICTED: probable leucine-rich repeat rece...    130   4e-31   
ref|XP_002456530.1|  hypothetical protein SORBIDRAFT_03g037960          131   4e-31   
gb|KCW88498.1|  hypothetical protein EUGRSUZ_A00884                     129   9e-31   
ref|XP_008802212.1|  PREDICTED: probable leucine-rich repeat rece...    130   2e-30   
gb|KCW88497.1|  hypothetical protein EUGRSUZ_A00884                     129   3e-30   
ref|XP_001774376.1|  predicted protein                                  128   9e-30   
ref|XP_002993954.1|  hypothetical protein SELMODRAFT_431914             126   3e-29   
ref|XP_002962984.1|  hypothetical protein SELMODRAFT_438262             125   4e-29   
ref|XP_002315909.2|  hypothetical protein POPTR_0010s12810g             116   2e-28   
ref|XP_008370579.1|  PREDICTED: probable leucine-rich repeat rece...    124   2e-28   
ref|XP_011461109.1|  PREDICTED: probable leucine-rich repeat rece...    119   6e-27   
ref|XP_009419865.1|  PREDICTED: probable leucine-rich repeat rece...    119   1e-26   
gb|EEC69015.1|  hypothetical protein OsI_37810                          119   1e-26   
gb|KDP21807.1|  hypothetical protein JCGZ_00594                         111   8e-26   
gb|KDP43149.1|  hypothetical protein JCGZ_26682                         110   2e-25   
tpg|DAA57112.1|  TPA: putative transmembrane protein kinase famil...    115   4e-25   
ref|XP_002993941.1|  hypothetical protein SELMODRAFT_449258             111   4e-24   
gb|EPS66484.1|  hypothetical protein M569_08293                         109   9e-24   
emb|CAN68980.1|  hypothetical protein VITISV_004150                     110   1e-23   
gb|EMT20930.1|  Putative LRR receptor-like serine/threonine-prote...    109   2e-23   
ref|XP_010486908.1|  PREDICTED: polygalacturonase inhibitor 1-like      105   3e-23   
ref|NP_974291.4|  leucine-rich repeat protein FLOR1                     105   4e-23   
ref|XP_010464968.1|  PREDICTED: polygalacturonase inhibitor 1-like      105   5e-23   
gb|AAL15279.1|  At3g12148/T23B7.11                                      104   7e-23   
gb|AAF65195.1|AF136588_1  leucine-rich repeat protein FLR1              104   1e-22   
ref|XP_002884889.1|  leucine-rich repeat protein FLR1                   103   2e-22   
ref|XP_002962583.1|  hypothetical protein SELMODRAFT_438263             107   2e-22   
emb|CDY52623.1|  BnaCnng23020D                                          103   2e-22   
gb|KFK23621.1|  hypothetical protein AALP_AAs71127U000200               101   2e-22   
ref|XP_006298126.1|  hypothetical protein CARUB_v10014170mg             103   2e-22   
ref|XP_010486728.1|  PREDICTED: receptor-like protein 12                102   2e-22   
ref|NP_199789.5|  leucine-rich repeat protein kinase-like protein       105   3e-22   
gb|AAG51067.1|AC069472_7  unknown protein; 756-145                      100   4e-22   
ref|XP_002322457.1|  Leucine-rich repeat receptor protein kinase ...    105   5e-22   
gb|ACX42230.1|  polygalacturonase inhibitory protein                    102   5e-22   
ref|XP_009120892.1|  PREDICTED: polygalacturonase inhibitor 1-like      102   5e-22   
ref|XP_008793424.1|  PREDICTED: probable leucine-rich repeat rece...    105   5e-22   
ref|XP_010498562.1|  PREDICTED: polygalacturonase inhibitor 1-lik...    102   5e-22   
ref|XP_010088707.1|  putative leucine-rich repeat receptor-like p...    104   8e-22   
ref|XP_006407361.1|  hypothetical protein EUTSA_v10021132mg             101   8e-22   
ref|XP_010534350.1|  PREDICTED: polygalacturonase inhibitor             101   9e-22   
emb|CDP12545.1|  unnamed protein product                                100   1e-21   
ref|XP_009396739.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-21   
dbj|BAD93860.1|  receptor protein kinase-like                           103   2e-21   
gb|EMT02279.1|  Putative LRR receptor-like serine/threonine-prote...    102   7e-21   
gb|KFK23620.1|  hypothetical protein AALP_AAs71127U000100               101   7e-21   
gb|EEC79423.1|  hypothetical protein OsI_20395                          101   1e-20   
ref|XP_001780578.1|  predicted protein                                  100   2e-20   
gb|KFK38578.1|  hypothetical protein AALP_AA3G131900                  97.4    2e-20   
ref|NP_001060863.1|  Os08g0117700                                       100   2e-20   
ref|WP_028289581.1|  MULTISPECIES: hypothetical protein               96.7    2e-20   
emb|CDY42127.1|  BnaC05g40920D                                        97.1    3e-20   
emb|CAN68981.1|  hypothetical protein VITISV_004151                   99.8    4e-20   
ref|WP_040586508.1|  hypothetical protein                             95.9    4e-20   
ref|XP_007217616.1|  hypothetical protein PRUPE_ppa016276mg           99.8    4e-20   
ref|XP_009125665.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  96.3    6e-20   
emb|CDY08451.1|  BnaA05g26870D                                        95.9    9e-20   
ref|XP_002323096.2|  hypothetical protein POPTR_0016s14700g           95.5    9e-20   
emb|CDY05006.1|  BnaAnng01880D                                        95.5    1e-19   
dbj|BAK00073.1|  predicted protein                                    97.1    1e-19   
ref|XP_004300723.1|  PREDICTED: somatic embryogenesis receptor ki...  98.2    1e-19   
ref|XP_002266206.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-19   
ref|XP_009629750.1|  PREDICTED: receptor-like protein 12 isoform X2   95.9    1e-19   
ref|XP_009146639.1|  PREDICTED: polygalacturonase inhibitor 1-like    95.1    1e-19   
ref|XP_011048672.1|  PREDICTED: leucine-rich repeat receptor prot...  98.6    1e-19   
ref|XP_010653122.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-19   
ref|XP_010653120.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-19   
ref|XP_006282247.1|  hypothetical protein CARUB_v10028521mg           97.1    2e-19   
dbj|BAP55140.1|  receptor protein kinase-like protein                 94.7    3e-19   
ref|XP_010043840.1|  PREDICTED: probable LRR receptor-like serine...  97.4    3e-19   
gb|KCW88496.1|  hypothetical protein EUGRSUZ_A00883                   97.1    3e-19   
ref|XP_010043831.1|  PREDICTED: probable LRR receptor-like serine...  97.1    3e-19   
ref|XP_009629749.1|  PREDICTED: LRR receptor-like serine/threonin...  95.5    4e-19   
ref|XP_008376456.1|  PREDICTED: somatic embryogenesis receptor ki...  96.7    4e-19   
ref|XP_010486743.1|  PREDICTED: receptor-like protein 12              95.5    4e-19   
ref|XP_006282197.1|  hypothetical protein CARUB_v10028463mg           96.3    6e-19   
ref|XP_008438170.1|  PREDICTED: LRR receptor-like serine/threonin...  95.1    6e-19   
ref|XP_007023749.1|  Leucine-rich repeat protein kinase family pr...  89.4    6e-19   
ref|XP_006842576.1|  hypothetical protein AMTR_s00077p00154750        96.3    7e-19   
ref|XP_008438169.1|  PREDICTED: probable LRR receptor-like serine...  95.5    8e-19   
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...  95.9    8e-19   
gb|EPS72502.1|  hypothetical protein M569_02256                       91.7    9e-19   
ref|XP_006654549.1|  PREDICTED: probable LRR receptor-like serine...  95.9    9e-19   
emb|CBI31162.3|  unnamed protein product                              96.3    1e-18   
ref|XP_006403671.1|  hypothetical protein EUTSA_v10010104mg           95.9    1e-18   
ref|XP_002318234.1|  Leucine-rich repeat receptor protein kinase ...  95.9    1e-18   
ref|XP_006659770.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  95.1    1e-18   
ref|NP_001047432.1|  Os02g0615800                                     95.5    1e-18   
ref|XP_004245714.1|  PREDICTED: probable LRR receptor-like serine...  94.7    1e-18   
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g           95.5    1e-18   
gb|KDP25788.1|  hypothetical protein JCGZ_22510                       94.7    1e-18   
ref|XP_004147946.1|  PREDICTED: LRR receptor-like serine/threonin...  94.7    1e-18   
ref|XP_011095176.1|  PREDICTED: probable LRR receptor-like serine...  95.1    1e-18   
ref|XP_011001640.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-18   
ref|XP_011001642.1|  PREDICTED: probable LRR receptor-like serine...  94.7    2e-18   
ref|XP_011001641.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-18   
ref|XP_011001639.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-18   
gb|AFW86032.1|  putative leucine-rich repeat receptor-like protei...  93.6    2e-18   
ref|XP_007155588.1|  hypothetical protein PHAVU_003G214800g           94.4    2e-18   
ref|XP_010101735.1|  Leucine-rich repeat receptor protein kinase EXS  94.4    2e-18   
gb|AFW86033.1|  putative leucine-rich repeat receptor-like protei...  94.0    2e-18   
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...  94.7    2e-18   
ref|XP_009374517.1|  PREDICTED: probable LRR receptor-like serine...  94.0    2e-18   
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...  94.4    3e-18   
ref|XP_009370496.1|  PREDICTED: somatic embryogenesis receptor ki...  94.0    3e-18   
emb|CDY14065.1|  BnaC02g01820D                                        91.3    3e-18   
gb|KEH19914.1|  Serine/Threonine kinase, plant-type protein           91.3    3e-18   
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...  94.4    3e-18   
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...  94.4    3e-18   
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...  94.4    3e-18   
gb|AFW74368.1|  putative leucine-rich repeat protein kinase famil...  90.1    3e-18   
ref|XP_008782697.1|  PREDICTED: probable LRR receptor-like serine...  94.0    4e-18   
ref|XP_004133916.1|  PREDICTED: probable LRR receptor-like serine...  93.6    4e-18   
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    4e-18   
ref|XP_011097228.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    4e-18   
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    4e-18   
ref|XP_004309271.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  93.6    4e-18   
gb|EEC79424.1|  hypothetical protein OsI_20396                        90.1    4e-18   
ref|XP_008448908.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    4e-18   
ref|XP_010416086.1|  PREDICTED: leucine-rich repeat receptor-like...  94.0    5e-18   
ref|XP_008224420.1|  PREDICTED: probable LRR receptor-like serine...  93.6    5e-18   
gb|EAY99946.1|  hypothetical protein OsI_21949                        93.6    5e-18   
gb|KDP45677.1|  hypothetical protein JCGZ_17284                       93.2    7e-18   
ref|XP_004511651.1|  PREDICTED: LRR receptor-like serine/threonin...  92.4    8e-18   
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...  92.8    9e-18   
ref|XP_006662949.1|  PREDICTED: somatic embryogenesis receptor ki...  89.4    9e-18   
ref|XP_004309048.2|  PREDICTED: probable LRR receptor-like serine...  92.8    9e-18   
ref|XP_010032651.1|  PREDICTED: probable inactive leucine-rich re...  92.4    1e-17   
dbj|BAP57509.1|  hypothetical protein THII_3212                       91.7    1e-17   
ref|XP_010032652.1|  PREDICTED: probable inactive leucine-rich re...  92.4    1e-17   
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...  92.8    1e-17   
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...  92.8    1e-17   
ref|XP_007136453.1|  hypothetical protein PHAVU_009G046600g           92.4    1e-17   
ref|XP_006481242.1|  PREDICTED: probable LRR receptor-like serine...  92.4    1e-17   
ref|XP_010921201.1|  PREDICTED: probable LRR receptor-like serine...  92.4    1e-17   
ref|XP_010557932.1|  PREDICTED: polygalacturonase inhibitor-like      89.4    1e-17   



>ref|XP_009784886.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nicotiana sylvestris]
Length=650

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 173/207 (84%), Gaps = 1/207 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            RIQL  + ++I  L I A+T+ +D+ A+++L+D W+NVPP+WA G+DPCG  WEG+GC  
Sbjct  8    RIQLCFLVVWIHILAITAWTNPDDFAALQSLKDSWQNVPPNWA-GADPCGSQWEGIGCRN  66

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SRV+S+TLSSM L+G+LSGDI+ LSELQ LDLSYNK+LTGSLP+ IG L KL NLILVGC
Sbjct  67   SRVISITLSSMSLSGQLSGDIQGLSELQTLDLSYNKELTGSLPQSIGKLTKLSNLILVGC  126

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPDSIGSL++L +LSLN N FIG IP ++G LS+LYWLDLADN+LTG++PVS G+
Sbjct  127  GFSGPIPDSIGSLTQLVFLSLNSNNFIGRIPATIGYLSKLYWLDLADNKLTGTLPVSSGS  186

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +PGLDML+ TKHFHFG N+ SGEIPA+
Sbjct  187  SPGLDMLLHTKHFHFGKNQLSGEIPAR  213



>ref|XP_009605195.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=957

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 179/217 (82%), Gaps = 2/217 (1%)
 Frame = +2

Query  44   MVI**TMIPR-IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCG  220
            MV+   M+PR IQL  + ++I  L I A+T+ +D+ A+++L+D W+NVPP+WA G+DPCG
Sbjct  1    MVVSLAMMPRRIQLCFLVVWIHVLAISAWTNPDDFAALQSLKDSWQNVPPNWA-GADPCG  59

Query  221  DHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK  400
              WEG+GC  SRV+S+TLSSM L+G+LSGDI+ LSELQ LDLSYNK+LTGSLP+ IG L 
Sbjct  60   SQWEGIGCRNSRVISITLSSMSLSGQLSGDIQGLSELQTLDLSYNKELTGSLPQSIGKLT  119

Query  401  KLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQL  580
            KL NLILVGCGF G IPDSIGSL++L +LSLN N FIG IP ++G LS+LYWLDLADN+L
Sbjct  120  KLSNLILVGCGFSGPIPDSIGSLTQLVFLSLNSNNFIGRIPATIGYLSKLYWLDLADNKL  179

Query  581  TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TG++PVS G++PGLDML+ TKHFHFG N+ SGEIPAQ
Sbjct  180  TGTLPVSSGSSPGLDMLLHTKHFHFGKNQLSGEIPAQ  216



>gb|EYU33236.1| hypothetical protein MIMGU_mgv1a021943mg [Erythranthe guttata]
Length=955

 Score =   266 bits (680),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            MI  I L ++  FIQ L I A T++NDYVA+KAL+D W NVPP+W  GSDPCGD W+G+ 
Sbjct  1    MISGIHLTMLLAFIQVLSIAALTNSNDYVALKALKDTWINVPPNWV-GSDPCGDVWDGIT  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C   RVVS+TL+S++LTG+LS DI  L+ELQ LDLSYNK +TGSLP  IGN+KKL +LIL
Sbjct  60   CKNDRVVSITLASINLTGQLSSDISGLTELQTLDLSYNKGMTGSLPSGIGNVKKLSSLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF G IP SIGSL +L+YLSLN N FIG IPPS+G L  LYWLDLADN+LTG+IPVS
Sbjct  120  VGCGFSGPIPPSIGSLQQLRYLSLNSNNFIGSIPPSIGNLLNLYWLDLADNKLTGTIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            DG +PGLDMLV TKHFHFG N+ SG IP Q
Sbjct  180  DGTSPGLDMLVNTKHFHFGKNQLSGVIPPQ  209



>ref|XP_009605193.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=948

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 175/208 (84%), Gaps = 2/208 (1%)
 Frame = +2

Query  71   RIQLLL-VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            RIQL+  + +F+Q LG+ A T++ DY  +++LR+ W+NVPP+W+ G+DPCGD W+G+ CN
Sbjct  6    RIQLISWLLIFMQVLGLDALTNSGDYGVLESLREEWENVPPNWS-GTDPCGDPWDGIECN  64

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRVV++ LSSM+L GELSGDIE LSELQILDLSYNKDLTGSLP+ IG+LK L  LILVG
Sbjct  65   NSRVVTIKLSSMNLKGELSGDIEALSELQILDLSYNKDLTGSLPQSIGSLKSLSILILVG  124

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F GLIPD++GSLS+L +LSLNLN F+GPIP S+G LS+LYWLDLADN+L+G +PVS G
Sbjct  125  CRFSGLIPDTVGSLSQLVFLSLNLNNFVGPIPASIGNLSKLYWLDLADNRLSGPLPVSHG  184

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +TPGLDMLV TKHFH G N+ SGEIPAQ
Sbjct  185  STPGLDMLVHTKHFHLGRNQLSGEIPAQ  212



>gb|EYU33238.1| hypothetical protein MIMGU_mgv1a025286mg [Erythranthe guttata]
Length=952

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            MI R+ L L+  FIQ L I A T+ ND+ ++KAL+D W N PP+W  GSDPCGD W+G+ 
Sbjct  1    MIWRVLLSLLVAFIQVLAIAALTNTNDFTSLKALKDTWGNYPPNWI-GSDPCGDVWDGIT  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C   RVVS+TL+S+DL+G+LS DI  L+ELQ LDLSYNK +TG LP +IGN+ KL +LIL
Sbjct  60   CKNDRVVSITLASIDLSGQLSSDIAGLTELQTLDLSYNKRMTGPLPPQIGNVNKLSSLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGFFG IP SIGSL +L+YLSLN N FIG IPPS+G L+ LYWLDLADN+LTG+IPVS
Sbjct  120  VGCGFFGPIPGSIGSLQQLRYLSLNSNNFIGSIPPSIGNLTNLYWLDLADNKLTGTIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            DG +PGLDMLV TKHFHFG N+ SG IP Q
Sbjct  180  DGTSPGLDMLVNTKHFHFGKNQLSGVIPPQ  209



>ref|XP_004230391.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=959

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 172/215 (80%), Gaps = 1/215 (0%)
 Frame = +2

Query  44   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  223
            MV+   MIPRI L  + + I  L I A T+ +D  A+++L+D W+NVPP+W  G+DPCG 
Sbjct  1    MVVSQAMIPRILLCFLFVLIHVLSIAARTNPDDSAALQSLKDSWQNVPPNWV-GADPCGS  59

Query  224  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  403
             W+G+GC  SRVVS+TLSSM L G+LSGDI+ L+EL+ LDLSYNK+L GSLP+ IG L K
Sbjct  60   SWDGIGCRNSRVVSITLSSMSLEGQLSGDIQGLAELETLDLSYNKELKGSLPQSIGKLTK  119

Query  404  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLT  583
            L NLILVGCGF G IPD+IGSL++L +LSLN N FIG IP ++G L+ELYWLDLADN+LT
Sbjct  120  LSNLILVGCGFSGPIPDTIGSLTRLVFLSLNSNNFIGGIPATVGYLTELYWLDLADNKLT  179

Query  584  GSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA  688
            G+IPVS+G++PGLD+LV TKHFHFG N+ SGEIPA
Sbjct  180  GTIPVSNGSSPGLDLLVHTKHFHFGKNQLSGEIPA  214



>ref|XP_006358482.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=959

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 170/215 (79%), Gaps = 1/215 (0%)
 Frame = +2

Query  44   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  223
            MV+   MI RI L  + + I  L I A T+ +D  A+++L+D W+NVPP+W  G+DPCG 
Sbjct  1    MVVSRAMIRRILLCFLFVLIHVLSIAARTNPDDSAALQSLKDSWQNVPPNWV-GADPCGS  59

Query  224  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  403
             W+G+GC  SRVVS+TLSSM L G+LSGDI+ L+EL+ LDLSYNK+L GSLP+ IG L K
Sbjct  60   SWDGIGCRNSRVVSITLSSMSLEGQLSGDIQGLAELETLDLSYNKELKGSLPQSIGKLTK  119

Query  404  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLT  583
            L NLILVGCGF G IPD+IGSL++L +LSLN N FIG IP ++G L+EL+WLDLADN+LT
Sbjct  120  LSNLILVGCGFSGPIPDTIGSLTRLVFLSLNSNNFIGGIPATIGNLTELHWLDLADNKLT  179

Query  584  GSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA  688
            G+IPVS+G+ PGLDMLV TKHFHFG N+ SGEIPA
Sbjct  180  GTIPVSNGSNPGLDMLVHTKHFHFGKNQLSGEIPA  214



>emb|CDO97682.1| unnamed protein product [Coffea canephora]
Length=953

 Score =   257 bits (657),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  RIQ  L+ +F+Q L + A T+  D+ A+++L+ GW+N PP+WA G+DPCG  W G+G
Sbjct  1    MFARIQPYLLVIFVQVLVVAAITNPQDFAALQSLKSGWENAPPNWA-GTDPCGSGWIGIG  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C+ SRVVS+TL+S+ L+G++ GDI +LSEL  LDLSYN+ LTGSLPR IGNL KL +LIL
Sbjct  60   CSNSRVVSITLASVGLSGQVPGDIADLSELLTLDLSYNEGLTGSLPRTIGNLAKLTSLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF G IPD+IGS+ +L  LSLN NKFIG IPPS+G L +L+WLDLADN+L+GSIPVS
Sbjct  120  VGCGFSGQIPDTIGSMKQLYTLSLNSNKFIGQIPPSIGALPKLHWLDLADNKLSGSIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +G  PGLDMLV T+HFHFG N+ SGEIP+Q
Sbjct  180  NGTAPGLDMLVQTQHFHFGKNQLSGEIPSQ  209



>ref|XP_009803111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=948

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 170/208 (82%), Gaps = 2/208 (1%)
 Frame = +2

Query  71   RIQLLL-VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            RIQL+  + + +Q L + A T+  DY  +++L++ W+NVPPSW  G+DPCGD WEG+ CN
Sbjct  7    RIQLITWLVISMQVLVLQALTNPGDYGVLESLKEEWENVPPSW-RGTDPCGDPWEGIECN  65

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRVV++ LSSM+L G+LSGDIE LSELQILDLSYNK LTGSLP+ IG+LK L  LILVG
Sbjct  66   NSRVVTIKLSSMNLKGQLSGDIEALSELQILDLSYNKGLTGSLPQSIGSLKSLSILILVG  125

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF GLIPD++GSLS+L +LSLN+N FIGPIP S+G LS+LYWLDLADN+L+G +PVS G
Sbjct  126  CGFNGLIPDTVGSLSQLVFLSLNVNNFIGPIPASIGNLSKLYWLDLADNRLSGPLPVSHG  185

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +TPGLDMLV TKHFH G N  SGEIPAQ
Sbjct  186  STPGLDMLVHTKHFHLGGNLLSGEIPAQ  213



>ref|XP_007023745.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY26367.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma 
cacao]
Length=758

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  83   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  262
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  263  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  442
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  443  LIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL  622
             IPD+IGSLS+L++LSLN N F G IPPS+G LS LYWLDLADNQL G IPVS G+TPGL
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPVSSGSTPGL  186

Query  623  DMLVGTKHFHFGXNKFSGEIPAQ  691
            DML+ TKHFHFG NK SG+IPAQ
Sbjct  187  DMLIHTKHFHFGKNKLSGQIPAQ  209



>gb|EYU33237.1| hypothetical protein MIMGU_mgv1a000884mg [Erythranthe guttata]
Length=951

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            MI RI L L+  FIQ L I A T++ND+ A+KAL+D W NVPP+W  GSDPCGD W+G+ 
Sbjct  1    MIWRIVLSLLLAFIQALAIGASTNSNDHAALKALKDTWTNVPPNWV-GSDPCGDVWDGIT  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C   RVVS+TL+S++L G+LS DI  L+ELQ LDLSYNK +TGSLP  IG++KKL +LIL
Sbjct  60   CKNDRVVSITLASINLIGQLSSDISGLTELQTLDLSYNKGMTGSLPSGIGDVKKLSSLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF G IP SIGSL +L+YLSLN N FIG IPPS+G L  LYWLDLADN+LTG+IPVS
Sbjct  120  VGCGFSGPIPPSIGSLLQLRYLSLNSNNFIGSIPPSIGNLLNLYWLDLADNKLTGTIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            DG +PGLDML+ TKHFHFG N+ SG IP Q
Sbjct  180  DGTSPGLDMLIHTKHFHFGKNQLSGVIPPQ  209



>ref|XP_007023744.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY26366.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
Length=909

 Score =   254 bits (649),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  83   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  262
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  263  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  442
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  443  LIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL  622
             IPD+IGSLS+L++LSLN N F G IPPS+G LS LYWLDLADNQL G IPVS G+TPGL
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPVSSGSTPGL  186

Query  623  DMLVGTKHFHFGXNKFSGEIPAQ  691
            DML+ TKHFHFG NK SG+IPAQ
Sbjct  187  DMLIHTKHFHFGKNKLSGQIPAQ  209



>ref|XP_009784887.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nicotiana sylvestris]
Length=625

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +2

Query  146  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  325
             A+++L+D W+NVPP+WA G+DPCG  WEG+GC  SRV+S+TLSSM L+G+LSGDI+ LS
Sbjct  8    AALQSLKDSWQNVPPNWA-GADPCGSQWEGIGCRNSRVISITLSSMSLSGQLSGDIQGLS  66

Query  326  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  505
            ELQ LDLSYNK+LTGSLP+ IG L KL NLILVGCGF G IPDSIGSL++L +LSLN N 
Sbjct  67   ELQTLDLSYNKELTGSLPQSIGKLTKLSNLILVGCGFSGPIPDSIGSLTQLVFLSLNSNN  126

Query  506  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            FIG IP ++G LS+LYWLDLADN+LTG++PVS G++PGLDML+ TKHFHFG N+ SGEIP
Sbjct  127  FIGRIPATIGYLSKLYWLDLADNKLTGTLPVSSGSSPGLDMLLHTKHFHFGKNQLSGEIP  186

Query  686  AQ  691
            A+
Sbjct  187  AR  188



>ref|XP_007023743.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY26365.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=955

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  83   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  262
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  263  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  442
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  443  LIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL  622
             IPD+IGSLS+L++LSLN N F G IPPS+G LS LYWLDLADNQL G IPVS G+TPGL
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPVSSGSTPGL  186

Query  623  DMLVGTKHFHFGXNKFSGEIPAQ  691
            DML+ TKHFHFG NK SG+IPAQ
Sbjct  187  DMLIHTKHFHFGKNKLSGQIPAQ  209



>ref|XP_004230392.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=951

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 172/210 (82%), Gaps = 5/210 (2%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIV----AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            +QL++  L I  + ++    A TD+ DYV +++L++ W+NVPP+W +GSDPC D WEG+ 
Sbjct  7    VQLIIFCLLIISMQVLIQLEASTDSGDYVVLESLKEEWENVPPTW-DGSDPCDDPWEGID  65

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            CN SRV+S+ LSS++L GELSGDIE LSELQILDLSYNK LTGSLP+ IGNLK L  LIL
Sbjct  66   CNNSRVISIKLSSINLKGELSGDIEGLSELQILDLSYNKGLTGSLPQSIGNLKSLSILIL  125

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF GLIP++IGSLS+L++LSLNLN FIGPIP S+G LS+L WLDLADN+L+G +P+S
Sbjct  126  VGCGFSGLIPNTIGSLSQLEFLSLNLNNFIGPIPASVGNLSKLRWLDLADNKLSGPLPIS  185

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             G+TPGLDMLV TKHFH G N+FSGEIP Q
Sbjct  186  RGSTPGLDMLVHTKHFHLGRNQFSGEIPDQ  215



>ref|XP_011092239.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Sesamum indicum]
Length=953

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  RI L L+   +Q  GI A+T  +D+VA+K+L+D W+NVPP+W +G DPCG +W+G+ 
Sbjct  2    MCWRIHLCLLVALVQVFGIAAWTYTDDFVALKSLKDEWENVPPNW-DGDDPCGHNWDGIS  60

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C+ +RV+S+TL+S++L+G LS DI+ LS L+ LDLSYNK +TG LP  IGNL++L +LIL
Sbjct  61   CSDTRVISITLASINLSGHLSSDIKGLSALETLDLSYNKGMTGPLPSSIGNLQELSSLIL  120

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF G IP SIGSL +L YLSLN NKF+G IPPS+G LS LYWLDLADN+L+G+IPVS
Sbjct  121  VGCGFSGPIPSSIGSLQQLVYLSLNSNKFVGEIPPSIGNLSNLYWLDLADNKLSGTIPVS  180

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             G+TPGLDMLV TKHFHFG N+ SGEIP+Q
Sbjct  181  KGSTPGLDMLVHTKHFHFGNNQLSGEIPSQ  210



>gb|EPS63997.1| hypothetical protein M569_10784, partial [Genlisea aurea]
Length=390

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = +2

Query  95   LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  274
            + I++  + A+T+ ND+ A+ AL+  W NVPP+W+ GSDPCG  W+G+ C  +RVVS+TL
Sbjct  7    IVIEYFVVTAWTNPNDFAALLALKSTWNNVPPNWS-GSDPCGSGWDGISCINNRVVSITL  65

Query  275  SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  454
            +S++L G+LS DI  LSELQILDLSYN  +TG LP  IGNL KL +LILVGCGF G+IP 
Sbjct  66   ASINLNGQLSSDITALSELQILDLSYNPGMTGPLPTTIGNLVKLTSLILVGCGFSGVIPS  125

Query  455  SIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV  634
            SIGSL +L YLSLN N FIG IPPS+G LS LYWLDLADN+L+GSIPVS G+ PGLDML 
Sbjct  126  SIGSLQQLVYLSLNSNNFIGEIPPSVGMLSNLYWLDLADNKLSGSIPVSSGSIPGLDMLA  185

Query  635  GTKHFHFGXNKFSGEIP  685
             TKHFHFG N+ SG+IP
Sbjct  186  NTKHFHFGNNQLSGQIP  202



>gb|KHG19770.1| hypothetical protein F383_03980 [Gossypium arboreum]
Length=826

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            I +LL+   +Q     A TD  DY A+++L D W+N+PPSW  G+DPCGD W G+ C GS
Sbjct  5    IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPSWT-GADPCGDSWVGIECTGS  63

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTGSLP  IGNLKKL NLILVGCG
Sbjct  64   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGSLPGSIGNLKKLKNLILVGCG  123

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  124  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  183

Query  614  PGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PGLD+L+ TKHFHFG NK SG IP++
Sbjct  184  PGLDLLIHTKHFHFGKNKLSGTIPSK  209



>gb|AES64685.2| LRR receptor-like kinase [Medicago truncatula]
Length=954

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            +V  T N+DY+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G
Sbjct  20   VVTKTSNDDYLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LS +I  LSELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +
Sbjct  80   QLSSEIGSLSELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQR  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +LSLN N+F G IPPS+G LS + WLDLA+NQL G IPVS+G TPGLDML  TKHFHF
Sbjct  140  LVFLSLNSNRFSGRIPPSIGNLSNINWLDLAENQLEGPIPVSNGTTPGLDMLHKTKHFHF  199

Query  656  GXNKFSGEIPAQ  691
            G NK SG IP Q
Sbjct  200  GKNKLSGNIPPQ  211



>gb|KJB68018.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=710

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  192

Query  614  PGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PGLD+L+ TKHFHFG NK SG IP++
Sbjct  193  PGLDLLIHTKHFHFGKNKLSGTIPSK  218



>gb|KJB68015.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
 gb|KJB68017.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=736

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  192

Query  614  PGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PGLD+L+ TKHFHFG NK SG IP++
Sbjct  193  PGLDLLIHTKHFHFGKNKLSGTIPSK  218



>gb|KJB68014.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=947

 Score =   246 bits (628),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  192

Query  614  PGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PGLD+L+ TKHFHFG NK SG IP++
Sbjct  193  PGLDLLIHTKHFHFGKNKLSGTIPSK  218



>ref|XP_006431373.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
 gb|ESR44613.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
Length=955

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 2/208 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  247
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRV S+TLS M L G+LSGDI  L+EL  LDLS NKDL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNKDLRGPLPTTIGNLKKLSNLMLVG  122

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F G IPDSIGSL +L  LSLN N F G +PPS+G LS LYWLDL DN+L G IPVSDG
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRVPPSIGNLSNLYWLDLTDNKLEGEIPVSDG  182

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            N+PGLDMLV  KHFHFG N+ SG IP +
Sbjct  183  NSPGLDMLVRAKHFHFGKNQLSGSIPEK  210



>gb|KDO40686.1| hypothetical protein CISIN_1g002189mg [Citrus sinensis]
Length=955

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 2/208 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  247
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRV S+TLS M L G+LSGDI  L+EL  LDLS NKDL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNKDLRGPLPTTIGNLKKLSNLMLVG  122

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F G IPDSIGSL +L  LSLN N F G +PPS+G LS LYWLDL DN+L G IPVSDG
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRVPPSIGNLSNLYWLDLTDNKLEGEIPVSDG  182

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            N+PGLDMLV  KHFHFG N+ SG IP +
Sbjct  183  NSPGLDMLVRAKHFHFGKNQLSGSIPEK  210



>ref|XP_011028448.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=888

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPPSW  GSDPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDIWENVPPSWV-GSDPCGSRWDGIL  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IG+LKKL +LIL
Sbjct  60   CTNSRVTSITLASMGLKGTLSGDISNLSELQILDLSYNPELSGPLPPAIGDLKKLTSLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            V C F G IPD+IGSL +L YLSLN N F G IPPSLG L +LYWLDLADN+LTG+IPVS
Sbjct  120  VSCRFSGPIPDTIGSLPQLTYLSLNSNGFTGSIPPSLGNLDKLYWLDLADNRLTGNIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             G TPGLD+LV TKHFHFG N+ SG IP +
Sbjct  180  TGTTPGLDLLVHTKHFHFGFNQLSGHIPPK  209



>ref|XP_011028446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Populus euphratica]
Length=958

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPPSW  GSDPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDIWENVPPSWV-GSDPCGSRWDGIL  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IG+LKKL +LIL
Sbjct  60   CTNSRVTSITLASMGLKGTLSGDISNLSELQILDLSYNPELSGPLPPAIGDLKKLTSLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            V C F G IPD+IGSL +L YLSLN N F G IPPSLG L +LYWLDLADN+LTG+IPVS
Sbjct  120  VSCRFSGPIPDTIGSLPQLTYLSLNSNGFTGSIPPSLGNLDKLYWLDLADNRLTGNIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             G TPGLD+LV TKHFHFG N+ SG IP +
Sbjct  180  TGTTPGLDLLVHTKHFHFGFNQLSGHIPPK  209



>ref|XP_010252241.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=955

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  +IQ  L+ +  Q     A T++ND  A+ ++R  WKN P +W EGSDPCG  W G+ 
Sbjct  1    MDKKIQACLLVVLFQISFSGAQTNSNDVAALNSIRLLWKNTPSNW-EGSDPCGGGWVGIT  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            CN SRVVS+TLSSM L G+LSGDI+ LSELQ LDLSYNK L GSLP  IG+L KL NLIL
Sbjct  60   CNNSRVVSITLSSMGLKGQLSGDIQSLSELQALDLSYNKGLNGSLPVSIGSLTKLSNLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGC F G IPD+IGSL +L +LSLN N F G IPPS+G LS+LYWLDLADN+LTG+IPVS
Sbjct  120  VGCSFSGPIPDTIGSLKQLAFLSLNSNSFTGEIPPSIGNLSKLYWLDLADNKLTGTIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +G+TPGLDML+ TKHFHFG N+ SG IP Q
Sbjct  180  NGSTPGLDMLIHTKHFHFGKNQLSGTIPPQ  209



>ref|XP_002519381.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF42998.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=960

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 156/207 (75%), Gaps = 1/207 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            RI L L+ + +Q   I A T+  D  A+ AL+D W+N PPSW +G+DPCGD WEG+ C  
Sbjct  11   RILLFLLFVSLQICNIAAVTNTADSSALNALKDIWQNTPPSW-KGADPCGDKWEGIECTN  69

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
             RV S+TLSS+ +TG+LSGDI  L ELQILDLSYNK L G+LP  IGNLKKL NLILVGC
Sbjct  70   LRVTSITLSSIGITGQLSGDISNLQELQILDLSYNKGLEGTLPESIGNLKKLTNLILVGC  129

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IP+SIGSL +L +LSLN N F G IPPS+G L++LYWLDLADN+L G IPVS G 
Sbjct  130  GFSGPIPNSIGSLQQLVFLSLNSNGFSGGIPPSIGNLAKLYWLDLADNKLEGRIPVSTGT  189

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGL+MLV TKHFHFG N+  G IP +
Sbjct  190  TPGLNMLVNTKHFHFGKNRLGGTIPPE  216



>ref|XP_006470792.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Citrus sinensis]
Length=955

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 2/208 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  247
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRV S+TLS M L G+LSGDI  L+EL  LDLS N DL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNNDLRGPLPTTIGNLKKLSNLMLVG  122

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F G IPDSIGSL +L  LSLN N F G IPPS+G LS+LYWLDL DN+L G IPVSDG
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRIPPSIGNLSKLYWLDLTDNKLEGEIPVSDG  182

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            N+PGLDMLV  KHFHFG N+ SG IP +
Sbjct  183  NSPGLDMLVRAKHFHFGKNQLSGSIPEK  210



>ref|XP_006385116.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|ERP62913.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=958

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 157/210 (75%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPP+W  G+DPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDVWENVPPTWV-GADPCGSRWDGIL  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IGNLK L +LIL
Sbjct  60   CTNSRVTSITLASMRLKGTLSGDISNLSELQILDLSYNTELSGPLPPAIGNLKMLTSLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGC F G +PDSIGSL +L YLSLN N F G IPPSLG L  LYWLDLADN+LTG+IPVS
Sbjct  120  VGCRFSGPVPDSIGSLPRLTYLSLNSNGFTGTIPPSLGNLDNLYWLDLADNRLTGTIPVS  179

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
               TPGLD+LV TKHFHFG N+ SG+IP +
Sbjct  180  TETTPGLDLLVHTKHFHFGFNQLSGQIPPK  209



>ref|XP_006358480.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=960

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 164/216 (76%), Gaps = 2/216 (1%)
 Frame = +2

Query  44   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  223
            MV+   M+ RI +  + + IQ L + A T+  D  A+K+L+D W   P +W  G DPCG 
Sbjct  1    MVVSMAMMLRIFVSFLVVLIQVLSVAARTNPVDSAALKSLKDSWYG-PSNWT-GEDPCGS  58

Query  224  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  403
             WEGVGC  SRV+S+TLSSMDL G+LSGD++ LSEL+ LDLSYNKDLTG L + IG L K
Sbjct  59   SWEGVGCRNSRVISITLSSMDLNGQLSGDVQGLSELETLDLSYNKDLTGYLSQSIGKLTK  118

Query  404  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLT  583
            L NLILVGCGF G IPDSIGSL++L +LSLN NKF G IP ++G L+ELYWLDL+DNQ+ 
Sbjct  119  LSNLILVGCGFSGPIPDSIGSLTQLFFLSLNSNKFTGGIPATIGYLTELYWLDLSDNQIE  178

Query  584  GSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            G+IPVS G+ PGLDMLV TKHFHFG N+ SGEIPA+
Sbjct  179  GNIPVSSGSNPGLDMLVNTKHFHFGKNQLSGEIPAR  214



>gb|KCW62551.1| hypothetical protein EUGRSUZ_G00043, partial [Eucalyptus grandis]
Length=945

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AIK L   W+N PP+W  G DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIKGLMSDWQNTPPNWV-GIDPCGNGWDGIGCKNSRITSITLSSMGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
             GDI +LSELQILDLSYNKDLTGSLP +IGNL KL NL+LVGCG +G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNKDLTGSLPVQIGNLVKLTNLLLVGCGLYGPIPDSIGSLQNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N F G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDML+ TKHFHFG 
Sbjct  140  FLSLNSNGFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDMLLHTKHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  200  NRLSGTIPSQ  209



>ref|XP_010065204.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   244 bits (623),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AIK L   W+N PP+W  G DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIKGLMSDWQNTPPNWV-GIDPCGNGWDGIGCKNSRITSITLSSMGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
             GDI +LSELQILDLSYNKDLTGSLP +IGNL KL NL+LVGCG +G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNKDLTGSLPVQIGNLVKLTNLLLVGCGLYGPIPDSIGSLQNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N F G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDML+ TKHFHFG 
Sbjct  140  FLSLNSNGFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDMLLHTKHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  200  NRLSGTIPSQ  209



>ref|XP_006358481.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=947

 Score =   244 bits (623),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 169/210 (80%), Gaps = 9/210 (4%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIV----AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            IQL++  L I  + ++    A T++ DYV ++ L++ W+N+PPSW +GSDPC D WEG+ 
Sbjct  7    IQLIIFCLLIISMQVLVQLGASTNSGDYVVLEPLKEEWENIPPSW-DGSDPCNDPWEGID  65

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            CN SRV+S+ LSS++L GELSGDIE LSELQILDLSYNK LTGSLP+ IGNLK L  LIL
Sbjct  66   CNNSRVISIKLSSINLKGELSGDIEGLSELQILDLSYNKGLTGSLPQSIGNLKSLSILIL  125

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF GLIP++IGSLS+L+YLSLNLN FIGPIP S+G LS+L+WLDLADN+L+G +PVS
Sbjct  126  VGCGFSGLIPNTIGSLSQLEYLSLNLNNFIGPIPASVGNLSKLHWLDLADNKLSGPLPVS  185

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
                PGLDMLV TKHFH G N+FSGEIP Q
Sbjct  186  ----PGLDMLVHTKHFHLGGNQFSGEIPDQ  211



>ref|XP_010657900.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Vitis vinifera]
Length=980

 Score =   243 bits (621),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 162/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  77   QLLLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            +L+LV L I F+ I A    T+ +D  A+ AL+D W+N PPSW  G DPCG  WEG+GC 
Sbjct  4    RLILVSLLIVFIQISATWARTNTDDATALVALKDLWENYPPSWV-GFDPCGSSWEGIGCY  62

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
              RV+S+ L+SM L G LSGD+++LSELQILDLSYNK+LTG++P  IG+LKKL NLILVG
Sbjct  63   NQRVISIILTSMGLKGGLSGDLDQLSELQILDLSYNKNLTGNIPASIGSLKKLTNLILVG  122

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F G IPD+IGSL++L +LSLN N F G IPPS+G LS+LYWLDLADNQLTG+IP+S+G
Sbjct  123  CSFSGPIPDTIGSLTELVFLSLNSNSFSGGIPPSIGNLSKLYWLDLADNQLTGTIPISNG  182

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +TPGLD L  TKHFHFG N+ SG IP +
Sbjct  183  STPGLDKLTHTKHFHFGKNRLSGSIPPK  210



>ref|XP_010521415.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=957

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 160/210 (76%), Gaps = 4/210 (2%)
 Frame = +2

Query  71   RIQLLLVPLF---IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            R++ LL+ L    +Q   + + T++ D   +KAL + WKN PP+W +GSDPCG  W G+ 
Sbjct  6    RVRTLLLVLMMASVQICSVTSQTNSGDSAGLKALMNEWKNFPPNW-KGSDPCGSGWVGIS  64

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C   RV S++L++M+L G LSGDI  LSELQILDLSYN  LTG+LP  IG LKKL NLIL
Sbjct  65   CTNGRVTSISLANMNLKGTLSGDISALSELQILDLSYNLGLTGTLPSAIGQLKKLKNLIL  124

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF G IP+SIGSLS+L YLSLN N+F G IPPSLGQLS+LYW D+ADN++ GSIPVS
Sbjct  125  VGCGFAGPIPESIGSLSQLVYLSLNSNQFSGRIPPSLGQLSDLYWFDIADNRIEGSIPVS  184

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            DG +PGLDMLV TKHFHFG NK SGEIP +
Sbjct  185  DGTSPGLDMLVNTKHFHFGQNKLSGEIPEK  214



>gb|KJB68016.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=943

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IP +IG        SLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIG----SLPQSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  188

Query  614  PGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PGLD+L+ TKHFHFG NK SG IP++
Sbjct  189  PGLDLLIHTKHFHFGKNKLSGTIPSK  214



>ref|XP_004486417.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=953

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = +2

Query  71   RIQLLLVPLF-IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            R+ + L  LF   F+ +V  T N DY+A+  L+  WKN PPSW    DPCGDHWEG+ C 
Sbjct  4    RVLVFLHLLFSYLFVVVVTKTSNEDYLALLTLKYEWKNTPPSWEGSEDPCGDHWEGIECI  63

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRV +++L+SMDL+G+LS DI  LSELQIL LSYNK+LTG L  EIGNLKKL NL L+ 
Sbjct  64   NSRVTTISLASMDLSGQLSADIGLLSELQILVLSYNKNLTGPLHAEIGNLKKLTNLQLIN  123

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF G IPD+IG+L +L +LSLN N+F G IPP++G LS +YWLDLA+NQL G IP+S+G
Sbjct  124  CGFIGPIPDTIGNLQRLVFLSLNSNRFSGKIPPAIGNLSSIYWLDLAENQLEGRIPISNG  183

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             TPGLDML  TKHFHFG NK SG IP Q
Sbjct  184  TTPGLDMLHKTKHFHFGRNKLSGNIPPQ  211



>ref|XP_002303227.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa]
 gb|EEE78206.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa]
Length=374

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 146/197 (74%), Gaps = 1/197 (1%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M PRI + LV    Q   I A TD  D+ A+KAL+D WKNVPP+W  G+DPCG  WEG+ 
Sbjct  1    MGPRILVFLVVALSQGCTIPAMTDEADFTALKALKDIWKNVPPTWV-GADPCGSRWEGIL  59

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  SRV S+TL+SM L G LSGDI+ LSELQILDLSYNK L+G LP  IG+LKKL NLIL
Sbjct  60   CANSRVTSITLASMGLKGSLSGDIQSLSELQILDLSYNKGLSGPLPSAIGDLKKLTNLIL  119

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGC F+G IPDSIGSL  L  LSLN N F G IP S+G L+ LYWLDLADN+LTG+IPVS
Sbjct  120  VGCSFWGPIPDSIGSLPLLASLSLNSNGFTGSIPSSIGNLTSLYWLDLADNRLTGTIPVS  179

Query  602  DGNTPGLDMLVGTKHFH  652
               TPGLD+LV TKH +
Sbjct  180  TATTPGLDLLVHTKHLY  196



>gb|KEH37006.1| LRR receptor-like kinase [Medicago truncatula]
Length=942

 Score =   240 bits (613),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +2

Query  143  YVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEEL  322
            Y+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G+LS +I  L
Sbjct  17   YLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSGQLSSEIGSL  76

Query  323  SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnln  502
            SELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +L +LSLN N
Sbjct  77   SELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQRLVFLSLNSN  136

Query  503  kFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI  682
            +F G IPPS+G LS + WLDLA+NQL G IPVS+G TPGLDML  TKHFHFG NK SG I
Sbjct  137  RFSGRIPPSIGNLSNINWLDLAENQLEGPIPVSNGTTPGLDMLHKTKHFHFGKNKLSGNI  196

Query  683  PAQ  691
            P Q
Sbjct  197  PPQ  199



>ref|XP_010682082.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=966

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = +2

Query  59   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            +M  +I   L+ + +Q   I + TD+ND VA+ +L+  W+NVPPSW    DPCG+HWEG+
Sbjct  19   SMSLKIAFCLLLICVQLSYITSDTDSNDAVALSSLKALWENVPPSWNGFLDPCGNHWEGI  78

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
             CN SRV+S+TLSSM L G+LSGDI++LSELQ LDLSYNK LT SLP  IG L KL NLI
Sbjct  79   VCNNSRVISITLSSMQLEGKLSGDIQQLSELQTLDLSYNKGLTSSLPEAIGKLAKLTNLI  138

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            L+ C F G IPDSIGSLS+L++LSLN N F G IP S+G LS+LYWLDLA+N+LTG++PV
Sbjct  139  LIDCNFIGKIPDSIGSLSELRFLSLNSNGFSGTIPRSIGSLSKLYWLDLAENKLTGTLPV  198

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            S+G  PGLD+L   KHFHFG N+ SG IP +
Sbjct  199  SNGTEPGLDLLHDCKHFHFGRNQLSGSIPPR  229



>ref|XP_010065205.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AI+ L   W++ PP+W  G+DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIEGLMSYWQHTPPNWV-GTDPCGNGWDGIGCTNSRITSITLSSMGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
             GDI +LSEL+ILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   PGDIVQLSELRILDLSYNRGLTGSLPAQIGNLMKLTNLILVGCGFSGQIPDSIGSLQNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDML+ TKHFHFG 
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDMLLHTKHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  200  NQLSGTIPSQ  209



>ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
 gb|ERP62909.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
Length=959

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 158/211 (75%), Gaps = 2/211 (1%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            M  RI + LV   IQ      A T+N+D+ A+KAL+D W NVPP+W  G+DPCG  W+G+
Sbjct  1    MGSRILVFLVVALIQVCTTTPAVTNNDDFNALKALKDVWDNVPPTWV-GADPCGSRWDGI  59

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
             C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +LTGSLP  IG+LKKL NLI
Sbjct  60   VCTNSRVTSITLASMGLKGTLSGDISLLSELQILDLSYNTELTGSLPLAIGDLKKLTNLI  119

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            LV C F G IPD+IGSLS+L  LSLN N+F G IPPSLG L +L+WLDLADN LTG+IPV
Sbjct  120  LVRCRFSGPIPDAIGSLSQLTDLSLNSNRFSGSIPPSLGNLDKLFWLDLADNMLTGTIPV  179

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            S G TPGLD+LV TKHFH G N+ +G+IP +
Sbjct  180  STGTTPGLDLLVHTKHFHLGFNQLTGQIPPK  210



>emb|CBI29612.3| unnamed protein product [Vitis vinifera]
Length=2030

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 162/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  77   QLLLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            +L+LV L I F+ I A    T+ +D  A+ AL+D W+N PPSW  G DPCG  WEG+GC 
Sbjct  4    RLILVSLLIVFIQISATWARTNTDDATALVALKDLWENYPPSWV-GFDPCGSSWEGIGCY  62

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
              RV+S+ L+SM L G LSGD+++LSELQILDLSYNK+LTG++P  IG+LKKL NLILVG
Sbjct  63   NQRVISIILTSMGLKGGLSGDLDQLSELQILDLSYNKNLTGNIPASIGSLKKLTNLILVG  122

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F G IPD+IGSL++L +LSLN N F G IPPS+G LS+LYWLDLADNQLTG+IP+S+G
Sbjct  123  CSFSGPIPDTIGSLTELVFLSLNSNSFSGGIPPSIGNLSKLYWLDLADNQLTGTIPISNG  182

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +TPGLD L  TKHFHFG N+ SG IP +
Sbjct  183  STPGLDKLTHTKHFHFGKNRLSGSIPPK  210


 Score =   208 bits (530),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = +2

Query  95    LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  274
             LF   L +    D  D  A  AL+   KN+P +W  G+DPC + WEG+GC+  RV+S+TL
Sbjct  1099  LFESSLSLAHIYDFGD--ATTALKSLLKNLPFTWV-GADPCVNGWEGIGCSNGRVISITL  1155

Query  275   SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  454
             +SMDL GELS D + LSEL+ILDLSYNK LTG++P  IG+LK L NLIL+GC F G IPD
Sbjct  1156  ASMDLKGELSEDFQGLSELKILDLSYNKGLTGNIPASIGSLKSLTNLILMGCSFSGQIPD  1215

Query  455   SIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV  634
             +IGSL+ L  LSLN N F G IPPS+G L  L WLD+ +NQ+TG+IP+S+G TPGLDML 
Sbjct  1216  TIGSLTNLVVLSLNSNSFSGVIPPSIGNLYNLNWLDITENQITGTIPISNGGTPGLDMLT  1275

Query  635   GTKHFHFGXNKFSGEIPAQ  691
               KHFHFG N+ SG IP Q
Sbjct  1276  QMKHFHFGKNRLSGPIPPQ  1294



>gb|KCW62549.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=940

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+  GLDML+ TKHFHFG 
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNFGLDMLLHTKHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  200  NQLSGTIPSQ  209



>ref|XP_010067941.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=947

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+  GLDML+ TKHFHFG 
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNFGLDMLLHTKHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  200  NQLSGTIPSQ  209



>gb|KCW62550.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=933

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+  GLDML+ TKHFHFG 
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNFGLDMLLHTKHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  200  NQLSGTIPSQ  209



>ref|XP_011088111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=952

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  298
             A+TD  D+ A+++L+D W NVPP+W+ G+DPCGD W G+ C  +RVVS+TL+S++L+G+
Sbjct  20   AAWTDPYDFAALRSLKDIWDNVPPNWS-GADPCGDGWSGISCINNRVVSITLASINLSGQ  78

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            LS DI +L+ELQ LDLSYN+ +TG LP  IGN  KL +LILVGCGF G IP SIGSL +L
Sbjct  79   LSSDIAKLAELQTLDLSYNEGMTGPLPSAIGNFPKLTSLILVGCGFSGQIPPSIGSLQQL  138

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG  658
             YLSLN NKF+G IPP++G LS LYWLDLADN+L+G IPVSDG+TPGLDMLV TKHFHFG
Sbjct  139  VYLSLNSNKFVGEIPPTIGNLSNLYWLDLADNKLSGKIPVSDGSTPGLDMLVKTKHFHFG  198

Query  659  XNKFSGEIP  685
             N+ SGEIP
Sbjct  199  NNQLSGEIP  207



>ref|XP_010682075.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=959

 Score =   238 bits (606),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            RI L +  + I+   I A T++ D  A+ AL  GW+N+PP+W  G DPCG+ WEG+ CN 
Sbjct  12   RIGLFVAFICIKIGDIAAQTNSQDSSALVALTSGWRNLPPNWT-GRDPCGNRWEGITCND  70

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SR+ ++TL++M LTG+L+GD+  LSELQILDLSYN+ LTG LP+ IG L +L +LIL+GC
Sbjct  71   SRITAITLANMGLTGQLTGDLASLSELQILDLSYNRGLTGPLPQSIGRLSRLTSLILIGC  130

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPDSIGSL  +  LSLN N F GP+P ++G +  LYWLDLADNQL+GSIPVS G+
Sbjct  131  GFSGRIPDSIGSLELVDNLSLNENNFTGPVPATIGNMLNLYWLDLADNQLSGSIPVSSGD  190

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIP  685
            TPGLD+LV TKHFHFG N+ +G IP
Sbjct  191  TPGLDLLVDTKHFHFGKNQLTGTIP  215



>ref|XP_010682077.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=954

 Score =   238 bits (606),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M+ RI L L  + I   G  A T N D VA+KAL +  K++P SW  G DPCG  WEG+ 
Sbjct  2    MLLRILLSLAFICIHVWGTTAQT-NEDGVALKALIEDRKSLPESWT-GEDPCGSRWEGIT  59

Query  242  CNGSRVVSLTLSSMDLTGELS-GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
            CN SR++++TL+SM LTG+LS GD+  LSELQ LDLSYNK  TGSLP  IG+L KL +LI
Sbjct  60   CNNSRIITITLASMGLTGQLSTGDLTSLSELQTLDLSYNKGFTGSLPSNIGDLSKLTSLI  119

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            LVGCGF G IPDS+GSL KL  LSLN N FIG +P S+G L  LYWLDL+DNQLTGSIPV
Sbjct  120  LVGCGFSGRIPDSVGSLKKLITLSLNSNSFIGEVPASIGNLKHLYWLDLSDNQLTGSIPV  179

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            SDG+ PGLD+LV TKHFHFG N+ SGEIP
Sbjct  180  SDGSKPGLDLLVNTKHFHFGMNQLSGEIP  208



>ref|XP_010533231.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=954

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = +2

Query  98   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  277
            F++   + + TD+ D   +KAL DGWKN PP+W +GSDPCG +W G+ C   RV S+ LS
Sbjct  16   FVEICSVASQTDSRDSAGLKALMDGWKNFPPNW-QGSDPCGANWVGISCTNGRVTSIALS  74

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +MDL G L GDI  LSELQILDLSYN  L G+L   IG LKKL NLILVGC F G IPD+
Sbjct  75   NMDLEGTLPGDISALSELQILDLSYNPSLAGTLSPGIGQLKKLKNLILVGCSFTGAIPDA  134

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG  637
            IGSL++L YLSLN N+F G IP +LGQLS LYW D+ADNQ+ GSIPVSDG +PGLDML+ 
Sbjct  135  IGSLTQLVYLSLNSNQFSGRIPATLGQLSNLYWFDIADNQIEGSIPVSDGTSPGLDMLIH  194

Query  638  TKHFHFGXNKFSGEIPAQ  691
            TKHFHFG N+ SGEIP +
Sbjct  195  TKHFHFGQNRLSGEIPEK  212



>ref|XP_011092237.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=943

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            RI   L+ + +Q  G  A T+ +D+VA++AL+D WKN+PPSW +G DPCG+ W+G+ C+ 
Sbjct  5    RILCSLLVVLVQVFGTAARTNTDDFVALEALKDVWKNLPPSW-DGDDPCGNDWDGISCSD  63

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
             RV S++L SM+L G+LS DI++LS L ILDLSYN +L G+LP  IGNLKKL  LILVGC
Sbjct  64   DRVTSISLGSMNLNGQLSSDIQKLSALVILDLSYN-NLNGALPTSIGNLKKLTTLILVGC  122

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            G  G IPDSIGSL +L+ LSLN N F+GPIPPS+G LS+LY LDL DN+L+G+IPVS G+
Sbjct  123  GLSGRIPDSIGSLPELQLLSLNSNNFVGPIPPSIGNLSKLYLLDLTDNKLSGTIPVSKGS  182

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGLDMLV   HFH G N+ SGEIP Q
Sbjct  183  TPGLDMLVSAGHFHLGKNQLSGEIPPQ  209



>ref|XP_010065206.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW62547.1| hypothetical protein EUGRSUZ_G00039 [Eucalyptus grandis]
Length=958

 Score =   236 bits (601),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AIK L   W+N PP+W  G+DPCG  W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFGAIKGLMSDWQNTPPNWV-GTDPCGGDWDGIVCTNSRITSITLSSMGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
             GDI +LSELQILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNRGLTGSLPTQIGNLMKLTNLILVGCGFSGRIPDSIGSLQNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N F G IPP++G LS LYWLDLADNQLTGSIPVS G+  GLDML+ TKHFHFG 
Sbjct  140  FLSLNSNGFSGQIPPTIGNLSRLYWLDLADNQLTGSIPVSKGSEFGLDMLLHTKHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  200  NQLSGTIPSQ  209



>gb|KCW62548.1| hypothetical protein EUGRSUZ_G00040, partial [Eucalyptus grandis]
Length=933

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = +2

Query  149  AIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSE  328
            AI+ L   W++ PP+W  G+DPCG+ W+G+GC  SR+ S+TLSSM LTG L GDI +LSE
Sbjct  22   AIEGLMSYWQHTPPNWV-GTDPCGNGWDGIGCTNSRITSITLSSMGLTGSLPGDIVQLSE  80

Query  329  LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkF  508
            L+ILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L +LSLN N+F
Sbjct  81   LRILDLSYNRGLTGSLPAQIGNLMKLTNLILVGCGFSGQIPDSIGSLQNLVFLSLNSNEF  140

Query  509  IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA  688
             G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDML+ TKHFHFG N+ SG IP+
Sbjct  141  SGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDMLLHTKHFHFGQNQLSGTIPS  200

Query  689  Q  691
            Q
Sbjct  201  Q  201



>ref|XP_011092240.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Sesamum indicum]
Length=934

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = +2

Query  146  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  325
            VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ +RV+S+TL+S++L+G LS DI+ LS
Sbjct  11   VALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSDTRVISITLASINLSGHLSSDIKGLS  69

Query  326  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  505
             L+ LDLSYNK +TG LP  IGNL++L +LILVGCGF G IP SIGSL +L YLSLN NK
Sbjct  70   ALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGCGFSGPIPSSIGSLQQLVYLSLNSNK  129

Query  506  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            F+G IPPS+G LS LYWLDLADN+L+G+IPVS G+TPGLDMLV TKHFHFG N+ SGEIP
Sbjct  130  FVGEIPPSIGNLSNLYWLDLADNKLSGTIPVSKGSTPGLDMLVHTKHFHFGNNQLSGEIP  189

Query  686  AQ  691
            +Q
Sbjct  190  SQ  191



>ref|XP_007023753.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY26375.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=956

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 151/207 (73%), Gaps = 5/207 (2%)
 Frame = +2

Query  83   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  262
            LL+ +FIQ   +   TD  D  A+K+L   W+NVPPSW  G DPCGD W G+ C  SRV 
Sbjct  8    LLLVVFIQIYIVAPTTDFGDSTALKSLVAEWENVPPSWV-GGDPCGDGWVGISCTDSRVT  66

Query  263  SLTLSSMDLTGELSGDIEELSELQ----ILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            S+ L SM+L G LSGDI  LSELQ      DLSYN+ LTGSLP  IGNLK L NLILVGC
Sbjct  67   SIILPSMNLVGRLSGDISTLSELQQTSMFRDLSYNQGLTGSLPASIGNLKNLTNLILVGC  126

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPDSIGSLS+L++LSLN N F G IPPS+G LS L WLDLADN L G IPVS+G+
Sbjct  127  GFNGPIPDSIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLVWLDLADNHLEGPIPVSNGS  186

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGLDML+ TKHFHFG NK SG+IP Q
Sbjct  187  TPGLDMLIHTKHFHFGKNKLSGQIPFQ  213



>emb|CDX83185.1| BnaA03g23210D [Brassica napus]
Length=247

 Score =   218 bits (556),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 153/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  188  GLDMLLETKHFHFGKNKLSGHIP  210



>ref|XP_011092238.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Sesamum indicum]
Length=964

 Score =   232 bits (592),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = +2

Query  146  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  325
            VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ +RV+S+TL+S++L+G LS DI+ LS
Sbjct  41   VALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSDTRVISITLASINLSGHLSSDIKGLS  99

Query  326  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  505
             L+ LDLSYNK +TG LP  IGNL++L +LILVGCGF G IP SIGSL +L YLSLN NK
Sbjct  100  ALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGCGFSGPIPSSIGSLQQLVYLSLNSNK  159

Query  506  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            F+G IPPS+G LS LYWLDLADN+L+G+IPVS G+TPGLDMLV TKHFHFG N+ SGEIP
Sbjct  160  FVGEIPPSIGNLSNLYWLDLADNKLSGTIPVSKGSTPGLDMLVHTKHFHFGNNQLSGEIP  219

Query  686  AQ  691
            +Q
Sbjct  220  SQ  221



>ref|XP_006836951.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
 gb|ERM99804.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
Length=951

 Score =   232 bits (592),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 152/209 (73%), Gaps = 4/209 (2%)
 Frame = +2

Query  68   PRIQLLLVPLFIQFLGIVAFTDNN-DYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  244
            P IQ  ++    Q   I     N  D   + +L++ W+NVPP+W +G DPC + W+G+ C
Sbjct  7    PCIQFFVI--LCQLCAIYGQETNPFDGAVLTSLQNVWQNVPPTW-KGGDPCLNQWDGISC  63

Query  245  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  424
            NGSRV ++ LS+M L G L+GDI  LSELQ LDLSYNKDLTGSLP+ IGNLKKL NLILV
Sbjct  64   NGSRVTAIKLSTMGLKGTLTGDIGSLSELQYLDLSYNKDLTGSLPQSIGNLKKLTNLILV  123

Query  425  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  604
            GC F G IP  IGSL +L +LSLN N F G IPPS+G LS+LYWLDLADNQLTGSIP+S 
Sbjct  124  GCSFSGTIPAQIGSLQELVFLSLNSNGFTGEIPPSIGSLSKLYWLDLADNQLTGSIPIST  183

Query  605  GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
              +PGLDML+GT+HFHF  NK SG IP Q
Sbjct  184  PTSPGLDMLLGTRHFHFNRNKLSGSIPTQ  212


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 37/173 (21%)
 Frame = +2

Query  257  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNK--------------------------  358
            +V L+L+S   TGE+   I  LS+L  LDL+ N+                          
Sbjct  141  LVFLSLNSNGFTGEIPPSIGSLSKLYWLDLADNQLTGSIPISTPTSPGLDMLLGTRHFHF  200

Query  359  ---DLTGSLPREI-GNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPP  526
                L+GS+P ++  +   + +++  G  F G IP SIG ++ L+ L L+ NKF GP+P 
Sbjct  201  NRNKLSGSIPTQLFSSAMTVIHILFDGNNFSGKIPSSIGLVTSLEVLRLDRNKFEGPVPA  260

Query  527  SLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            +L  L+++  L LA N LTG +P    N  G+++L    +     N F    P
Sbjct  261  NLNNLTKIQELSLAQNALTGPLP----NLTGMNVLA---YLDLSNNSFDATEP  306



>gb|KCW62545.1| hypothetical protein EUGRSUZ_G00037, partial [Eucalyptus grandis]
Length=937

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 143/190 (75%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D  A+  L   W+N PP+W  G+DPCGD+W G+ CN SRV S+ LSS  LTG L
Sbjct  21   AATNPYDLSALTGLMTDWQNAPPNWV-GTDPCGDNWVGIRCNNSRVTSIILSSAGLTGSL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI +LSELQILDLSYNK LTGSLP +IGNL KL   ILVGCGFFG IPDSIG L  L 
Sbjct  80   SGDIGQLSELQILDLSYNKGLTGSLPEQIGNLIKLTRWILVGCGFFGQIPDSIGYLQNLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            YL+LN N+F GPIP  +G LS LYWLDLADNQLTGSIP+S+G+ PGLDML+   HFHFG 
Sbjct  140  YLALNSNRFSGPIPAIIGNLSTLYWLDLADNQLTGSIPISNGSNPGLDMLLRAIHFHFGQ  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP Q
Sbjct  200  NQLSGTIPPQ  209



>ref|XP_010088710.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXB36891.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=1000

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 158/210 (75%), Gaps = 5/210 (2%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  ++QL L+ +F +   I A  +N+D++ +K+L   WKN PP+W +GSDPCG  WEG+ 
Sbjct  67   MDQKLQLFLLLVFSKTFFITA--ENSDFLGLKSLE--WKNTPPNW-KGSDPCGSEWEGID  121

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  SRV S+TLSS+ L G+LSG+I++LSEL+ LDLSYNK LTG LP  IGNLKKL NLIL
Sbjct  122  CTNSRVTSITLSSLGLEGQLSGEIDQLSELEALDLSYNKKLTGLLPESIGNLKKLSNLIL  181

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGCGF+G IP +IGSL +L +LSLN N+F G IPP++G LS+LYWLDLADN + G IP+S
Sbjct  182  VGCGFYGQIPGTIGSLQELVFLSLNSNRFTGLIPPAIGNLSKLYWLDLADNNIEGMIPIS  241

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            DG T GLDML   KHFH G NK +G IP +
Sbjct  242  DGKTLGLDMLHHCKHFHLGKNKLTGTIPEE  271



>ref|XP_003594434.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
Length=986

 Score =   230 bits (586),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 151/224 (67%), Gaps = 32/224 (14%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            +V  T N+DY+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G
Sbjct  20   VVTKTSNDDYLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LS +I  LSELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +
Sbjct  80   QLSSEIGSLSELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQR  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF--  649
            L +LSLN N+F G IPPS+G LS + WLDLA+NQL G IPVS+G TPGLDML  TKH   
Sbjct  140  LVFLSLNSNRFSGRIPPSIGNLSNINWLDLAENQLEGPIPVSNGTTPGLDMLHKTKHLYV  199

Query  650  ------------------------------HFGXNKFSGEIPAQ  691
                                          HFG NK SG IP Q
Sbjct  200  MLTFFSFDNIYSNLLHINQTLHNKFPFFYSHFGKNKLSGNIPPQ  243



>ref|XP_007156284.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
 gb|ESW28278.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
Length=965

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 153/208 (74%), Gaps = 5/208 (2%)
 Frame = +2

Query  83   LLVPLFIQFL-----GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            L V LF+ FL      I ++T+  D VA+++L+D W N PPSW    DPCG+ WEGV CN
Sbjct  4    LCVLLFLGFLWAEIHVISSYTETQDVVALRSLKDEWHNTPPSWDRSDDPCGEPWEGVTCN  63

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRV SL LS+M L G+LSGDI +LSEL+ LDLS+N+DLTGSL  E+G L KL  LIL G
Sbjct  64   KSRVTSLGLSTMGLKGKLSGDIGQLSELRSLDLSFNRDLTGSLSPELGELSKLNILILAG  123

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF G IPD +G+LS+L +L+LN N F G IPPSLG+LS++YWLDLADNQLTG IPVS  
Sbjct  124  CGFSGNIPDELGNLSELSFLALNSNNFTGKIPPSLGKLSKIYWLDLADNQLTGPIPVSTS  183

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             +PGLD+L+  KHFHF  N+ SG IP +
Sbjct  184  TSPGLDLLLKAKHFHFNKNQLSGSIPPK  211



>ref|XP_010252252.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=953

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  RI+  L+ +  Q     A TD  D  A+ + +  WKN PP+W    DPC  +W G+ 
Sbjct  1    MDQRIKAFLLVVLFQVSSAAAQTDPQDAAALNSFKRLWKNTPPNW-NNPDPCNGNWVGIT  59

Query  242  CNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
            CN + RV+S+TLSSM L G+LSGDI  LSELQ LDLSYNK LTGSLP  IG+L KL NLI
Sbjct  60   CNSNFRVISITLSSMGLEGQLSGDIGSLSELQTLDLSYNKGLTGSLPEAIGSLMKLSNLI  119

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            L+GC F G IPD+IGSL +L +LSLN N F G IPPS+G LS+LYWLDLADN+LTG+IPV
Sbjct  120  LLGCSFSGPIPDAIGSLKQLVFLSLNSNSFSGEIPPSIGNLSKLYWLDLADNKLTGTIPV  179

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            S G TPGLDML+ TKHFHFG N+  G IP++
Sbjct  180  SSGGTPGLDMLIHTKHFHFGKNQLKGTIPSR  210



>ref|XP_010682076.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=945

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = +2

Query  149  AIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSE  328
            A+ AL  GW+N+PP+W  G DPCG+ WEG+ CN SR+ ++TL++M LTG+L+GD+  LSE
Sbjct  24   ALVALTSGWRNLPPNWT-GRDPCGNRWEGITCNDSRITAITLANMGLTGQLTGDLASLSE  82

Query  329  LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkF  508
            LQILDLSYN+ LTG LP+ IG L +L +LIL+GCGF G IPDSIGSL  +  LSLN N F
Sbjct  83   LQILDLSYNRGLTGPLPQSIGRLSRLTSLILIGCGFSGRIPDSIGSLELVDNLSLNENNF  142

Query  509  IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
             GP+P ++G +  LYWLDLADNQL+GSIPVS G+TPGLD+LV TKHFHFG N+ +G IP
Sbjct  143  TGPVPATIGNMLNLYWLDLADNQLSGSIPVSSGDTPGLDLLVDTKHFHFGKNQLTGTIP  201



>ref|XP_010252232.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=984

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A TD  D  A+++L   W+N+PPSW +  DPCG  WEGV C  SR+ +L+LS+M L G L
Sbjct  53   ASTDTEDVAALRSLMSHWQNIPPSWGKTDDPCGTPWEGVSCRNSRITALSLSTMGLKGTL  112

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI + +EL  LDLSYNK+LTG L   IG+L+KL  LIL GCGF G IP  IG+L+KL 
Sbjct  113  SGDIGQFTELTTLDLSYNKELTGPLSPRIGDLQKLNILILAGCGFTGTIPTEIGNLAKLT  172

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +L+LN N FIG IPPSLG LS+LYWLDLADNQLTGS+PVSD N+PGLD+L+  KHFHF  
Sbjct  173  FLALNSNNFIGGIPPSLGSLSQLYWLDLADNQLTGSLPVSDNNSPGLDLLLKAKHFHFNK  232

Query  662  NKFSGEIPAQ  691
            NK SG IP++
Sbjct  233  NKLSGAIPSK  242



>ref|XP_010065203.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=929

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 136/173 (79%), Gaps = 1/173 (1%)
 Frame = +2

Query  173  WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY  352
            W+N PP+W  G+DPCGD+W G+ CN SRV S+ LSS  LTG LSGDI +LSELQILDLSY
Sbjct  4    WQNAPPNWV-GTDPCGDNWVGIRCNNSRVTSIILSSAGLTGSLSGDIGQLSELQILDLSY  62

Query  353  NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSL  532
            NK LTGSLP +IGNL KL   ILVGCGFFG IPDSIG L  L YL+LN N+F GPIP  +
Sbjct  63   NKGLTGSLPEQIGNLIKLTRWILVGCGFFGQIPDSIGYLQNLVYLALNSNRFSGPIPAII  122

Query  533  GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            G LS LYWLDLADNQLTGSIP+S+G+ PGLDML+   HFHFG N+ SG IP Q
Sbjct  123  GNLSTLYWLDLADNQLTGSIPISNGSNPGLDMLLRAIHFHFGQNQLSGTIPPQ  175



>ref|XP_007019716.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007019717.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16941.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16942.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=963

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I AFTD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   ISAFTDPHDAAALQSLKDSWQNTPPSWDKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LSGDI EL+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G L++
Sbjct  80   KLSGDIGELTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGKLAE  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IPPSLG LS+LYWLDLADNQL GSIPVS   +PGLD+L+  KHFHF
Sbjct  140  LSFLALNSNNFTGRIPPSLGTLSKLYWLDLADNQLMGSIPVSTPTSPGLDLLLKAKHFHF  199

Query  656  GXNKFSGEIPAQ  691
              NK SG IP +
Sbjct  200  NKNKLSGTIPPK  211



>emb|CDY68959.1| BnaCnng61190D, partial [Brassica napus]
Length=359

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ L  QFL + A T+  D  A++AL+  W   P SW  G+DPCG +W G+ C   RV
Sbjct  25   MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPESWV-GADPCGTNWVGITCTNDRV  83

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++D+ G+LS DI  L+ELQILDLSYN  LTG LP  IG LKKL NLILV C F 
Sbjct  84   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTGLTGPLPSNIGQLKKLKNLILVACSFS  143

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G++PVS+G ++P
Sbjct  144  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTLPVSNGTSSP  203

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  204  GLDMLLETKHFHFGKNKLSGVIP  226



>gb|KHN40742.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=954

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            R+ +L++  F   L +   T   D  A+ AL + W+N PP+W +G+DPCG  W+G+ C  
Sbjct  4    RVIVLILLFFTHLLIVFTKTSPQDSAALLALVNEWQNTPPNW-DGTDPCGAGWDGIECTN  62

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SR+ S++L+SMDL+G+L+ DI  LSEL ILDLSYNK LTG LP +IGNL+KL NL+++ C
Sbjct  63   SRITSISLASMDLSGQLTSDIGSLSELLILDLSYNKKLTGPLPNDIGNLRKLRNLLVINC  122

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IP +IG+L +L +LSLN N F GPIP ++G LS +YWLDLA+NQL G IP+S+G 
Sbjct  123  GFTGPIPVTIGNLERLVFLSLNSNGFTGPIPAAIGNLSNVYWLDLAENQLEGPIPISNGT  182

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGLDM+  TKHFHFG NK SG IP+Q
Sbjct  183  TPGLDMMHHTKHFHFGKNKLSGNIPSQ  209



>ref|XP_011464972.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=962

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 149/212 (70%), Gaps = 2/212 (1%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEG-SDPCGDHWEG  235
            M  R Q+ L+ +F  FL +    T   D + +  L+  W N PPSW    SDPC D W+G
Sbjct  1    MDHRTQVFLLLIFAPFLVLANHVTSPQDVMGLTFLKQLWNNTPPSWGTRLSDPCEDDWDG  60

Query  236  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  415
            + C   RV+SL L SM+LTG LSGDI++ SELQILDLSYNK LTG LP EIG+LKKLYN+
Sbjct  61   IRCTNMRVISLILPSMNLTGTLSGDIDQFSELQILDLSYNKGLTGPLPTEIGSLKKLYNI  120

Query  416  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  595
            ILVGC F GLIP SIGSL +L +LSLN N+F G IP S+G LS+LYWLDLADN L G IP
Sbjct  121  ILVGCSFSGLIPASIGSLQELIFLSLNSNRFSGRIPSSIGNLSKLYWLDLADNNLEGPIP  180

Query  596  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            VSDG  PGLDML   KHFH G N  SG IP++
Sbjct  181  VSDGVEPGLDMLSHCKHFHLGINHLSGPIPSK  212



>gb|EPS73565.1| hypothetical protein M569_01189, partial [Genlisea aurea]
Length=957

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 150/209 (72%), Gaps = 1/209 (0%)
 Frame = +2

Query  65   IPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  244
            I RI  +L+ + IQ L + A+T+ ND  A+ AL++ W NVPPSW  G DPC   W+G+ C
Sbjct  7    ISRIDFILLAVLIQILVVGAWTNPNDRTALLALKEQWSNVPPSWV-GPDPCNSAWDGIRC  65

Query  245  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  424
              S VVS+TL S  L G L  DI   SELQILDLSYN  LTG LP +IGNL KL NLILV
Sbjct  66   INSSVVSITLVSYSLKGYLPSDITLFSELQILDLSYNTRLTGPLPDKIGNLWKLRNLILV  125

Query  425  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  604
            GCGF G IP SIGSL +L +LSLN N FIG IP S+G LS LYWLD+ADN+L+GSIPVS 
Sbjct  126  GCGFSGPIPSSIGSLQQLVFLSLNSNNFIGEIPNSIGLLSTLYWLDIADNKLSGSIPVSK  185

Query  605  GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             + PGLD+L  TKHFHFG N+ SG+IP +
Sbjct  186  ESLPGLDLLFNTKHFHFGNNQLSGQIPPE  214



>ref|XP_003530535.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=969

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I +FTD  D VA+++L+D W++ PPSW +  DPCG  WEGV CN SRV SL LS+M L G
Sbjct  20   ISSFTDTRDVVALRSLKDAWQHTPPSWDKSDDPCGAPWEGVTCNKSRVTSLGLSTMGLKG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +L+GDI +L+EL+ LDLS+N+DLTG L  ++G+L  L  LIL GC F G IPD +G LS+
Sbjct  80   KLTGDIGQLTELRSLDLSFNRDLTGPLSPQLGDLSNLNILILAGCSFSGNIPDDLGKLSE  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IPPSLG LS+LYWLDLADNQLTG IPVS  NTPGLD+L+  KHFHF
Sbjct  140  LSFLALNSNNFTGKIPPSLGNLSKLYWLDLADNQLTGPIPVSTSNTPGLDLLLKAKHFHF  199

Query  656  GXNKFSGEIPAQ  691
              N  SG IP +
Sbjct  200  NKNHLSGSIPPK  211



>gb|KFK27543.1| hypothetical protein AALP_AA8G397000 [Arabis alpina]
Length=401

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 149/206 (72%), Gaps = 2/206 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            R  + ++  F Q   + A T+  D  A+KAL+ GW   P SW EGSDPCG +W G+ CN 
Sbjct  6    RAFMFMILFFFQISYVSAVTNGLDVYALKALKSGWSKFPESW-EGSDPCGTNWIGITCNN  64

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
             RVVS++L + +L G+LS  I  LSEL ILDLSYN  L+G LP  IG+LKKL NL+LVGC
Sbjct  65   DRVVSISLVNFNLEGKLSSYISFLSELHILDLSYNTGLSGPLPPNIGDLKKLTNLVLVGC  124

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-  607
             F G IP+SIGSL +L YLSLN N+F G IP S+GQLS+LYW D+ DNQ+ G +P+S+G 
Sbjct  125  TFSGQIPESIGSLEQLMYLSLNSNQFSGTIPASIGQLSKLYWFDITDNQIEGKLPISNGT  184

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIP  685
            ++PGLDML+ TKHFHFG NK SG+IP
Sbjct  185  SSPGLDMLLDTKHFHFGQNKLSGDIP  210



>ref|XP_008366930.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Malus domestica]
Length=223

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 139/198 (70%), Gaps = 0/198 (0%)
 Frame = +2

Query  98   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  277
            F +   I + TD +D  A+++L+  W NVPPSW + SDPCG  WEGV CN SRV +L LS
Sbjct  15   FSRLHVISSVTDPDDASALQSLKQTWSNVPPSWDKSSDPCGAQWEGVTCNDSRVTALGLS  74

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            ++++ G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GC F G IP  
Sbjct  75   AINVKGKIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCSFTGSIPSE  134

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG  637
            +G+L +L +L+LN N F G IP S G+LS LYWLDLADNQLTG IPVS    PGLD LV 
Sbjct  135  LGNLKELTFLALNTNNFTGSIPASFGKLSNLYWLDLADNQLTGPIPVSTAVAPGLDQLVK  194

Query  638  TKHFHFGXNKFSGEIPAQ  691
             KHFHF  N+ SG IPA+
Sbjct  195  AKHFHFNQNQLSGIIPAR  212



>gb|KJB29748.1| hypothetical protein B456_005G116800 [Gossypium raimondii]
Length=701

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            + A TD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   LSAVTDPHDAAALQSLKDSWQNTPPSWVKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G+L++
Sbjct  80   KLSGDIGGLTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGNLAE  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQL G+IPVS   +PGLD+L+  KHFHF
Sbjct  140  LSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLVGAIPVSTPTSPGLDLLLKAKHFHF  199

Query  656  GXNKFSGEIPAQ  691
              NK SG IP +
Sbjct  200  NKNKLSGTIPPK  211



>gb|KHN40734.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=969

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I +FTD  D VA+++L+D W++ PPSW +  DPCG  WEGV CN SRV SL LS+M L G
Sbjct  20   ISSFTDTRDVVALRSLKDAWQHTPPSWDKSDDPCGAPWEGVTCNKSRVTSLGLSTMGLKG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +L+GDI +L+EL+ LDLS+N+DLTG L  ++G+L  L  LIL GC F G IPD +G LS+
Sbjct  80   KLTGDIGQLTELRSLDLSFNRDLTGPLSPQLGDLSNLNILILAGCSFSGNIPDDLGKLSE  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IPPSLG LS+LYWLDLADNQLTG IPVS   TPGLD+L+  KHFHF
Sbjct  140  LSFLALNSNNFTGKIPPSLGNLSKLYWLDLADNQLTGPIPVSTSTTPGLDLLLKAKHFHF  199

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP +
Sbjct  200  NKNQLSGSIPPK  211



>gb|KEH20269.1| LRR receptor-like kinase [Medicago truncatula]
Length=966

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 149/209 (71%), Gaps = 0/209 (0%)
 Frame = +2

Query  65   IPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  244
            I  + L L+ L+ Q   I + TD  D  A+++L+D W+N PPSW +  DPCG  WEGV C
Sbjct  3    IQSVFLFLLFLWAQIHLIFSITDPQDVAALRSLKDIWENTPPSWDKSDDPCGAPWEGVTC  62

Query  245  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  424
            N SRV SL LS+M L G+LSGDI  L+EL+ LDLS+NKDL G +  E+G+L KL  LIL 
Sbjct  63   NKSRVTSLGLSTMGLKGKLSGDIGGLTELRSLDLSFNKDLMGPISPELGDLSKLNILILA  122

Query  425  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  604
            GC F G IPD +G LS+L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG +PVS 
Sbjct  123  GCSFSGNIPDKLGDLSELSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLTGPLPVST  182

Query  605  GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
              TPGLD+L+  KHFHF  N+ SG IP Q
Sbjct  183  STTPGLDLLLKAKHFHFNKNQLSGSIPPQ  211



>gb|KJB29747.1| hypothetical protein B456_005G116800 [Gossypium raimondii]
Length=965

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            + A TD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   LSAVTDPHDAAALQSLKDSWQNTPPSWVKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G+L++
Sbjct  80   KLSGDIGGLTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGNLAE  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQL G+IPVS   +PGLD+L+  KHFHF
Sbjct  140  LSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLVGAIPVSTPTSPGLDLLLKAKHFHF  199

Query  656  GXNKFSGEIPAQ  691
              NK SG IP +
Sbjct  200  NKNKLSGTIPPK  211



>ref|XP_006402242.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
 gb|ESQ43695.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
Length=953

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 153/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW EG+DPCG +W G+ C+  RV
Sbjct  9    MLLILLFFQTCSVSALTNGLDASALQALKAEWTTSPDSW-EGADPCGTNWVGITCSNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++++ G+LS DI  L ELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSADIAALPELQILDLSYNTGLTGPLPPNIGQLKKLRNLILVGCSFT  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG+L +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ GSIPVS+G ++P
Sbjct  128  GQIPESIGNLEQLIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGSIPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SGEIP
Sbjct  188  GLDMLLETKHFHFGKNKLSGEIP  210



>ref|XP_011464973.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011464974.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=955

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 151/211 (72%), Gaps = 2/211 (1%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            M  R Q+ L+ ++   L +    T   D   +K+L   W N PPSW    DPC D W+G+
Sbjct  1    MDQRTQVFLLLIYAPVLVLSNHQTSIPDVTGLKSLMALWTNTPPSWG-ARDPCEDSWDGI  59

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
            GC   RVVSLTLSSM+L+G LSGDI++LSELQILDLSYNK L+G LP +IG+L KL N+I
Sbjct  60   GCTNMRVVSLTLSSMNLSGSLSGDIQQLSELQILDLSYNKGLSGPLPTQIGSLTKLTNII  119

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            LVGC F GLIP SIGSL +L++LSLN N+F G IP S+G LS+LYWLDLADN L G IPV
Sbjct  120  LVGCSFSGLIPASIGSLQELRFLSLNANRFSGKIPSSIGNLSKLYWLDLADNNLEGPIPV  179

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            SDG  PGLDML   KHFH G N+ SG IP++
Sbjct  180  SDGVEPGLDMLSHCKHFHLGINQLSGPIPSK  210



>emb|CDY21455.1| BnaC03g27420D [Brassica napus]
Length=953

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 154/203 (76%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q L + A T+  D  A++AL+  W   P SW EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGPALQALKAEWTKPPSSW-EGADPCGTSWVGITCSNNRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPESIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  188  GLDMLLETKHFHFGKNKLSGYIP  210



>ref|XP_003547844.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
 gb|KHN01903.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=967

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 150/206 (73%), Gaps = 0/206 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            + L L  L+ +   I +FTD  D VA+++L+D W+N PPSW +  DPCG  WEGV CN S
Sbjct  6    VLLFLGLLWAEIHVISSFTDTQDVVALRSLKDVWQNTPPSWDKADDPCGAPWEGVTCNKS  65

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV SL LS+M L G+L+GDI +L+EL+ LDLS+N+ LTG L  ++G+L  L  LIL GC 
Sbjct  66   RVTSLGLSTMGLKGKLTGDIGQLTELRSLDLSFNRGLTGPLSPQLGDLSNLNILILAGCS  125

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IPD +G+LS+L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG IPVS   T
Sbjct  126  FGGNIPDELGNLSELSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLTGPIPVSTSTT  185

Query  614  PGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PGLD+L+  KHFHF  N+ SG IP +
Sbjct  186  PGLDLLLKAKHFHFNKNQLSGSIPPK  211



>ref|XP_010671953.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Beta vulgaris subsp. 
vulgaris]
Length=945

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 155/205 (76%), Gaps = 5/205 (2%)
 Frame = +2

Query  80   LLLVPLFIQFLG-IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC--NG  250
            LL+V  F  ++G I A T++ D+ A+ AL   W+N+PPSW  G + C   WEG+ C  NG
Sbjct  6    LLVVGFFCIYVGNIAAQTNSRDHAALVALTTDWENLPPSWT-GQNSCTS-WEGITCDANG  63

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            +R++++TL+SM L+G+L+GD+  LSELQILDLSYN+ LTGSLP +IG L +L NLIL+GC
Sbjct  64   TRIIAITLASMQLSGQLTGDLVFLSELQILDLSYNRGLTGSLPGDIGQLSRLTNLILLGC  123

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
               G IPDSIG L +L  LSLN N+F GP+P S+G L+ L+WLDL DN+LTGSIPVS G+
Sbjct  124  SLSGRIPDSIGLLQQLVSLSLNSNRFSGPVPASIGNLTNLFWLDLTDNRLTGSIPVSSGD  183

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIP  685
            TPGLD+LV T+HFHFG N+ SG IP
Sbjct  184  TPGLDLLVNTRHFHFGMNQLSGTIP  208



>ref|XP_010065202.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=975

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 143/190 (75%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A T+  D+ AI  L   W+  PP+W  G+DPCG++W G+ CN SRV S+ LSS  LTG L
Sbjct  41   AATNPYDFSAIMGLMTDWQIAPPNWV-GNDPCGNNWVGIVCNNSRVTSIILSSAGLTGPL  99

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI +LSELQ LDLS NK LTGSLP +IGNL KL +LILVGCGF G IPDS+GSL  L 
Sbjct  100  SGDIGQLSELQFLDLSNNKGLTGSLPEQIGNLMKLTHLILVGCGFSGQIPDSVGSLQNLV  159

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N+F G IP  +G LS LYWLDLADNQLTGSIPVS+G+  GLDML+  KHFHFG 
Sbjct  160  HLSLNSNRFTGLIPAIIGNLSRLYWLDLADNQLTGSIPVSNGSNSGLDMLLQAKHFHFGQ  219

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  220  NQLSGTIPSQ  229



>emb|CDX83184.1| BnaA03g23220D [Brassica napus]
Length=953

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 153/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  188  GLDMLLETKHFHFGKNKLSGSIP  210



>gb|KDO70764.1| hypothetical protein CISIN_1g002121mg [Citrus sinensis]
Length=964

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 149/207 (72%), Gaps = 6/207 (3%)
 Frame = +2

Query  80   LLLVPLF---IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            L+ + LF   IQ   I + TD+ D  A+++L+D W+N PP+W    DPCG  WEGV CN 
Sbjct  7    LIFIALFSFHIQL--ISSATDSRDAAALQSLKDAWQNTPPTWKNSDDPCGS-WEGVTCNN  63

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SRV +L LS+M LTG+LSGDI  L+EL+ LDLSYN  LTGSL   IG+L+KL  LIL GC
Sbjct  64   SRVTALGLSTMGLTGKLSGDIGGLTELRSLDLSYNGGLTGSLSPRIGDLQKLNILILAGC  123

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPD IG+L++L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTGSIPVS   
Sbjct  124  GFTGNIPDEIGNLAELSFLALNSNNFSGRIPPSLGKLSQLYWLDLADNQLTGSIPVSTIT  183

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +PGLD L   KHFHF  NK SG I  Q
Sbjct  184  SPGLDQLKNAKHFHFNKNKLSGTISEQ  210



>ref|XP_010930348.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=952

 Score =   219 bits (557),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 139/190 (73%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A TD  D   + +L   W N P +W  GSDPCGD W G+ C  SRV+S+TLSS+ LTG L
Sbjct  21   ADTDPQDAAVLNSLASSWDNTPSNWI-GSDPCGDKWVGISCTNSRVISITLSSLGLTGTL  79

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI+ L+ELQ LDLSYNK LTG +P  IG+L KL NLILVGC F G IP  IG+L +L 
Sbjct  80   SGDIQSLNELQALDLSYNKGLTGGIPASIGSLSKLVNLILVGCSFSGEIPPEIGNLPRLV  139

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N F G IP +LG LS+LYW DLADN+LTG+IPVSDGN PGLD+L   KHFHFG 
Sbjct  140  FLSLNSNSFTGSIPKTLGNLSKLYWFDLADNKLTGTIPVSDGNKPGLDLLTHCKHFHFGV  199

Query  662  NKFSGEIPAQ  691
            N+ SG IP++
Sbjct  200  NQLSGTIPSK  209



>ref|XP_009118911.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=940

 Score =   219 bits (557),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ L  QFL + A T+  D  A++AL+  W   P SW  G+DPCG +W G+ C   RV
Sbjct  9    MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPESWV-GADPCGTNWVGITCTNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++D+ G+LS DI  L+ELQILDLSYN  LTG LP  IG LKKL NLILV C F 
Sbjct  68   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTGLTGPLPSNIGQLKKLKNLILVACSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTLPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+GTKHFHFG NK SG IP
Sbjct  188  GLDMLLGTKHFHFGKNKLSGIIP  210



>ref|XP_008782739.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=960

 Score =   218 bits (556),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 135/188 (72%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD  D  A+++L DGW+N PPSW +  DPCG  WEGV C  SRV  L LS+M L G LSG
Sbjct  23   TDPTDAAALRSLMDGWQNTPPSWGQSDDPCGTPWEGVNCINSRVTVLKLSTMGLKGTLSG  82

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +LSELQ LDLSYN +L G L   IGNLKK+  LILVGC F G IP+ +G+L KL YL
Sbjct  83   DIGQLSELQTLDLSYNNELGGPLASNIGNLKKITTLILVGCSFSGQIPEELGNLEKLSYL  142

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            ++N NKF G IP SLG LS LYWLD+ADNQL+G IPVSD   PGLD L+ TKHFHF  N+
Sbjct  143  AINSNKFTGRIPASLGTLSNLYWLDVADNQLSGPIPVSDNGAPGLDQLLNTKHFHFNKNQ  202

Query  668  FSGEIPAQ  691
             SG IP +
Sbjct  203  LSGRIPEK  210



>ref|XP_009134023.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=953

 Score =   218 bits (555),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 152/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++P S+G ++P
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPASNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  188  GLDMLLETKHFHFGKNKLSGSIP  210



>ref|XP_009593371.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=951

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  R Q+ L+    Q L I+  T++ND  A+ A++  W N+PP+W EGSDPCG  WEG+ 
Sbjct  4    MGSRSQVFLLIFASQILAILGQTNSNDVTALFAIKSSWNNLPPNW-EGSDPCGSSWEGIV  62

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  SR+ S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CKDSRITSIKLSGMGLEGNQFGDLSSLTALQILDLSNNVGLKGTLPSSIGNLKNLTTLIL  122

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGC FFG IP+SIGSL +L ++SL  N F GPIPPS+G LS+L WLDL+DN+L+G+IPVS
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKLSGTIPVS  182

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             G+TPGLD LV T+H H   N+ SG I +Q
Sbjct  183  KGSTPGLDWLVNTRHLHLSKNQLSGPIQSQ  212



>emb|CDY61244.1| BnaCnng37500D [Brassica napus]
Length=953

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ L  QFL + A T+  D  A++AL+  W   P +W  G+DPCG +W G+ C   RV
Sbjct  9    MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPENWV-GADPCGTNWVGITCTNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++D+ G+LS DI  L+ELQILDLSYN +LTG LP  IG LKKL NLILV C F 
Sbjct  68   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTELTGPLPSNIGQLKKLKNLILVACSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G+IPVS+G ++P
Sbjct  128  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTIPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  188  GLDMLLETKHFHFGKNKLSGVIP  210



>gb|EEE52938.1| hypothetical protein OsJ_35570 [Oryza sativa Japonica Group]
Length=967

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 144/208 (69%), Gaps = 1/208 (0%)
 Frame = +2

Query  68   PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            P I + L+ + +Q     A T+  D   +  L   W + P +WA G+DPCGD W G+ C 
Sbjct  5    PWIIIFLLIVLVQAFVASADTNAQDTSGLNGLAGSWGSAPSNWA-GNDPCGDKWIGIICT  63

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
            G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L G LP  IG L KL NLILVG
Sbjct  64   GNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNLNGPLPSTIGTLSKLQNLILVG  123

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF G IP  IG LS L +LSLN NKF G IPPSLG LS+LYW DLADNQLTG +P+S+ 
Sbjct  124  CGFTGEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPISNA  183

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             +PGLD L  TKHFHFG N+ SG IP+Q
Sbjct  184  TSPGLDNLTSTKHFHFGINQLSGSIPSQ  211



>ref|NP_001066400.1| Os12g0210400 [Oryza sativa Japonica Group]
 gb|ABA96703.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29419.1| Os12g0210400 [Oryza sativa Japonica Group]
 dbj|BAG91081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=967

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 144/208 (69%), Gaps = 1/208 (0%)
 Frame = +2

Query  68   PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  247
            P I + L+ + +Q     A T+  D   +  L   W + P +WA G+DPCGD W G+ C 
Sbjct  5    PWIIIFLLIVLVQAFVASADTNAQDTSGLNGLAGSWGSAPSNWA-GNDPCGDKWIGIICT  63

Query  248  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
            G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L G LP  IG L KL NLILVG
Sbjct  64   GNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNLNGPLPSTIGTLSKLQNLILVG  123

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF G IP  IG LS L +LSLN NKF G IPPSLG LS+LYW DLADNQLTG +P+S+ 
Sbjct  124  CGFTGEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPISNA  183

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             +PGLD L  TKHFHFG N+ SG IP+Q
Sbjct  184  TSPGLDNLTSTKHFHFGINQLSGSIPSQ  211



>ref|XP_010252249.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nelumbo nucifera]
Length=915

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 149/207 (72%), Gaps = 5/207 (2%)
 Frame = +2

Query  83   LLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            LL+ + IQ     A    TD ND  A+ + +  WKN PP+W E SDPC   W GV CN S
Sbjct  12   LLLVVLIQISSAAAQQAPTDPNDAAALNSFKLMWKNRPPNW-ENSDPCVGGWVGVTCNNS  70

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC  430
            +V+S+ LSSM L G+LSGDI  L+ELQ LDLSYN+ L G LP E IG+LKKL NLILVGC
Sbjct  71   QVISIKLSSMGLEGQLSGDIGALTELQTLDLSYNRGLNGPLPAEAIGSLKKLSNLILVGC  130

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
             F G IP +IG L +L +LSLN N F G IPPS+G+LS+LYWLD+ADN+L+G+IPVS  +
Sbjct  131  SFSGRIPSTIGDLEELVFLSLNSNSFTGEIPPSIGKLSKLYWLDIADNKLSGTIPVSSSS  190

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGLDML+  KHFHFG N+ SG IP Q
Sbjct  191  TPGLDMLLHAKHFHFGKNQLSGTIPPQ  217



>ref|XP_006481666.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Citrus sinensis]
Length=964

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 148/207 (71%), Gaps = 6/207 (3%)
 Frame = +2

Query  80   LLLVPLF---IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            L+ + LF   IQ   I + TD+ D  A+++L+D W+N PP+W    DPCG  WEGV CN 
Sbjct  7    LIFIALFSFHIQL--ISSATDSRDAAALQSLKDAWQNTPPTWKNSDDPCGS-WEGVTCNN  63

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SRV +L LS+M LTG+LSGDI  L+EL+ LDLSYN  LTGSL   IG+L+KL  LIL GC
Sbjct  64   SRVTALGLSTMGLTGKLSGDIGGLTELRSLDLSYNGGLTGSLSPRIGDLQKLNILILAGC  123

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPD IG+L++L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTGSIPVS   
Sbjct  124  GFTGNIPDEIGNLAELSFLALNSNNFSGRIPPSLGKLSQLYWLDLADNQLTGSIPVSTIT  183

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +PGLD L   KHFHF  NK  G I  Q
Sbjct  184  SPGLDQLKNAKHFHFNKNKLLGTISEQ  210



>gb|AAF68126.1|AC010793_21 F20B17.5 [Arabidopsis thaliana]
Length=980

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 147/214 (69%), Gaps = 3/214 (1%)
 Frame = +2

Query  59   TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  229
            T+    +LLL+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  W
Sbjct  6    TVTATSRLLLICFAYSFTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPW  65

Query  230  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  409
            EGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL 
Sbjct  66   EGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLN  125

Query  410  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  589
             LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG 
Sbjct  126  ILILAGCGFTGTIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGP  185

Query  590  IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            IP+S G++PGLD+L+  KHFHF  N+ SG IP +
Sbjct  186  IPISSGSSPGLDLLLKAKHFHFNKNQLSGTIPPK  219



>ref|XP_010252248.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=959

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 149/207 (72%), Gaps = 5/207 (2%)
 Frame = +2

Query  83   LLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            LL+ + IQ     A    TD ND  A+ + +  WKN PP+W E SDPC   W GV CN S
Sbjct  12   LLLVVLIQISSAAAQQAPTDPNDAAALNSFKLMWKNRPPNW-ENSDPCVGGWVGVTCNNS  70

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC  430
            +V+S+ LSSM L G+LSGDI  L+ELQ LDLSYN+ L G LP E IG+LKKL NLILVGC
Sbjct  71   QVISIKLSSMGLEGQLSGDIGALTELQTLDLSYNRGLNGPLPAEAIGSLKKLSNLILVGC  130

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
             F G IP +IG L +L +LSLN N F G IPPS+G+LS+LYWLD+ADN+L+G+IPVS  +
Sbjct  131  SFSGRIPSTIGDLEELVFLSLNSNSFTGEIPPSIGKLSKLYWLDIADNKLSGTIPVSSSS  190

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGLDML+  KHFHFG N+ SG IP Q
Sbjct  191  TPGLDMLLHAKHFHFGKNQLSGTIPPQ  217



>ref|NP_178080.2| putative serine/threonine kinase [Arabidopsis thaliana]
 dbj|BAC42504.1| unknown protein [Arabidopsis thaliana]
 gb|ACN59279.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE36273.1| putative serine/threonine kinase [Arabidopsis thaliana]
Length=971

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 147/214 (69%), Gaps = 3/214 (1%)
 Frame = +2

Query  59   TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  229
            T+    +LLL+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  W
Sbjct  6    TVTATSRLLLICFAYSFTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPW  65

Query  230  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  409
            EGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL 
Sbjct  66   EGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLN  125

Query  410  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  589
             LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG 
Sbjct  126  ILILAGCGFTGTIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGP  185

Query  590  IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            IP+S G++PGLD+L+  KHFHF  N+ SG IP +
Sbjct  186  IPISSGSSPGLDLLLKAKHFHFNKNQLSGTIPPK  219



>gb|KFK42372.1| hypothetical protein AALP_AA2G247300 [Arabis alpina]
Length=970

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 145/212 (68%), Gaps = 1/212 (0%)
 Frame = +2

Query  59   TMIPRIQLL-LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
            T IPR  L+     F  F    + TD  D  A+++L D W N PPSW    DPCG  WEG
Sbjct  6    TAIPRFLLICFAYCFTVFSMTSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEG  65

Query  236  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  415
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  L
Sbjct  66   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNIL  125

Query  416  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  595
            IL GCGF G IP+ +G L  L +L+LN N F G IP +LG L+++YWLDLADNQLTG IP
Sbjct  126  ILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPSALGNLTKVYWLDLADNQLTGPIP  185

Query  596  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +S G++PGLD+L+ TKHFHF  N+ SG IP +
Sbjct  186  ISSGSSPGLDLLLKTKHFHFNKNQLSGTIPPK  217



>ref|XP_002889259.1| hypothetical protein ARALYDRAFT_477135 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65518.1| hypothetical protein ARALYDRAFT_477135 [Arabidopsis lyrata subsp. 
lyrata]
Length=971

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 146/212 (69%), Gaps = 1/212 (0%)
 Frame = +2

Query  59   TMIPRIQLL-LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
            T I R+ L+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  WEG
Sbjct  8    TAISRLLLIGFAYSFTVFSIISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEG  67

Query  236  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  415
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLNIL  127

Query  416  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  595
            IL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  596  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +S G++PGLD+L+  KHFHF  N+ SG IP +
Sbjct  188  ISSGSSPGLDLLLKAKHFHFNKNQLSGTIPPK  219



>ref|XP_009377697.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=385

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 135/192 (70%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ CNGSRV +L LS M++ G
Sbjct  18   ISSSTHLDDANALQSLRQTWINVPPSWDKSNDPCGESWEGITCNGSRVTALGLSGMNVEG  77

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            ++ GDI  LSEL+ LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   KIEGDIAGLSELRFLDLSFNKGLTGSLSPRLGDLSNLNILILAGCSFSGIIPSELGKLGE  137

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PVS G TPGLD L   KHFH 
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPVSSGTTPGLDQLFKAKHFHL  197

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP +
Sbjct  198  NQNQLSGTIPTR  209



>emb|CDX83183.1| BnaA03g23230D [Brassica napus]
Length=812

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW +G DPCG  W G+ C   RV
Sbjct  9    MLLIFLFFQIFSVSALTNGFDGAALQALKAEWTKPPSSW-DGDDPCGTSWVGITCISDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGETKKLKNLILVGCSFT  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  616
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G + P
Sbjct  128  GQIPESIGKLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSLP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  188  GLDMLLETKHFHFGKNKLSGHIP  210



>ref|XP_009134024.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=899

 Score =   215 bits (547),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW +G DPCG  W G+ C   RV
Sbjct  9    MLLIFLFFQIFSVSALTNGFDGAALQALKAEWTKPPSSW-DGDDPCGTSWVGITCISDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGETKKLKNLILVGCSFT  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  616
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G + P
Sbjct  128  GQIPESIGKLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSLP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIP  685
            GLDML+ TKHFHFG NK SG IP
Sbjct  188  GLDMLLETKHFHFGKNKLSGHIP  210



>ref|XP_010441110.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=247

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 149/205 (73%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF Q   + A T++ D VA+ AL+      P +W +G DPCG +W G+ C+  RV
Sbjct  9    MLLILLFFQISSVSALTNSIDAVALLALKSELTGTPKNW-KGFDPCGTNWVGISCSNGRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            V+++LS+++L G+LS DI  LSEL  LDL+ N ++TG LP  IGNLKKL  L L+GCGF 
Sbjct  68   VNISLSNLNLQGKLSADISTLSELVTLDLTSNSNITGPLPPNIGNLKKLTELNLMGCGFD  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG+L KL  LSLN NKF G IP S+G+LS+LYW D+ADNQ+ G IPVS+G ++P
Sbjct  128  GQIPESIGNLEKLTKLSLNSNKFNGKIPASMGRLSKLYWFDIADNQIEGEIPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ T HFHFG NK SG+IP +
Sbjct  188  GLDMLLQTVHFHFGKNKLSGKIPKE  212



>ref|XP_004137665.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 ref|XP_004160329.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 gb|KGN58673.1| hypothetical protein Csa_3G727910 [Cucumis sativus]
Length=966

 Score =   215 bits (548),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 145/208 (70%), Gaps = 1/208 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            M P   LLL   F   +    +FTD  D  A+++LR+ W+N PPSW    DPCG  WEGV
Sbjct  1    MSPVETLLLFAFFYAGIDTAGSFTDPRDSAALESLRNEWQNTPPSWGASIDPCGTPWEGV  60

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
             C  SRV +L LS+M L G+L GDI  L+EL+ LDLS+NKDLTGS+   +G+L+ L  LI
Sbjct  61   ACINSRVTALRLSTMGLKGKLGGDIGGLTELKSLDLSFNKDLTGSISPALGDLQNLSILI  120

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            L GCGF G IP+ +G+LS L +L+LN N F G IPPSLG+LS LYWLDLADNQLTGS+PV
Sbjct  121  LAGCGFSGSIPEQLGNLSNLSFLALNSNNFTGTIPPSLGKLSNLYWLDLADNQLTGSLPV  180

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEI  682
            S   TPGLD+L+  KHFHF  N+ SG I
Sbjct  181  STSETPGLDLLLKAKHFHFNKNQLSGSI  208



>ref|XP_010275979.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=964

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD  D VA+++L++ W+N PPSW + +DPCG  WEGV C  SRV +L LS+M+L G LSG
Sbjct  25   TDTQDAVALQSLKEQWQNTPPSWGKSNDPCGAPWEGVTCTNSRVTALRLSTMNLKGTLSG  84

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI + +EL+ LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G+L++L +L
Sbjct  85   DIGQFTELRSLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFTGSIPKELGNLAQLSFL  144

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN N F G IPPSLG LS+LYWLDLADNQLTG IPVS   +PGLD+L+  KHFHF  NK
Sbjct  145  ALNSNNFTGGIPPSLGTLSKLYWLDLADNQLTGVIPVSTDKSPGLDLLLKAKHFHFNKNK  204

Query  668  FSGEIPAQ  691
             SG IP +
Sbjct  205  LSGPIPPK  212



>ref|XP_007147540.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
 gb|ESW19534.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
Length=944

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  298
            VA     D+  +K+L D W+   P+W EGSDPC D W G+ C  SRVVS++L+ + LTG+
Sbjct  20   VAQDITKDFQVLKSLSDSWQGQIPNW-EGSDPCQD-WYGINCRNSRVVSISLTDIGLTGK  77

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            LSGDI  LSEL  LDLSYN+ LTG LP+EIGNLKKL  L LVGCGF G IPD IGSL  L
Sbjct  78   LSGDIGSLSELDSLDLSYNRGLTGPLPQEIGNLKKLTKLTLVGCGFTGRIPDEIGSLQHL  137

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG  658
            ++LSLN N F GPIPPS+G LS L WLDLADNQL GSIPVS G TPGLDML    HFH G
Sbjct  138  EFLSLNSNNFAGPIPPSIGNLSNLTWLDLADNQLDGSIPVSSGTTPGLDMLHKALHFHLG  197

Query  659  XNKFSGEIPAQ  691
             NK SG+IP +
Sbjct  198  QNKLSGQIPPK  208



>ref|XP_006389866.1| hypothetical protein EUTSA_v10018176mg [Eutrema salsugineum]
 gb|ESQ27152.1| hypothetical protein EUTSA_v10018176mg [Eutrema salsugineum]
Length=756

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 139/198 (70%), Gaps = 0/198 (0%)
 Frame = +2

Query  98   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  277
            F  F  + + TD  D  AI++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  23   FTVFSMVSSVTDPRDAAAIRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNDSRITALGLS  82

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  LIL GCGF G IP+ 
Sbjct  83   TMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNILILAGCGFTGSIPNE  142

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG  637
            +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP+S G++PGLD+L+ 
Sbjct  143  LGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIPISSGSSPGLDLLLK  202

Query  638  TKHFHFGXNKFSGEIPAQ  691
             KHFHF  N+ SG IP +
Sbjct  203  AKHFHFNKNQLSGTIPPK  220



>ref|XP_006852584.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
 gb|ERN14051.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
Length=962

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 148/206 (72%), Gaps = 1/206 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            + L L+    QF  I+  TD  D  A+ AL+   +N PP+W+ G+DPCG +W+GV C+ S
Sbjct  6    VLLFLLSTGFQFHLILGITDPGDGAAMIALKSYMQNTPPNWS-GADPCGSNWDGVSCSNS  64

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV++L LS+M L G L GDI  L+ELQ LDLS+N+DL GS+P+ I NLKKL  LIL GC 
Sbjct  65   RVIALKLSTMGLRGFLPGDIGSLTELQFLDLSFNQDLGGSIPKSIENLKKLTTLILAGCS  124

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IPD +GSL +L +L+LN NKF G IP SLG+LS+LYW DLADNQLTG +PVSDG  
Sbjct  125  FSGTIPDELGSLQELAFLALNTNKFTGRIPASLGKLSKLYWFDLADNQLTGGLPVSDGIN  184

Query  614  PGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PGLDML+  KHFHF  N+ SG IP +
Sbjct  185  PGLDMLLNAKHFHFNQNQLSGLIPPK  210



>dbj|BAA98164.1| receptor protein kinase-like [Arabidopsis thaliana]
Length=941

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 147/205 (72%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct  9    LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  616
            G IP+SIG+L +L YLSLNLNKF G IPPS+G LS+LYW D+ADNQ+ G +PVS+G + P
Sbjct  128  GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ TKHFHFG NK SG IP +
Sbjct  188  GLDMLLQTKHFHFGKNKLSGNIPKE  212



>ref|XP_008802221.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=967

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 142/190 (75%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A TD  D  A+ +L   W+N P +W  GSDPCG++W G+ C  SRV+S+TLSS+ L G L
Sbjct  37   AETDPQDAAALNSLASLWENTPSNWI-GSDPCGNNWVGISCTNSRVISITLSSLGLIGTL  95

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI+ L+ELQ LDLSYNK L G +P  IG+L KL NLILVGC F G IP  IG+L++L 
Sbjct  96   SGDIQSLNELQALDLSYNKGLNGGIPASIGSLSKLVNLILVGCSFSGKIPPEIGNLARLV  155

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +LSLN N F G IP ++G LS+LYWLD+ADN+LTG+IPVSDGN PGLD+L   KHFHFG 
Sbjct  156  FLSLNSNGFTGSIPETVGNLSKLYWLDMADNKLTGTIPVSDGNKPGLDLLTHCKHFHFGV  215

Query  662  NKFSGEIPAQ  691
            N+ SG IP++
Sbjct  216  NQLSGTIPSK  225



>gb|KJB57523.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=959

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 144/205 (70%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L LV +      + A TD +D  +++A+   WKNVP +W  G DPC D W G+GC GSRV
Sbjct  7    LFLVVVLFHIYIVAAETDPDDNSSLRAVMSEWKNVPSNWGRG-DPCDDKWVGIGCTGSRV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             SL L +M L G L GDI  LSEL+ LDLSYNK L G LP  + NLKKL NLILVGCGF 
Sbjct  66   TSLNLPNMKLEGRLVGDIFFLSELKELDLSYNKGLRGILPPAVQNLKKLENLILVGCGFS  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TP  616
            G IPD+IGSL +L+ LSLN N F G IPPS+G LS L WLD+ADNQL G IPVS+G+ TP
Sbjct  126  GQIPDTIGSLPQLRILSLNSNAFSGNIPPSIGNLSTLNWLDMADNQLEGEIPVSNGSTTP  185

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLD L+ TKHFHFG NK SG IP +
Sbjct  186  GLDWLIHTKHFHFGLNKLSGPIPRK  210



>gb|KFK26616.1| hypothetical protein AALP_AA8G271800 [Arabis alpina]
Length=952

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF     + A T+  D  A++AL+  W   P  W EGSDPCG +W G+ C   R+
Sbjct  9    MLLILLFFHICYVSALTNGLDASALQALKSEWTRSPEGW-EGSDPCGTNWVGITCINDRI  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS+++++++L G+LSGDI  L+ELQILDLS++  L+G LP  IG+LKKL NLILVGC F 
Sbjct  68   VSISVANLNLEGKLSGDISALTELQILDLSFSTGLSGPLPPNIGDLKKLRNLILVGCSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IPDSIGSL +L YLSLN N+F G IP S+G+LS+LYW D+ADNQL G IPVS+G ++P
Sbjct  128  GQIPDSIGSLEQLIYLSLNSNQFSGTIPASIGRLSKLYWFDIADNQLEGEIPVSNGASSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ TKHFHFG NK SG IP +
Sbjct  188  GLDMLLETKHFHFGKNKLSGVIPEK  212



>ref|NP_199787.2| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAC41801.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAP21294.1| At5g49760 [Arabidopsis thaliana]
 gb|ACN59388.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95854.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=953

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 147/205 (72%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct  9    LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  616
            G IP+SIG+L +L YLSLNLNKF G IPPS+G LS+LYW D+ADNQ+ G +PVS+G + P
Sbjct  128  GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ TKHFHFG NK SG IP +
Sbjct  188  GLDMLLQTKHFHFGKNKLSGNIPKE  212



>ref|XP_002269419.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
Length=944

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 153/209 (73%), Gaps = 8/209 (4%)
 Frame = +2

Query  77   QLLLVPL---FIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  244
            +L+LV L   FIQF     A T+ +D  A+K+L    KN+P +W  G+DPC + WEG+GC
Sbjct  4    RLILVSLLIVFIQFNSATWASTNTDDATALKSL---LKNLPFTWV-GADPCVNGWEGIGC  59

Query  245  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  424
            +  RV+S+TL+SMDL GELS D + LSEL+ILDLSYNK LTG++P  IG+LK L NLIL+
Sbjct  60   SNGRVISITLASMDLKGELSEDFQGLSELKILDLSYNKGLTGNIPASIGSLKSLTNLILM  119

Query  425  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  604
            GC F G IPD+IGSL+ L  LSLN N F G IPPS+G L  L WLD+ +NQ+TG+IP+S+
Sbjct  120  GCSFSGQIPDTIGSLTNLVVLSLNSNSFSGVIPPSIGNLYNLNWLDITENQITGTIPISN  179

Query  605  GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            G TPGLDML   KHFHFG N+ SG IP Q
Sbjct  180  GGTPGLDMLTQMKHFHFGKNRLSGPIPPQ  208



>ref|XP_010441081.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=952

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 149/214 (70%), Gaps = 5/214 (2%)
 Frame = +2

Query  62   MIPRIQL--LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
            M  RI L  LL+ L +Q   +   TD  D  A++ L+  W  +  SW +GSDPCG+HW G
Sbjct  1    MSSRIGLFKLLILLVVQVCSVSTTTDGADSSALQVLKSEWTALSKSW-KGSDPCGNHWVG  59

Query  236  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  412
            + CN + RVVS+ LS+++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L N
Sbjct  60   ITCNNNNRVVSIMLSNLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLRN  119

Query  413  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  592
            LIL+GCGF G IP+SIGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ GSI
Sbjct  120  LILMGCGFSGQIPESIGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGSI  179

Query  593  PVSDG-NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PVSDG + PGLDML   KHFHFG NK S  IP +
Sbjct  180  PVSDGISLPGLDMLHQAKHFHFGNNKLSDSIPEK  213



>ref|XP_010930467.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=970

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 141/190 (74%), Gaps = 1/190 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            A TD  D  A+ +L   W+N P +W  GSDPCGD+W G+ CN S V+++TLSS+ L G L
Sbjct  37   AETDPQDADALISLASSWENPPSNWI-GSDPCGDNWVGISCNNSHVIAITLSSLGLIGTL  95

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI+ L+EL+ LDLSYNK LTG +P  IG+L KL NL+LV C F G IP  IG+L +L 
Sbjct  96   SGDIQSLNELRALDLSYNKGLTGGIPASIGSLSKLINLVLVDCSFSGEIPREIGNLPRLV  155

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +L+LN N F G IP +LG LS+LYWLDLADN+LTG+IPVSDGN PGLD+L   KHFHFG 
Sbjct  156  FLALNSNSFTGTIPETLGNLSKLYWLDLADNKLTGTIPVSDGNKPGLDLLTHCKHFHFGA  215

Query  662  NKFSGEIPAQ  691
            N+ SG IP+Q
Sbjct  216  NQLSGAIPSQ  225



>ref|XP_009128375.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=976

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 138/198 (70%), Gaps = 0/198 (0%)
 Frame = +2

Query  98   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  277
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  23   FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS  82

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  83   TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  142

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG  637
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+L+ 
Sbjct  143  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDLLLK  202

Query  638  TKHFHFGXNKFSGEIPAQ  691
             KHFHF  N+ SG IP +
Sbjct  203  AKHFHFNKNQLSGTIPPK  220



>ref|XP_011028445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Populus euphratica]
Length=952

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +2

Query  101  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  280
            +Q L I A TD+ND  A+ +L+  WKN PP+W+ G DPCG  WEG+GC GSR+ S+ LS 
Sbjct  14   LQVLVITAATDSNDLSALNSLKSNWKNTPPNWS-GFDPCGGRWEGIGCTGSRITSIVLSG  72

Query  281  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  460
            M L+G LSGDI    ELQ LDLS N  LTG LP  I NLKKL NL LV C F G IPD I
Sbjct  73   MGLSGTLSGDIGNFPELQTLDLSQNNGLTGILPPAIVNLKKLENLFLVDCNFNGPIPDEI  132

Query  461  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGT  640
            GSL+ L  LSL  N F GPIPPS+G++S L  LDL DN+L+G+IPVSDG +PGLD+L+  
Sbjct  133  GSLTHLVSLSLASNNFNGPIPPSIGKMSNLSLLDLTDNKLSGTIPVSDGTSPGLDLLLKA  192

Query  641  KHFHFGXNKFSGEIPA  688
            +HFH G N+ +G IP+
Sbjct  193  RHFHLGKNQLTGGIPS  208



>ref|XP_009387132.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD  D  A++++   WKN PP+W + SDPCG  WEGV C+ SRV SL LS+M + G LS 
Sbjct  25   TDPQDAAALRSMLSEWKNAPPTWGQSSDPCGSPWEGVFCDASRVTSLRLSTMGIKGTLSS  84

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +L+ELQ LDLSYN DL G L   IGNLKKL  LIL GC F G IP+ +G+L  L +L
Sbjct  85   DISQLTELQSLDLSYNGDLGGLLTPNIGNLKKLTTLILAGCSFNGKIPEELGNLKLLSFL  144

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN NKF G IP SLG LS LYWLDLADNQL GS+P+S   TPGLD L+ TKHFHF  N+
Sbjct  145  ALNSNKFNGRIPASLGLLSNLYWLDLADNQLIGSLPISVNATPGLDRLLNTKHFHFNKNQ  204

Query  668  FSGEIPAQ  691
             SGEIP Q
Sbjct  205  LSGEIPEQ  212



>ref|XP_008442305.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Cucumis melo]
Length=965

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 144/208 (69%), Gaps = 1/208 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            M P   LLL   F        +FTD  D  A+++LR+ W+N PPSW    DPCG  WEGV
Sbjct  1    MSPVETLLLFAFFYAGQDTAGSFTDPRDSAALESLRNEWQNTPPSWGASIDPCGTPWEGV  60

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
             C  SRV +L LS+M L G+L GDI  L+EL+ LDLS+NKDLTGS+   +G+L+ L  LI
Sbjct  61   ACINSRVTALRLSTMGLKGKLGGDIGGLTELKSLDLSFNKDLTGSISPALGDLQNLSILI  120

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            L GCGF G IP+ +G+LS L +L+LN N F G IPPSLG+LS LYWLDLADNQLTGS+PV
Sbjct  121  LAGCGFSGSIPEQLGNLSNLSFLALNSNNFTGTIPPSLGKLSNLYWLDLADNQLTGSLPV  180

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEI  682
            S   TPGLD+L+  KHFHF  N+ SG I
Sbjct  181  STSETPGLDLLLKAKHFHFNKNQLSGSI  208



>ref|XP_010442445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
 ref|XP_010442446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=950

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 149/214 (70%), Gaps = 5/214 (2%)
 Frame = +2

Query  62   MIPRIQL--LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
            M  RI L  LL+ L +Q   + A TD +D  A++ L+  W  +  SW +GSDPCG+HW G
Sbjct  1    MSSRIGLFKLLILLVVQVCSVSAITDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVG  59

Query  236  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  412
            + CN + RVVS+ LS+++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L  
Sbjct  60   ITCNNNNRVVSIMLSNLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKHLKR  119

Query  413  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  592
            LIL+GCGF G IP+SIGS+ KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G I
Sbjct  120  LILMGCGFSGQIPESIGSVEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKI  179

Query  593  PVSDG-NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PVSDG + PGLDML   KHFHFG NK S  IP +
Sbjct  180  PVSDGISLPGLDMLHQAKHFHFGNNKLSDSIPEK  213



>ref|XP_010417632.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=973

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 143/212 (67%), Gaps = 1/212 (0%)
 Frame = +2

Query  59   TMIPRIQLLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
            T   R+ L+       F  + +  TD  D  ++++L D W N PPSW    DPCG  WEG
Sbjct  8    TATSRLLLICFAYSFTFFSMTSSVTDPRDAASLRSLMDQWDNTPPSWGGSEDPCGTPWEG  67

Query  236  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  415
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNIL  127

Query  416  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  595
            IL GCGF G IP+ IG L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNEIGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  596  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +S G++PGLD+L+  KHFHF  N+ SG IP +
Sbjct  188  ISSGSSPGLDLLLKAKHFHFNKNQLSGTIPPK  219



>ref|XP_002864013.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40272.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 154/215 (72%), Gaps = 6/215 (3%)
 Frame = +2

Query  62   MIPRIQ----LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  229
            M  RI+    +L+V  F Q   + AFT+  +  A++AL++ W   P SW EGSDPCG +W
Sbjct  1    MSSRIEALSFMLVVFFFFQRCYVSAFTNGLEASALRALKNEWTRSPKSW-EGSDPCGTNW  59

Query  230  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  409
             G+ C  +RVVS++L + +L G LS  I  LSEL+ILDLS+N  LTG LP  IGNLKKL 
Sbjct  60   VGITCTNNRVVSISLVNHNLEGTLSEYISALSELEILDLSFNTGLTGPLPPNIGNLKKLK  119

Query  410  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  589
            NLILVGCGF G IP+S+GSL +L  L+LN NKF G IP S+G+LS+L W D+ DN++ G 
Sbjct  120  NLILVGCGFSGQIPESVGSLEQLIKLALNSNKFNGTIPASVGRLSKLDWFDIDDNRIEGE  179

Query  590  IPVSDG-NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +P+S+G ++PGLDML+ T+HFHFG NK SG+IP +
Sbjct  180  LPISNGTSSPGLDMLLQTQHFHFGKNKLSGDIPEK  214



>ref|XP_011012973.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Populus euphratica]
Length=978

 Score =   213 bits (542),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 148/204 (73%), Gaps = 5/204 (2%)
 Frame = +2

Query  95   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IPD +G+L++L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S   TPG
Sbjct  132  GSIPDELGNLAELSFLALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPISKNTTPG  191

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD+L+  KHFHF  N+ SG IP +
Sbjct  192  LDLLLNAKHFHFNKNQLSGSIPPE  215



>ref|XP_002323702.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF05463.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=978

 Score =   213 bits (541),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M+L G
Sbjct  24   IFSDTDPSDAAALQSLKKQWQNTPPSWGQSHDPCGAPWEGVTCSNSRITALGLSTMNLKG  83

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LSGDI  L+EL+ LDLS+N +LTGSL    G+L KL  LIL GCGF G IPD +G+L++
Sbjct  84   KLSGDIGGLTELRSLDLSFNTNLTGSLTPRFGDLLKLNILILAGCGFSGSIPDELGNLAE  143

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S   TPGLD+L+  KHFHF
Sbjct  144  LSFLALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPISKNTTPGLDLLLNAKHFHF  203

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP +
Sbjct  204  NKNQLSGSIPPE  215



>ref|XP_009387702.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=961

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 137/188 (73%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD ND   ++++ + W+N PP+W +  DPCG  WEGV C+ +RV +L LS+M + G L+G
Sbjct  23   TDPNDAAVLRSMLNQWENAPPTWGQSDDPCGTPWEGVSCDSTRVTALRLSTMGIKGTLNG  82

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            D+ +L++LQ LDLSYN  L+G L   IGNLK+L   IL GC F G IP  +G+L  L +L
Sbjct  83   DVGQLTQLQSLDLSYNGGLSGPLSASIGNLKQLTTFILAGCSFSGSIPQELGNLKLLSFL  142

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN NKF G IP SLG LS LYWLDLADNQLTGS+P+S  +TPGLD+LVGTKHFHF  N+
Sbjct  143  ALNSNKFSGRIPASLGLLSNLYWLDLADNQLTGSLPISTNSTPGLDLLVGTKHFHFNKNQ  202

Query  668  FSGEIPAQ  691
             SGEIP Q
Sbjct  203  LSGEIPEQ  210



>ref|XP_002864014.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40273.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=953

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 149/205 (73%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+  F Q   + A T+  D  A+ AL+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLIMFFFQICSVSALTNGLDSSALNALKAEWTSPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLNLEGKLQPDISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG L +L YLSLNLN+F G IP S+GQLS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GQIPESIGMLKELIYLSLNLNQFSGTIPASIGQLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ TKHFHFG NK SG+IP +
Sbjct  188  GLDMLLQTKHFHFGKNKLSGKIPKE  212



>emb|CDM81495.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNAQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +PV DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPVFDGTNPG  185

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD L  TKHFHFG N+ SG IP+Q
Sbjct  186  LDNLTNTKHFHFGVNQLSGTIPSQ  209



>ref|XP_006300598.1| hypothetical protein CARUB_v10019721mg, partial [Capsella rubella]
 gb|EOA33496.1| hypothetical protein CARUB_v10019721mg, partial [Capsella rubella]
Length=982

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = +2

Query  44   MVI**TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDP  214
            MV   T+    +LLL+     F  F    + TD  D  ++++L D W N PPSW    DP
Sbjct  9    MVASNTVTATSRLLLICFSYSFTVFSLTSSVTDPRDAASLRSLMDQWDNTPPSWGGSDDP  68

Query  215  CGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN  394
            CG  WEGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+
Sbjct  69   CGTPWEGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGD  128

Query  395  LKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADN  574
            L+KL  LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADN
Sbjct  129  LQKLNILILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADN  188

Query  575  QLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            QLTG IP+S G++PGLD+L+  KHFHF  N+ SG IP +
Sbjct  189  QLTGPIPISSGSSPGLDLLLKAKHFHFNKNQLSGTIPPK  227



>emb|CDM81501.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNAQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +PV DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPVFDGTNPG  185

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD L  TKHFHFG N+ SG IP+Q
Sbjct  186  LDNLTNTKHFHFGVNQLSGTIPSQ  209



>emb|CDY49740.1| BnaA02g19320D [Brassica napus]
Length=1396

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 138/198 (70%), Gaps = 0/198 (0%)
 Frame = +2

Query  98   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  277
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  472  FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS  531

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  532  TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  591

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG  637
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+L+ 
Sbjct  592  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDLLLK  651

Query  638  TKHFHFGXNKFSGEIPAQ  691
             KHFHF  N+ SG IP +
Sbjct  652  AKHFHFNKNQLSGTIPPK  669



>gb|KHN40741.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=945

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  298
            VA   N+D+  +K+LR  W +  P+W EGSDPC D WEG+ C  SRV+S++LS + LTG 
Sbjct  22   VAQDVNSDFAVLKSLRGSWLSPTPNW-EGSDPCKD-WEGIKCKNSRVISISLSDIGLTGH  79

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            LSGDI  LSEL+ILDLSYN+ LTGSLP+EIGNLKKL  L+LVGCGF G IPD IG L +L
Sbjct  80   LSGDIGSLSELEILDLSYNRGLTGSLPQEIGNLKKLLKLVLVGCGFTGRIPDEIGFLEQL  139

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG  658
             +LSLN N F+GPIPPS+G LS L WLDLADNQL GSIPVS G T GLDML  T HFH G
Sbjct  140  VFLSLNSNNFVGPIPPSIGNLSNLTWLDLADNQLDGSIPVSSGTTSGLDMLQKTLHFHLG  199

Query  659  XNKFSGEIPAQ  691
             N+ SGEIP +
Sbjct  200  KNRLSGEIPPK  210



>emb|CDY22287.1| BnaC02g25910D [Brassica napus]
Length=1719

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 138/198 (70%), Gaps = 0/198 (0%)
 Frame = +2

Query  98   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  277
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  381  FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNSSRITALGLS  440

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  441  TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  500

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG  637
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+L+ 
Sbjct  501  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDLLLK  560

Query  638  TKHFHFGXNKFSGEIPAQ  691
             KHFHF  N+ SG IP +
Sbjct  561  AKHFHFNKNQLSGTIPPK  578


 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  506  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+L+  KHFHF  N+ SG IP
Sbjct  916  FTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDLLLKAKHFHFNKNQLSGTIP  975

Query  686  AQ  691
             +
Sbjct  976  PK  977



>ref|XP_006402241.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
 gb|ESQ43694.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
Length=964

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 153/207 (74%), Gaps = 2/207 (1%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            + +LL  LF Q   + A T+ +D  A++AL+  W   P SW +GSDPCG +W G+ C+  
Sbjct  7    VCMLLTLLFFQNCFVSALTNGSDASALQALKSDWSRFPESW-KGSDPCGTNWVGITCSND  65

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            R+VS++L +++L G+LS DI  L+ELQILDL+ N  L+G LP  IGNLKKL  L L+GCG
Sbjct  66   RIVSISLGNINLEGKLSADISALAELQILDLTSNPKLSGPLPPNIGNLKKLNTLNLMGCG  125

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-N  610
            F G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L+W D+ADNQ+ G++PVS+G +
Sbjct  126  FSGQIPESIGSLEQLTTLSLNSNKFSGTIPASIGRLSKLFWFDIADNQIEGTVPVSNGTS  185

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +PGLDML+ TKHFHFG NK SG+IP +
Sbjct  186  SPGLDMLLETKHFHFGNNKLSGDIPEK  212



>gb|KHG12756.1| hypothetical protein F383_03913 [Gossypium arboreum]
 gb|KHG27402.1| hypothetical protein F383_16446 [Gossypium arboreum]
Length=959

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 145/205 (71%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L L+ + I    + A TD +D  +++A+   WKNVP +W  G DPC D W G+GC GSRV
Sbjct  7    LFLLVVSIHIYIVTAETDPDDNSSLRAVMSEWKNVPSNWGRG-DPCDDKWVGIGCTGSRV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ L +M L G L GDI  LSEL+ LDLSYNK L G LP  + NLKKL NLILVGCGF 
Sbjct  66   TSINLPNMKLEGGLVGDIFFLSELKELDLSYNKGLRGILPPAVQNLKKLENLILVGCGFS  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TP  616
            G IPD+IGSL +L+ LSLN N F G IPPS+G LS L WLD+ADNQL G IPVS+G+ TP
Sbjct  126  GQIPDTIGSLPQLRILSLNSNAFSGNIPPSIGNLSTLNWLDMADNQLEGEIPVSNGSTTP  185

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLD L+ TKHFHFG NK SG IP +
Sbjct  186  GLDWLIHTKHFHFGLNKLSGPIPRK  210



>dbj|BAJ89467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L+L  + +Q   ++A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LVLFGILVQASVVLADTNAQDTAGLTGIAASWDTRPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +P+ DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPIFDGTNPG  185

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD L  TKHFHFG N+ SG IP+Q
Sbjct  186  LDNLTNTKHFHFGLNQLSGTIPSQ  209



>dbj|BAJ94480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L+L  + +Q   ++A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LVLFGILVQASVVLADTNAQDTAGLTGIAASWDTRPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +P+ DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPIFDGTNPG  185

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD L  TKHFHFG N+ SG IP+Q
Sbjct  186  LDNLTNTKHFHFGLNQLSGTIPSQ  209



>ref|XP_008804684.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=562

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 135/188 (72%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD  D  A+++L + W+  PPSW +  DPCG  W GV C+ SRV  L LS+M + G LSG
Sbjct  24   TDPQDAAALRSLMNQWQAAPPSWGQSDDPCGMPWNGVICSKSRVTILRLSTMGIKGTLSG  83

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +L++LQ LDLSYN DL G L   IGNLK+L  LILVGC F G IP  +G+L++L +L
Sbjct  84   DIGQLTKLQSLDLSYNSDLGGPLTPNIGNLKELTTLILVGCNFSGTIPSELGNLAELSFL  143

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
             LN N+F G IP SLG LS LYWLDLA+N+LTG +P+S G TPGLD+L+ TKHFHF  N+
Sbjct  144  DLNSNQFTGNIPASLGNLSNLYWLDLANNKLTGMLPISKGTTPGLDLLINTKHFHFNKNQ  203

Query  668  FSGEIPAQ  691
             SG+IP Q
Sbjct  204  LSGQIPEQ  211



>emb|CDP08081.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   210 bits (535),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 144/204 (71%), Gaps = 2/204 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L  + +  +F GI ++TD  D   +++L+D W+N PP+W +  DPCG  WEGV CN SRV
Sbjct  8    LFYLVMSARFRGIFSYTDPRDVAVLRSLKDQWQNTPPNWGKSDDPCGAPWEGVSCNNSRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             +L LSSM L+G+L+GDI  L+EL  LDLS+N+ LTGSL   IG+L+ L  LIL GC F 
Sbjct  68   TALGLSSMGLSGKLNGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQNLSILILAGCSFN  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG--NT  613
            G +P  +G+L++L +L+LN N F G IPPSLG+LS LYWLDLADNQLTG IPVS     T
Sbjct  128  GNVPSELGNLAQLSFLALNSNNFTGGIPPSLGKLSHLYWLDLADNQLTGPIPVSSSMTET  187

Query  614  PGLDMLVGTKHFHFGXNKFSGEIP  685
            PGLD+L   KHFHF  N+ SG IP
Sbjct  188  PGLDLLKKAKHFHFNKNQLSGPIP  211



>ref|XP_003535032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=945

 Score =   209 bits (533),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  298
            VA   N+D++ +K+LR  W +  P+W EGSDPC D WEG+ C  SRV+S++L  + LTG 
Sbjct  22   VAQDVNSDFLVLKSLRGSWLSPTPNW-EGSDPCKD-WEGIKCKNSRVISISLPDIGLTGH  79

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            LSGDI  LSEL+ILDLSYN+ LTGSLP+EIGNLKKL  L+LVGCGF G IPD IG L +L
Sbjct  80   LSGDIGSLSELEILDLSYNRGLTGSLPQEIGNLKKLLKLVLVGCGFTGRIPDEIGFLEQL  139

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG  658
             +LSLN N F+GPIPPS+G LS L WLDLADNQL GSIPVS G T GLDML  T HFH G
Sbjct  140  VFLSLNSNNFVGPIPPSIGNLSNLTWLDLADNQLDGSIPVSSGTTSGLDMLQKTLHFHLG  199

Query  659  XNKFSGEIPAQ  691
             N+ SGEIP +
Sbjct  200  KNRLSGEIPPK  210



>ref|XP_010484994.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Camelina sativa]
Length=846

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 149/205 (73%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFHICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            +S++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEGKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ TKHFHFG NK SG+IP +
Sbjct  188  GLDMLLATKHFHFGKNKLSGKIPKE  212



>ref|XP_010482269.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=955

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 150/205 (73%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            ++L+ LF     +   T+  D  A++A++  W   P +W EGSDPCG +W G+ C+  R+
Sbjct  13   MILILLFFHICCVYGLTNGPDATALQAVKSEWTKFPKNW-EGSDPCGTNWVGITCSNDRI  71

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            VS++L ++DL G+LS DI  LSELQILDL+ N +LTG LP  IGNLKKL  L L+GCGF 
Sbjct  72   VSISLGNVDLEGKLSADIAALSELQILDLTSNPNLTGPLPPNIGNLKKLVILNLMGCGFS  131

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIGSL +L  LSLN NKFIG IP S+G+LS+L+WLD+ADNQ+ G +PVS+G ++P
Sbjct  132  GQIPESIGSLEQLTTLSLNSNKFIGTIPASIGRLSQLFWLDIADNQIEGKLPVSNGTSSP  191

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+   HFHFG NK SG+IP +
Sbjct  192  GLDMLLEAGHFHFGNNKLSGDIPEK  216



>gb|KCW47574.1| hypothetical protein EUGRSUZ_K01321 [Eucalyptus grandis]
Length=955

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 144/207 (70%), Gaps = 1/207 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            R+   L  L      I +FTD  D  A++ALR  W+N PPSWA+  DPCG  W+GV CN 
Sbjct  3    RLVFFLAILLAGIHVICSFTDPGDSAALQALRGIWQNTPPSWAK-DDPCGVPWDGVTCNN  61

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
             RV +L LSSM++ G LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L  L  LIL GC
Sbjct  62   LRVTALGLSSMNIKGSLSGDIGGLTELRSLDLSFNQDLTGSLTARLGDLSNLNTLILQGC  121

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPD +G LS+L +L+LN NKF G IP SLG LS+L WLDLA+NQLTGSIP+S  N
Sbjct  122  GFTGNIPDELGKLSQLTFLALNNNKFTGSIPASLGNLSQLSWLDLAENQLTGSIPLSHNN  181

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             PGLD L+  KHFHF  N+ SG IP +
Sbjct  182  NPGLDHLLNAKHFHFNKNQLSGPIPRE  208



>ref|XP_010038738.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=959

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 144/207 (70%), Gaps = 1/207 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            R+   L  L      I +FTD  D  A++ALR  W+N PPSWA+  DPCG  W+GV CN 
Sbjct  3    RLVFFLAILLAGIHVICSFTDPGDSAALQALRGIWQNTPPSWAK-DDPCGVPWDGVTCNN  61

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
             RV +L LSSM++ G LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L  L  LIL GC
Sbjct  62   LRVTALGLSSMNIKGSLSGDIGGLTELRSLDLSFNQDLTGSLTARLGDLSNLNTLILQGC  121

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPD +G LS+L +L+LN NKF G IP SLG LS+L WLDLA+NQLTGSIP+S  N
Sbjct  122  GFTGNIPDELGKLSQLTFLALNNNKFTGSIPASLGNLSQLSWLDLAENQLTGSIPLSHNN  181

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             PGLD L+  KHFHF  N+ SG IP +
Sbjct  182  NPGLDHLLNAKHFHFNKNQLSGPIPRE  208



>ref|XP_010429861.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=973

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 142/212 (67%), Gaps = 1/212 (0%)
 Frame = +2

Query  59   TMIPRIQLLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
            T   R+ L+        L + +  TD  D  ++++L D W N PPSW    DPCG  WEG
Sbjct  8    TATSRLLLICFAYSFSVLSMTSSVTDPRDAASLRSLMDQWDNTPPSWGGSDDPCGTPWEG  67

Query  236  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  415
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LD+S+N  LTGSL   +G+L KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDISFNPGLTGSLTSRLGDLPKLNIL  127

Query  416  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  595
            IL GCGF G IP+ IG L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNEIGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  596  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +S G++PGLD+L+  KHFHF  N+ SG IP +
Sbjct  188  ISSGSSPGLDLLLKAKHFHFNKNQLSGTIPPK  219



>ref|XP_010688349.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=962

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 146/207 (71%), Gaps = 0/207 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            R+ LL +  F +   I+  TD+ D  A+ +L+  W+N PPSW++  DPC   WEGV CN 
Sbjct  5    RVLLLCLLGFAKVNLILCLTDSGDAAALHSLKAQWQNTPPSWSKSDDPCAAPWEGVTCNK  64

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SR+ +L LS+M L G+LSGDI  L+EL+ LDLS+N+ LTGSL   +G+L+KL  LIL GC
Sbjct  65   SRITALGLSTMGLKGKLSGDIGGLTELRSLDLSFNRGLTGSLTPRLGDLQKLNILILAGC  124

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
             F G IP  +G+L++L +L+LN N   G IP SLG LS+LYWLDLADNQL+GSIP S  N
Sbjct  125  SFSGSIPMELGNLAELSFLALNSNNLTGEIPHSLGNLSKLYWLDLADNQLSGSIPTSTPN  184

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGLD+L   KHFHF  N+ SG IP++
Sbjct  185  TPGLDLLRKAKHFHFNKNRLSGSIPSE  211



>ref|XP_010921260.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=602

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 143/205 (70%), Gaps = 1/205 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  256
            LLL+ +F+  L + +  TD  D   +++L   W+N PP+W +  DPCG  W GV C+ SR
Sbjct  5    LLLLLVFVAGLQVSSGTTDLTDAAVLRSLMGEWQNTPPNWGQSDDPCGTPWIGVNCSNSR  64

Query  257  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  436
            V  L LS+M L G LSGDI +LSELQILDLSYNK+L G LP  IGNLKK+  LIL+GC F
Sbjct  65   VTVLKLSTMGLKGTLSGDIGQLSELQILDLSYNKELGGQLPANIGNLKKINTLILIGCNF  124

Query  437  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  616
             G IP+ +G++  L +L+LN NKF G IP SLG LS LY LD+ADNQL+G IP+S+  TP
Sbjct  125  GGEIPEELGNIGNLSFLALNSNKFTGRIPASLGTLSHLYLLDVADNQLSGPIPISNNGTP  184

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLD L+ TKHFH   N+ SG IP +
Sbjct  185  GLDQLLHTKHFHLNKNQLSGPIPEE  209



>ref|XP_004960772.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=962

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 140/204 (69%), Gaps = 1/204 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L L  + +Q   I+A TD  D   + A+   WKN P +W  G DPC D W G+ C G+RV
Sbjct  8    LFLFSVLVQTSAILADTDPGDSAGLTAIAANWKNKPSNW-NGDDPCRDKWIGIICTGNRV  66

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ LSS  L+G LSGDI+ L+EL  LDLSYNKDL+G LP  IG+L  L NLILVGC F 
Sbjct  67   TSIRLSSFGLSGTLSGDIQTLTELVYLDLSYNKDLSGPLPSTIGSLSNLQNLILVGCSFS  126

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IP  +G LSKL +LSLN NKF G IP SLG LS+LYW DLADN+LTG++P+ DG  PG
Sbjct  127  GEIPKELGQLSKLIFLSLNSNKFSGSIPASLGNLSKLYWFDLADNKLTGTLPIFDGTNPG  186

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD L  TKHFHFG N+ SG IP +
Sbjct  187  LDNLTNTKHFHFGINQLSGTIPRE  210



>ref|XP_008804670.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
 ref|XP_008804671.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=951

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 137/188 (73%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD  D  A+++L + W+  PPSW +  DPCG  W+GV C+ SRV  L LS+M + G LSG
Sbjct  13   TDPQDAAALRSLMNQWQAAPPSWGQSDDPCGMPWDGVVCSKSRVTVLRLSTMGIKGTLSG  72

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +L++LQ LDLSYN DL G L   IGNLK+L  LILVGC F G +P  +G+L++L +L
Sbjct  73   DIGQLTKLQSLDLSYNNDLRGPLAPNIGNLKELTTLILVGCSFSGTLPSELGNLAELSFL  132

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
             LN N+F G IP SLG LS LYWLDLA+N+LTG++P+S G TPGLD+L+ TKHFHF  N+
Sbjct  133  DLNSNQFTGKIPGSLGSLSNLYWLDLANNKLTGTLPISKGTTPGLDLLINTKHFHFNKNQ  192

Query  668  FSGEIPAQ  691
             SG+IP Q
Sbjct  193  LSGQIPEQ  200



>ref|XP_010938089.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=986

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 142/205 (69%), Gaps = 1/205 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGI-VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  256
            LLL+  F+  L +    TD  D  A+++L D W+N PP+W +  DPCG  W GV C+GSR
Sbjct  29   LLLLLAFVSGLRVGYGITDPTDAAALRSLIDTWQNTPPNWGQSDDPCGTPWVGVSCHGSR  88

Query  257  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  436
            V +LTLS+M L G LSGDI +LSELQ LDLSYN +L G L   IGNLKKL  LIL+GC F
Sbjct  89   VTALTLSTMGLKGILSGDIGQLSELQSLDLSYNNELGGPLTANIGNLKKLATLILLGCSF  148

Query  437  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  616
             G IPD +G+L KL YL+LN NKF G IP SLG LS LY LD++DNQL+G IP+S+   P
Sbjct  149  SGQIPDELGNLGKLSYLALNSNKFTGSIPASLGTLSNLYCLDVSDNQLSGPIPISNNGAP  208

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLD L+  KHFHF  NK SG IP  
Sbjct  209  GLDQLLQAKHFHFSKNKLSGPIPEH  233



>ref|XP_010044506.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 ref|XP_010044514.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW88495.1| hypothetical protein EUGRSUZ_A00882 [Eucalyptus grandis]
Length=968

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 150/208 (72%), Gaps = 2/208 (1%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            I L+ V LF + L +V +FT+ +D VA+++L+  W+N PPSW   SDPCG  WEGV CN 
Sbjct  9    IFLVAVLLFGKDLQLVFSFTNPDDSVALQSLKMSWQNTPPSWERSSDPCGLPWEGVTCNS  68

Query  251  -SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRV SL LS+M + G+L  +I  L+EL+ LDLS+NK+LTG L R++GNL+KL  LIL G
Sbjct  69   NSRVTSLGLSTMGIKGQLISEIAGLAELRSLDLSFNKELTGPLARQLGNLQKLNILILAG  128

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F G IPD +G+L++L +L+LN N   G IP SLG LS+LYW DLADNQLTG IP+S  
Sbjct  129  CSFTGSIPDELGNLAELSFLALNSNNLTGNIPASLGNLSKLYWFDLADNQLTGPIPISTD  188

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             +PGLD+L+  KHFHF  NK SG IP +
Sbjct  189  TSPGLDLLLKAKHFHFNKNKLSGPIPEK  216



>ref|XP_010441071.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 149/205 (73%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFYICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            +S++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEGKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ TKHFHFG N+ SG+IP +
Sbjct  188  GLDMLLATKHFHFGKNRLSGKIPKE  212



>ref|XP_010922852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=962

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 148/207 (71%), Gaps = 1/207 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            ++ LL+ +++  L + +  TD  D  A+++L + W+  PPSW + +DPCG  W+GV C+ 
Sbjct  5    VRFLLLFMWLSGLQLCSCDTDQQDAAALRSLMNQWQAAPPSWGQSNDPCGVPWDGVVCSN  64

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SRV  L LS+M + G LSGDI +L++LQ LDLSYN +L G     IGNLK+L  LILVGC
Sbjct  65   SRVTVLRLSTMGIKGTLSGDIAQLTKLQSLDLSYNGELGGPFTPNIGNLKELTTLILVGC  124

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
             F G IP  +G+L++L +L LN N+F G IP SLG LS LYWLDLA+N+LTG++P+S+G 
Sbjct  125  SFSGTIPSELGNLAELSFLDLNSNQFTGNIPASLGNLSNLYWLDLANNKLTGTLPISEGT  184

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            TPGLD+L+ TKHFHF  N+ SG IP Q
Sbjct  185  TPGLDLLINTKHFHFNKNQLSGPIPEQ  211



>ref|XP_007206754.1| hypothetical protein PRUPE_ppa025198mg [Prunus persica]
 gb|EMJ07953.1| hypothetical protein PRUPE_ppa025198mg [Prunus persica]
Length=416

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 138/192 (72%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I + TD ND   + +L++ W+N PPSW + +DPC   WEGV CN SRV  L LS++ L G
Sbjct  21   ISSVTDPNDAAVLLSLKNSWQNTPPSWDKSNDPCDSRWEGVTCNNSRVSGLGLSNISLKG  80

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +L GDI  L EL+ LDLS+N  LTG L   +GNLK L  LIL GC F G IPD +G+L++
Sbjct  81   KLYGDIGGLIELKSLDLSFNPGLTGPLSPRLGNLKNLSILILAGCSFNGEIPDELGNLAE  140

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG+IP+S  ++PGLD+L+  KHFH 
Sbjct  141  LSFLALNSNNFSGVIPPSLGKLSKLYWLDLADNQLTGTIPISTYHSPGLDLLLKAKHFHL  200

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP++
Sbjct  201  NKNQLSGIIPSK  212



>ref|XP_010113026.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXC35197.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=964

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            ++QLLL  +      + ++T+ ND   + +L++ W+N PPSW E  DPCG  WEGV CN 
Sbjct  5    KLQLLLAFVCAGIYLVSSYTNPNDVAVLHSLKEAWENTPPSWEESDDPCGGQWEGVKCND  64

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SRV +L+LS+M L G+L GDI  L EL+ LDLSYNKDLTG L   +G+L+ L  LIL GC
Sbjct  65   SRVTALSLSTMGLKGKLDGDIGGLIELRSLDLSYNKDLTGPLSPRLGDLQNLNILILAGC  124

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
             F G IP+ +G+L  L +L+LN N F G IP +LG+LS +YW D++DNQLTGS+P+S   
Sbjct  125  RFSGKIPEELGNLKSLSFLALNSNNFTGSIPATLGKLSNVYWFDVSDNQLTGSLPISTPT  184

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIP  685
            T GLD+L+  KHFHF  N+ SG IP
Sbjct  185  TSGLDLLLKAKHFHFNKNQLSGAIP  209



>ref|XP_010442444.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 148/205 (72%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFHICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            +S++L +++L  +L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEAKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ TKHFHFG NK SG+IP +
Sbjct  188  GLDMLLATKHFHFGKNKLSGKIPKE  212



>ref|XP_011012970.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Populus euphratica]
Length=984

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 147/210 (70%), Gaps = 11/210 (5%)
 Frame = +2

Query  95   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  440  GLIPDSIGsls------klkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            G IPD +G+L+       L++ +LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S
Sbjct  132  GSIPDELGNLAELSFFTTLRHRALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPIS  191

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
               TPGLD+L+  KHFHF  N+ SG IP +
Sbjct  192  KNTTPGLDLLLNAKHFHFNKNQLSGSIPPE  221



>ref|XP_011012972.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=979

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 147/210 (70%), Gaps = 11/210 (5%)
 Frame = +2

Query  95   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  440  GLIPDSIGsls------klkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            G IPD +G+L+       L++ +LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S
Sbjct  132  GSIPDELGNLAELSFFTTLRHRALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPIS  191

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
               TPGLD+L+  KHFHF  N+ SG IP +
Sbjct  192  KNTTPGLDLLLNAKHFHFNKNQLSGSIPPE  221



>emb|CDY12940.1| BnaA09g13340D [Brassica napus]
Length=931

 Score =   207 bits (526),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 154/214 (72%), Gaps = 5/214 (2%)
 Frame = +2

Query  62   MIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
            M  RIQ  +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G
Sbjct  5    MRSRIQVCMLLILTFCQICSVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVG  63

Query  236  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  412
            + CN +  V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  
Sbjct  64   ITCNNNNHVISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTT  123

Query  413  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  592
            L L+ CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+I
Sbjct  124  LNLMECGFSGEIPESIGSLEQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTI  183

Query  593  PVSDG-NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            PVS+G ++PGLDML+ TKHFHFG NK SG+IP +
Sbjct  184  PVSNGTSSPGLDMLLETKHFHFGNNKLSGDIPEK  217



>ref|XP_006358564.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=950

 Score =   207 bits (526),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 142/210 (68%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  R  + L+    Q L I+  T++ND  A+ +L+  W N+PP+W EGSDPCG  W G+ 
Sbjct  4    MGSRSHVFLLIFVSQILAILGQTNSNDATALFSLKSSWNNLPPNW-EGSDPCGSSWAGIV  62

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C+ SRV S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CDNSRVTSIKLSGMGLEGNQFGDLSSLTALQILDLSNNVGLKGTLPPSIGNLKNLTTLIL  122

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGC FFG IP+SIGSL +L ++SL  N F GPIPPS+G LS+L WLDL+DN++ G+IP+S
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKINGTIPIS  182

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             G+T GLD LV T+H H   N+ SG I  Q
Sbjct  183  QGSTLGLDSLVNTRHLHLSKNQLSGLIQPQ  212



>gb|KGN59773.1| hypothetical protein Csa_3G844910 [Cucumis sativus]
Length=771

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 145/205 (71%), Gaps = 1/205 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  256
            L++  LF+ F  + A  TD+ D   +++L+DGW+N PPSW   +DPCG  W+GV C  SR
Sbjct  41   LVVSLLFLDFFYLAASSTDSRDSSVLQSLKDGWQNTPPSWGTSNDPCGTPWDGVICKNSR  100

Query  257  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  436
            VV+L LSSM L G+L GDI  L+EL+ LDL+ N+DL GS+ R +GNL KL  LIL  CGF
Sbjct  101  VVALKLSSMGLKGKLGGDIGGLTELRSLDLAANRDLVGSISRALGNLLKLDTLILSTCGF  160

Query  437  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  616
             G IP+ +G+LS+L +LSL  N F G IP +LG+LS+LYWLDLADNQLTG++PVS   + 
Sbjct  161  SGKIPEELGNLSELTFLSLYSNSFTGTIPATLGKLSKLYWLDLADNQLTGALPVSTSGSS  220

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLD L   KHFHF  N+ SG IP +
Sbjct  221  GLDRLYMAKHFHFSNNQLSGTIPPE  245



>ref|NP_199786.2| Leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AED95853.1| Leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=493

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +2

Query  59   TMIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWE  232
            TM  RI+  +LL+  F Q   + A T+  D  A++ +++ W   P  W EGSDPCG +W 
Sbjct  57   TMSSRIRTCMLLILFFFQKCYVSALTNVFDASALRGMKNEWTRSPKGW-EGSDPCGTNWV  115

Query  233  GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  412
            G+ C   RVVS++L + +L G LS  I  LSEL+ILDLS+N  LTG LP  IG+LKKL N
Sbjct  116  GITCTNDRVVSISLVNHNLEGTLSEYILALSELEILDLSFNIGLTGPLPSNIGDLKKLKN  175

Query  413  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  592
            LILVGCG  G IPDSIGSL ++  LSLNLNKF G IP S+G+LS+L W D+A+NQ+ G +
Sbjct  176  LILVGCGLSGQIPDSIGSLEQIINLSLNLNKFSGTIPASIGRLSKLDWFDIAENQIEGEL  235

Query  593  PVSDG-NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            P+S+G ++PGLDML  T+HFHFG NK SG IP +
Sbjct  236  PISNGTSSPGLDMLTQTQHFHFGKNKLSGHIPEK  269



>ref|XP_009417853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Musa acuminata subsp. malaccensis]
Length=841

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD LV TKHFHF  N+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQLVHTKHFHFNKNQ  201

Query  668  FSGEIP  685
             SG IP
Sbjct  202  LSGSIP  207



>ref|XP_004249557.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=964

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   IYTVTDPRDVTILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G LS+
Sbjct  80   KLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPRELGRLSE  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IP +LG LS+LYWLDLADNQLTG IPVS  ++PGLD+L   KHFHF
Sbjct  140  LSFLALNSNNFTGEIPRTLGNLSKLYWLDLADNQLTGPIPVSTFSSPGLDLLKKAKHFHF  199

Query  656  GXNKFSGEIP  685
              N+ SG IP
Sbjct  200  NKNQLSGSIP  209



>ref|XP_010482274.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Camelina sativa]
Length=800

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = +2

Query  101  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  277
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDMLV  634
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDML 
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDMLH  194

Query  635  GTKHFHFGXNKFSGEIPAQ  691
              KHFHFG NK S  IP +
Sbjct  195  QAKHFHFGNNKLSDSIPEK  213



>ref|XP_010314121.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Solanum lycopersicum]
Length=950

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 141/210 (67%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  R  + L+    Q L I+  T++ND  A+ AL+  W N+PP+W EGSDPCG  W G+ 
Sbjct  4    MGSRSHVFLLIFVSQILAILGQTNSNDATALFALKSSWNNLPPNW-EGSDPCGSSWAGLI  62

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C+ SRV S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CDNSRVTSIKLSGMGLEGNQFGDLSSLAALQILDLSNNVGLKGTLPPSIGNLKNLTTLIL  122

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGC FFG IP+SIGSL +L ++SL  N F GPIPPS+G LS+L WLDL+DN++ G+IP+S
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKINGTIPIS  182

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             G+  GLD LV T+H H   NK SG I  Q
Sbjct  183  QGSALGLDSLVNTRHLHLSKNKLSGLIQPQ  212



>emb|CDY21452.1| BnaC03g27450D [Brassica napus]
Length=953

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 142/192 (74%), Gaps = 2/192 (1%)
 Frame = +2

Query  113  GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT  292
             + A T+  D  A++AL+  W   P SW EG DPCG  W G+ C   RVVS++L ++++ 
Sbjct  20   SVSALTNGFDGAALQALKAEWTKPPSSW-EGDDPCGTSWVGITCISDRVVSISLGNLNVE  78

Query  293  GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGsls  472
            G+LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F G IP+SIG L 
Sbjct  79   GKLSGDIAALSELQILDLSYNTGLTGPLPPNIGEAKKLKNLILVGCSFTGQIPESIGKLE  138

Query  473  klkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDMLVGTKHF  649
            +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++PGLDML+ TKHF
Sbjct  139  QLIYLSLNLNQFSGTIPVSIGRLSKLYWFDIADNQIEGTLPVSNGTSSPGLDMLLETKHF  198

Query  650  HFGXNKFSGEIP  685
            HFG NK SG IP
Sbjct  199  HFGKNKLSGHIP  210



>ref|XP_009417851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Musa acuminata subsp. malaccensis]
Length=933

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD LV TKHFHF  N+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQLVHTKHFHFNKNQ  201

Query  668  FSGEIP  685
             SG IP
Sbjct  202  LSGSIP  207



>ref|XP_009417852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Musa acuminata subsp. malaccensis]
Length=928

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD LV TKHFHF  N+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQLVHTKHFHFNKNQ  201

Query  668  FSGEIP  685
             SG IP
Sbjct  202  LSGSIP  207



>ref|XP_009417849.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Musa acuminata subsp. malaccensis]
Length=958

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD LV TKHFHF  N+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQLVHTKHFHFNKNQ  201

Query  668  FSGEIP  685
             SG IP
Sbjct  202  LSGSIP  207



>ref|XP_009761326.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=961

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 135/188 (72%), Gaps = 0/188 (0%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
            + TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G+L
Sbjct  22   SVTDPRDVAILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRGKL  81

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            SGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G L++L 
Sbjct  82   SGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPRELGKLAELS  141

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            +L+LN N F G IP +LG L++LYWLDLADNQLTG IPVS  ++PGLD+L   KHFHF  
Sbjct  142  FLALNSNNFTGEIPRTLGNLAKLYWLDLADNQLTGPIPVSTSSSPGLDLLKKAKHFHFNK  201

Query  662  NKFSGEIP  685
            N+ SG IP
Sbjct  202  NQLSGSIP  209



>ref|XP_010482273.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Camelina sativa]
Length=950

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = +2

Query  101  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  277
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDMLV  634
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDML 
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDMLH  194

Query  635  GTKHFHFGXNKFSGEIPAQ  691
              KHFHFG NK S  IP +
Sbjct  195  QAKHFHFGNNKLSDSIPEK  213



>ref|XP_010482272.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=953

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = +2

Query  101  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  277
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDMLV  634
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDML 
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDMLH  194

Query  635  GTKHFHFGXNKFSGEIPAQ  691
              KHFHFG NK S  IP +
Sbjct  195  QAKHFHFGNNKLSDSIPEK  213



>ref|XP_010482271.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
Length=954

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = +2

Query  101  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  277
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDMLV  634
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDML 
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDMLH  194

Query  635  GTKHFHFGXNKFSGEIPAQ  691
              KHFHFG NK S  IP +
Sbjct  195  QAKHFHFGNNKLSDSIPEK  213



>ref|XP_006664421.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Oryza brachyantha]
Length=912

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 138/204 (68%), Gaps = 1/204 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +    + ++     A T+  D   +  +   W + P +W  G DPCGD W G+ C G+RV
Sbjct  8    IFFFSVLVEAFVASADTNAQDTSGLNGIAGSWDSRPSNW-NGLDPCGDKWIGIICTGNRV  66

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ LSS  L+G LSGDI+ L+ELQ LDLSYNK+L G+LP  IG L KL NLILVGC F 
Sbjct  67   TSIRLSSFGLSGTLSGDIQSLTELQYLDLSYNKNLRGTLPSTIGTLSKLQNLILVGCSFT  126

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IP  IG LS L +LSLN NKF G IPPSLG LS+LYW DLADNQLTG +P+S+  +PG
Sbjct  127  GEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPISNLTSPG  186

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD L  TKHFHFG N+ SG IP+Q
Sbjct  187  LDNLTNTKHFHFGMNQLSGSIPSQ  210



>ref|XP_009600216.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=964

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 135/193 (70%), Gaps = 0/193 (0%)
 Frame = +2

Query  107  FLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMD  286
            F  I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M 
Sbjct  17   FHLIYTVTDPRDVAILRSLKDQWENTPPSWQKSDDPCGTTWEGVTCNNSRVTALGLSTMG  76

Query  287  LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGs  466
            L G+LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+ L  LIL GC F G IP  +G 
Sbjct  77   LRGKLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQNLNILILAGCSFSGSIPRELGK  136

Query  467  lsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH  646
            L++L +L+LN N F G IP +LG L++LYWLDLADNQLTG IPVS  ++PGLD+L   KH
Sbjct  137  LAELSFLALNSNNFTGEIPRTLGNLAKLYWLDLADNQLTGQIPVSTSSSPGLDLLKKAKH  196

Query  647  FHFGXNKFSGEIP  685
            FHF  N+ SG IP
Sbjct  197  FHFNKNQLSGSIP  209



>ref|XP_011461103.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461104.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461105.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=939

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 144/201 (72%), Gaps = 2/201 (1%)
 Frame = +2

Query  89   VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSL  268
            V + +Q L I A  +  +Y  ++ L D W   PPSW   +DPC D WEG+ C  SR+ +L
Sbjct  12   VLVLLQVLFIAAEANTQEYGYMQILMDEWNIKPPSWV-SADPC-DGWEGIKCTNSRITAL  69

Query  269  TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI  448
             L++M L G+LS DIE LSEL+IL+LS+NK L+G L   IG LKKL +L LVGC FFG I
Sbjct  70   VLANMGLKGQLSTDIELLSELRILNLSFNKGLSGQLRASIGKLKKLVHLNLVGCSFFGPI  129

Query  449  PDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  628
            PD+IGSL+KL YLSL  N F GPIPPS+G LS L ++DL+DN+L GSIPVS+G TPGLDM
Sbjct  130  PDAIGSLTKLSYLSLKNNSFSGPIPPSIGNLSNLTFIDLSDNKLQGSIPVSNGTTPGLDM  189

Query  629  LVGTKHFHFGXNKFSGEIPAQ  691
            L+  KHFHFG N+ SG IP +
Sbjct  190  LLKAKHFHFGNNQLSGPIPPR  210



>gb|KHN40213.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=944

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  7    TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTSLAGQLSG  64

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  65   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  124

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPVS G+  GLD L   KHFH G N 
Sbjct  125  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPVSSGDISGLDKLHHAKHFHLGKNN  184

Query  668  FSGEIPAQ  691
             SG IP Q
Sbjct  185  LSGSIPPQ  192



>ref|XP_009370844.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=959

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 135/192 (70%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ C+GSRV +L LS M++ G
Sbjct  18   ISSSTHLDDANALQSLRQKWINVPPSWDKSNDPCGESWEGITCHGSRVTALGLSGMNVEG  77

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            ++ GDI  LSEL+ LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   KIEGDIAGLSELRFLDLSFNKGLTGSLSPRLGDLSNLNILILAGCSFSGIIPSELGKLGE  137

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PVS G TPGLD L   KHFH 
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPVSSGTTPGLDQLFKAKHFHL  197

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP +
Sbjct  198  NQNQLSGTIPTR  209



>ref|XP_006584124.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
Length=960

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  23   TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTGLAGQLSG  80

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  81   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  140

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPVS G+  GLD L   KHFH G N 
Sbjct  141  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPVSSGDISGLDKLHHAKHFHLGKNN  200

Query  668  FSGEIPAQ  691
             SG IP Q
Sbjct  201  LSGSIPPQ  208



>ref|XP_006584125.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
Length=945

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  23   TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTGLAGQLSG  80

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  81   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  140

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPVS G+  GLD L   KHFH G N 
Sbjct  141  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPVSSGDISGLDKLHHAKHFHLGKNN  200

Query  668  FSGEIPAQ  691
             SG IP Q
Sbjct  201  LSGSIPPQ  208



>ref|XP_006338928.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=964

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   IYTVTDPRDVTILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G L++
Sbjct  80   KLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPMELGRLAE  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IP +LG LS+LYWLDLADNQLTG IPVS  ++ GLD+L   KHFHF
Sbjct  140  LSFLALNSNNFTGEIPQTLGNLSKLYWLDLADNQLTGPIPVSTSSSSGLDLLKKAKHFHF  199

Query  656  GXNKFSGEIP  685
              N+ SG IP
Sbjct  200  NKNQLSGSIP  209



>ref|XP_009761610.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Nicotiana sylvestris]
Length=934

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = +2

Query  146  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  325
             A+ A++  W N+PP+W EGSDPCG  WEG+ CN SRV S+ LS M L G   GD+  L+
Sbjct  15   TALFAIKSSWNNLPPNW-EGSDPCGSSWEGIICNDSRVTSIKLSGMGLEGNQFGDLSSLT  73

Query  326  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  505
             LQILDLS N  L G+LP  IGNLK L  LILVGC FFG IP+SIGSL +L ++SL  N 
Sbjct  74   ALQILDLSNNVGLKGTLPSSIGNLKNLTTLILVGCSFFGQIPESIGSLQQLVFISLTSNS  133

Query  506  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            F G IPPS+G LS+L WLDL+DN+L+G+IPVS G+TPGLD LV T+H H   N+ SG I 
Sbjct  134  FTGSIPPSIGNLSKLSWLDLSDNKLSGTIPVSKGSTPGLDWLVNTRHLHLSKNQLSGRIQ  193

Query  686  AQ  691
            +Q
Sbjct  194  SQ  195



>ref|XP_007154094.1| hypothetical protein PHAVU_003G0900000g, partial [Phaseolus vulgaris]
 gb|ESW26088.1| hypothetical protein PHAVU_003G0900000g, partial [Phaseolus vulgaris]
Length=797

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T + D+  + +L   WKN  P W  GSDPC D WEG+ C  +RV S+TLSS    G LSG
Sbjct  23   TADEDFTTLMSLMSTWKNTSPDWV-GSDPCED-WEGIKCKNTRVTSITLSSTGFGGPLSG  80

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI  LSEL+ILDLSYNKD TG LP  IG L+KL  LILVGC F G IPDSIG+L +L +L
Sbjct  81   DIGSLSELEILDLSYNKDFTGPLPESIGELRKLSTLILVGCNFNGPIPDSIGNLQELLFL  140

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            SLN N+F GPIPPS+G LS+LYWLDLADNQL GSIPVS  +  GLD L   KHFH G N 
Sbjct  141  SLNSNRFSGPIPPSIGSLSKLYWLDLADNQLEGSIPVSGDDIFGLDNLHHAKHFHLGKNN  200

Query  668  FSGEIPAQ  691
             SG IP +
Sbjct  201  LSGTIPPR  208



>ref|XP_007154093.1| hypothetical protein PHAVU_003G0900000g [Phaseolus vulgaris]
 gb|ESW26087.1| hypothetical protein PHAVU_003G0900000g [Phaseolus vulgaris]
Length=874

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            T + D+  + +L   WKN  P W  GSDPC D WEG+ C  +RV S+TLSS    G LSG
Sbjct  23   TADEDFTTLMSLMSTWKNTSPDWV-GSDPCED-WEGIKCKNTRVTSITLSSTGFGGPLSG  80

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI  LSEL+ILDLSYNKD TG LP  IG L+KL  LILVGC F G IPDSIG+L +L +L
Sbjct  81   DIGSLSELEILDLSYNKDFTGPLPESIGELRKLSTLILVGCNFNGPIPDSIGNLQELLFL  140

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            SLN N+F GPIPPS+G LS+LYWLDLADNQL GSIPVS  +  GLD L   KHFH G N 
Sbjct  141  SLNSNRFSGPIPPSIGSLSKLYWLDLADNQLEGSIPVSGDDIFGLDNLHHAKHFHLGKNN  200

Query  668  FSGEIPAQ  691
             SG IP +
Sbjct  201  LSGTIPPR  208



>gb|KJB57522.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=925

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 129/174 (74%), Gaps = 2/174 (1%)
 Frame = +2

Query  173  WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY  352
            WKNVP +W  G DPC D W G+GC GSRV SL L +M L G L GDI  LSEL+ LDLSY
Sbjct  4    WKNVPSNWGRG-DPCDDKWVGIGCTGSRVTSLNLPNMKLEGRLVGDIFFLSELKELDLSY  62

Query  353  NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSL  532
            NK L G LP  + NLKKL NLILVGCGF G IPD+IGSL +L+ LSLN N F G IPPS+
Sbjct  63   NKGLRGILPPAVQNLKKLENLILVGCGFSGQIPDTIGSLPQLRILSLNSNAFSGNIPPSI  122

Query  533  GQLSELYWLDLADNQLTGSIPVSDGN-TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            G LS L WLD+ADNQL G IPVS+G+ TPGLD L+ TKHFHFG NK SG IP +
Sbjct  123  GNLSTLNWLDMADNQLEGEIPVSNGSTTPGLDWLIHTKHFHFGLNKLSGPIPRK  176



>ref|XP_009337850.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
 ref|XP_009337851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=963

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 0/195 (0%)
 Frame = +2

Query  98   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  277
            F +   I + T+ +D  A+++L+  W NVPPSW + SDPCG  WEGV CN SRV +L LS
Sbjct  15   FSRLHVISSVTNPDDASALQSLKQTWSNVPPSWDKSSDPCGAQWEGVTCNDSRVTALGLS  74

Query  278  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  457
            ++++ G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GC F G IP  
Sbjct  75   AINVKGKIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCSFSGSIPSE  134

Query  458  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG  637
            +G+L +L +L+LN N F G IP SLG+LS LYWLDLADNQLTG IPVS    PGLD LV 
Sbjct  135  LGNLKELTFLALNTNNFTGRIPASLGKLSNLYWLDLADNQLTGPIPVSTAVAPGLDQLVK  194

Query  638  TKHFHFGXNKFSGEI  682
             KHFHF  N+ SG I
Sbjct  195  AKHFHFNQNQLSGII  209



>ref|XP_009113087.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=934

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
             + +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G+ CN 
Sbjct  6    EVCMLLILAFCQICYVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVGITCNN  64

Query  251  S-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
            +  V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  L L+ 
Sbjct  65   NNHVISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTTLNLME  124

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+IPVS+G
Sbjct  125  CGFSGEIPESIGSLDQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTIPVSNG  184

Query  608  -NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             ++PGLDML+ TKHFHFG NK SG+IP +
Sbjct  185  TSSPGLDMLLETKHFHFGNNKLSGDIPEK  213



>ref|XP_009416032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            R  + L+    Q L + + TD+ D  A+ AL   WKN+P +W   SDPCGD+W G+ CN 
Sbjct  20   RCLVFLLGFLTQMLVVTSDTDSQDAAALNALATLWKNIPSNW-RSSDPCGDNWVGISCNN  78

Query  251  -SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
             SRV S++LSS+ L G L+GDI+ L+ELQ LDLSYNK LTG LP  IG+L KL NLILVG
Sbjct  79   ESRVTSISLSSLGLKGTLTGDIQYLTELQALDLSYNKGLTGGLPSSIGSLSKLVNLILVG  138

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            C F G IP  IGSLS L +LSLN N F G IP S+G LS LYWLDLADN+L+G+IPVS  
Sbjct  139  CSFSGEIPPEIGSLSLLTFLSLNSNSFTGGIPSSIGNLSNLYWLDLADNKLSGTIPVS--  196

Query  608  NTPGLDMLVGTKHFHFGXNKFSGEIP  685
              PGLD L  TKHFHFG N+ SG IP
Sbjct  197  --PGLDSLTYTKHFHFGMNQLSGTIP  220



>emb|CDP16125.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 142/206 (69%), Gaps = 0/206 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            ++QL  + + +    + +FTD  D   +++++  WKN+PPSW   +DPCG  WEGV C+ 
Sbjct  5    KLQLCYLIVSMACHLVFSFTDPQDATVLQSIKQQWKNLPPSWNNSNDPCGTPWEGVTCSN  64

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SRV +L LSSM L+G+L  DI  L+EL  LDLS N DLTGS+   +G+L+KL  LIL GC
Sbjct  65   SRVKALALSSMRLSGKLGDDIGGLTELTSLDLSSNPDLTGSVSSRLGDLRKLNVLILAGC  124

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            G  G IP  +G+L++L +L+LN N F G IP SLG L+ LYWLDL++N+L+GSIPVS   
Sbjct  125  GLSGTIPSELGNLAQLSFLALNSNNFTGEIPASLGNLTNLYWLDLSNNRLSGSIPVSTST  184

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPA  688
             PGLD+L   KHFHF  N+  G+IPA
Sbjct  185  GPGLDLLKKAKHFHFSKNQLLGQIPA  210



>ref|XP_002467924.1| hypothetical protein SORBIDRAFT_01g036470 [Sorghum bicolor]
 gb|EER94922.1| hypothetical protein SORBIDRAFT_01g036470 [Sorghum bicolor]
Length=966

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 133/190 (70%), Gaps = 1/190 (1%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTG  295
            +A TD+ D   ++AL D W+N PPSW +  DPCGD  WEGV C   +V+S+ LS+M + G
Sbjct  20   LAMTDSQDTSVLRALMDQWQNAPPSWGQSDDPCGDSPWEGVTCGSDKVISIKLSTMGIKG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
             L+ DI +LS LQ LDLS+NKDL+G L   IGNLK+L  LIL GC F G IPD +GSL K
Sbjct  80   TLAADIGQLSNLQSLDLSFNKDLSGVLSPTIGNLKQLTTLILAGCSFHGTIPDELGSLPK  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L Y++LN N+F G IP SLG LS LYW D+ADNQL+G +PVS     GLD L+ TKHFHF
Sbjct  140  LSYMALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPVSTSGGMGLDKLIKTKHFHF  199

Query  656  GXNKFSGEIP  685
              N+ SG IP
Sbjct  200  NKNQLSGPIP  209



>ref|XP_002519985.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF42309.1| receptor protein kinase, putative [Ricinus communis]
Length=988

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 136/192 (71%), Gaps = 1/192 (1%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I + TD  D   +++L+D W N PPSW  G DPCG  WEGV C  SRV +L LS+M L G
Sbjct  30   IFSVTDPRDAATLQSLKDSWLNTPPSWGSG-DPCGTPWEGVTCKDSRVTALGLSTMSLAG  88

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +L+GDI  L+EL  LDLSYN +LTGSL   +G+L+ L  LIL GCGF G IP+ +G+L++
Sbjct  89   KLTGDIGGLTELISLDLSYNPELTGSLTPRLGDLRNLNILILAGCGFTGSIPNELGNLAE  148

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N   G IPPSLG+LS +YWLDLADN+LTG IP+S   TPGLD L   KHFHF
Sbjct  149  LSFLALNSNNLTGIIPPSLGKLSNVYWLDLADNELTGPIPISTPATPGLDQLKKAKHFHF  208

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP+Q
Sbjct  209  NKNQLSGPIPSQ  220



>ref|XP_003593681.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
 gb|AES63932.1| LRR receptor-like kinase [Medicago truncatula]
Length=934

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 135/198 (68%), Gaps = 2/198 (1%)
 Frame = +2

Query  101  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  280
             Q L + + TD  D+ A+ +L   W N P +W  GSDPCG +W G+GC+ SR+  L L  
Sbjct  16   FQVLHVASQTDRGDFTALSSLTQSWNNRPSNWV-GSDPCGSNWAGIGCDNSRITELKLLG  74

Query  281  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  460
            + L G+LS  I+ LSEL+ LDLS N  +TG++PREIGNLK L +L LVGCGF G IPDSI
Sbjct  75   LSLEGQLSSAIQSLSELETLDLSSNTGMTGTIPREIGNLKNLNSLALVGCGFSGPIPDSI  134

Query  461  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGLDMLVG  637
            GSL KL +L+LN N F G IP SLG LS L WLDL  NQL G IPVS D   PGLDML+ 
Sbjct  135  GSLKKLTFLALNSNNFTGNIPHSLGNLSNLDWLDLDQNQLEGPIPVSNDQGQPGLDMLLK  194

Query  638  TKHFHFGXNKFSGEIPAQ  691
             +HFHFG NK SG IP +
Sbjct  195  AQHFHFGNNKLSGPIPQK  212



>ref|NP_199788.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 sp|Q9LT96.1|Y5977_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein 
kinase At5g49770; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA98165.1| receptor protein kinase-like [Arabidopsis thaliana]
 gb|ACN59389.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95855.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=946

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = +2

Query  104  QFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG-SRVVSLTLSS  280
            Q   + AFTD +D+ A++AL++ W  +  SW + SDPCG  W G+ CN  +RVVS++L++
Sbjct  19   QIYSVYAFTDGSDFTALQALKNEWDTLSKSW-KSSDPCGTEWVGITCNNDNRVVSISLTN  77

Query  281  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  460
             +L G+L  +I  LSELQ LDL+ N +L+G LP  IGNL+KL  L L+GC F G IPDSI
Sbjct  78   RNLKGKLPTEISTLSELQTLDLTGNPELSGPLPANIGNLRKLTFLSLMGCAFNGPIPDSI  137

Query  461  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-PGLDMLVG  637
            G+L +L  LSLNLNKF G IP S+G+LS+LYW D+ADNQL G +PVSDG + PGLDML+ 
Sbjct  138  GNLEQLTRLSLNLNKFSGTIPASMGRLSKLYWFDIADNQLEGKLPVSDGASLPGLDMLLQ  197

Query  638  TKHFHFGXNKFSGEIPAQ  691
            T HFHFG NK SGEIP +
Sbjct  198  TGHFHFGNNKLSGEIPEK  215



>ref|XP_011018905.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Populus euphratica]
Length=967

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            +++ TD  D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M+L G
Sbjct  24   LLSDTDPRDAAALRSLKSQWQNTPPSWGQSDDPCGAPWEGVTCSNSRITALGLSTMNLVG  83

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +LSGDI  L+EL+ LDLS+N +LTG L   +G+L  L  LIL GCGF G IPD +G+L+K
Sbjct  84   KLSGDIGGLAELRSLDLSFNSNLTGPLSPRLGDLLNLNILILAGCGFSGSIPDELGNLAK  143

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN NKF G IPPSLG+LS+LYWLDLADNQLTG+IP+S G  PGLD+L+  KHFHF
Sbjct  144  LSFLALNSNKFSGGIPPSLGKLSKLYWLDLADNQLTGTIPISKGTIPGLDLLLNAKHFHF  203

Query  656  GXNKFSGEIPAQ  691
              N+ SG +P +
Sbjct  204  NKNQLSGSLPPE  215



>ref|XP_009365989.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Pyrus x bretschneideri]
Length=962

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            IV+ TD ND   +++L+  W+N PPSW + +DPCG  WEGV CNGSRV +L LSS  L G
Sbjct  21   IVSLTDLNDAAVLQSLKGAWQNTPPSWDKSNDPCGLRWEGVTCNGSRVSALALSSTGLKG  80

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            EL+GDI  L+EL+ +DLS+N  LTGSL   +G+LKKL  ++L GC F G IPD +G+L++
Sbjct  81   ELTGDIGGLTELRSMDLSFNPGLTGSLSPRLGDLKKLNVMVLAGCSFSGNIPDELGNLAE  140

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N   G IP  LG+LS LYWLDLA NQL+G IP+S   +PGLD+L+  KHFH 
Sbjct  141  LTFLALNSNNLTGVIPHPLGKLSNLYWLDLAKNQLSGPIPISTSTSPGLDLLLKAKHFHL  200

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP +
Sbjct  201  NENQLSGSIPPR  212



>ref|XP_002308292.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE91815.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=974

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD  D  A+K+L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M L G+LSG
Sbjct  28   TDPRDAAALKSLKSQWQNTPPSWDQSDDPCGAPWEGVTCSNSRITALGLSTMSLVGKLSG  87

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI  L+EL+ LDLS+N +LTG L   +G+L  L  LIL GCGF G IPD +G+L+KL +L
Sbjct  88   DIGGLAELRSLDLSFNSNLTGPLSPRLGDLLNLNILILAGCGFSGSIPDELGNLAKLSFL  147

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN NKF G IPPSLG+LS+LYWLDLADNQLTG+IP+S G  PGLD+L+  KHFHF  N+
Sbjct  148  ALNSNKFSGGIPPSLGKLSKLYWLDLADNQLTGTIPISKGTIPGLDLLLNAKHFHFNKNQ  207

Query  668  FSGEIPAQ  691
             SG +P +
Sbjct  208  LSGSLPPE  215



>ref|XP_007208371.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
 gb|EMJ09570.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
Length=961

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 141/204 (69%), Gaps = 6/204 (3%)
 Frame = +2

Query  95   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            LF+ F       I + TD  D     +L+  W N+PPSW + +DPCG  WEGV CN SRV
Sbjct  8    LFLAFCSAGIHMIFSETDPGDAAVFISLKGAWTNLPPSW-KSNDPCGMSWEGVTCNNSRV  66

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             +L LS+MDL G + GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GCGF 
Sbjct  67   TALGLSAMDLKGHIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFS  126

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IPD +G+L +L +L+LN N F G IPPSLG+LS+L+WLDLADNQLTG++P+S   T G
Sbjct  127  GNIPDELGNLGELTFLALNTNNFTGKIPPSLGKLSKLFWLDLADNQLTGTLPISTPVTSG  186

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LD L+  KHFHF  N+ SG IP +
Sbjct  187  LDKLLKAKHFHFNKNQLSGTIPPR  210



>emb|CDY12939.1| BnaA09g13350D [Brassica napus]
Length=938

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 150/209 (72%), Gaps = 3/209 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
             + +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G+ CN 
Sbjct  10   EVCMLLILAFCQICYVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVGITCNN  68

Query  251  S-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
            +  ++S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  L L+ 
Sbjct  69   NNHIISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTTLNLME  128

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+IPVS+G
Sbjct  129  CGFSGEIPESIGSLDQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTIPVSNG  188

Query  608  -NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             ++PGLDML+ TKHFHFG NK SG IP +
Sbjct  189  TSSPGLDMLLETKHFHFGNNKLSGYIPEK  217



>ref|XP_009365988.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Pyrus x bretschneideri]
Length=959

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 132/192 (69%), Gaps = 0/192 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ C+GSRV +L LS M++ G
Sbjct  18   ISSSTHPDDANALQSLRQTWTNVPPSWDKSNDPCGERWEGITCSGSRVTALGLSGMNVKG  77

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
             + GDI  LS+L  LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   TIEGDIAGLSKLISLDLSFNKGLTGSLSPRLGDLSNLNTLILAGCNFSGIIPSELGKLGE  137

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PVS   TPGLD L   KHFH 
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPVSSSTTPGLDQLFKAKHFHL  197

Query  656  GXNKFSGEIPAQ  691
              N+ SG IP +
Sbjct  198  NQNQLSGTIPPR  209



>emb|CDY19539.1| BnaC09g13640D [Brassica napus]
Length=938

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            ++ +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G+ CN 
Sbjct  10   QVCMLLILTFCQICSVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVGITCNN  68

Query  251  S-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  427
            +  V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  L L+ 
Sbjct  69   NNHVISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTTLNLME  128

Query  428  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  607
            CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADN++ G+IPVS+G
Sbjct  129  CGFSGEIPESIGSLEQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNKIEGTIPVSNG  188

Query  608  -NTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
             ++PGLDML+ TKHFHFG N  SG+IP +
Sbjct  189  TSSPGLDMLLETKHFHFGNNTLSGDIPEK  217



>ref|XP_011077100.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=963

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 136/196 (69%), Gaps = 1/196 (1%)
 Frame = +2

Query  101  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  280
            I F  I A T+  D   +++L+D W N PPSW   +DPC   WEGV CN SRV SL LS+
Sbjct  17   ICFHVIYAETNAQDAAVLRSLKDEWGNTPPSWDRSNDPCA-AWEGVTCNNSRVTSLGLST  75

Query  281  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  460
            M LTG++SGDI  LSEL  LDLSYN  LTGSL   +G+L+KL  LIL GC F   IP  +
Sbjct  76   MGLTGKMSGDIGGLSELVSLDLSYNPGLTGSLSPRLGDLQKLTILILAGCSFTNSIPSEL  135

Query  461  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGT  640
            G+LS+L +L+LN N   G IPPSLG+LS+LYWLDLADNQL G IP+S   +PGLD L   
Sbjct  136  GNLSELTFLALNSNNLSGDIPPSLGKLSKLYWLDLADNQLKGQIPISSVFSPGLDQLKQA  195

Query  641  KHFHFGXNKFSGEIPA  688
            KHFHF  N+ SGEIP+
Sbjct  196  KHFHFNKNQLSGEIPS  211



>gb|EYU33251.1| hypothetical protein MIMGU_mgv1a021972mg, partial [Erythranthe 
guttata]
Length=945

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 139/210 (66%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  R  + ++ + ++ L + A TD+ D  A+ A+R  W N+PP+W  G DPCG++W+G+ 
Sbjct  12   MSSRFVVCVLLVSVRILDVSALTDSGDLAALNAIRSSWTNLPPNWI-GPDPCGNNWDGIS  70

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  +RV SL L+ MD+ G    DI  L+ L  LDLS N  L G LP  IGNLK L  LIL
Sbjct  71   CTATRVTSLMLAGMDVQGSQFSDISSLTGLTFLDLSNNIGLKGILPPSIGNLKNLSTLIL  130

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            VGC FFG IPDSIGSL +L Y+SLN N F GPIPPS+G LS+L WLDL+ N+L GSIPVS
Sbjct  131  VGCSFFGPIPDSIGSLQQLIYISLNSNGFSGPIPPSIGNLSKLSWLDLSVNRLNGSIPVS  190

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
                PGLD L+  +HFH   N+ SG IP Q
Sbjct  191  SDTAPGLDKLLSARHFHLSNNQLSGPIPDQ  220



>emb|CDO97683.1| unnamed protein product [Coffea canephora]
Length=946

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 141/202 (70%), Gaps = 1/202 (0%)
 Frame = +2

Query  86   LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVS  265
            L+ L IQ L  +A TD+ND  A+ A++  W N+PP+W +G+DPCG  W+G+ CN S    
Sbjct  9    LLILSIQILHTLAQTDSNDSAALNAIKSSWNNLPPNW-KGADPCGSGWDGITCNVSDFQC  67

Query  266  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL  445
              L  M LTG   GDI  L+ELQ LDLS N  L G++P  IGNLKKL  LILVGC F G 
Sbjct  68   RMLGGMLLTGSGLGDITMLTELQTLDLSNNIGLKGTIPSSIGNLKKLSTLILVGCSFSGP  127

Query  446  IPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  625
            IPDSIGSLS+L Y+SLN N F GPIPPS+G LS L WLDL++N L G++PVS  ++PGLD
Sbjct  128  IPDSIGSLSRLVYISLNSNSFSGPIPPSIGNLSNLSWLDLSENNLNGTLPVSFQDSPGLD  187

Query  626  MLVGTKHFHFGXNKFSGEIPAQ  691
            ML+  KHFH   N+ SG IPA+
Sbjct  188  MLLNAKHFHLSKNQLSGVIPAE  209



>ref|XP_010537840.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=964

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 147/207 (71%), Gaps = 0/207 (0%)
 Frame = +2

Query  71   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            R+   LV  F  F  I + TD  D  A+++L D W+N PPSW E  DPCG  WEGV CN 
Sbjct  7    RLLFFLVCCFAVFSVISSVTDPRDAAAMRSLMDQWENTPPSWRESDDPCGTPWEGVTCNN  66

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SR+ +L LS+M L G+LSGDI  L+EL+ LDLS+N  L GSL  ++G+L+ L  LIL GC
Sbjct  67   SRITALGLSTMGLKGKLSGDIGGLTELRSLDLSFNPGLKGSLTPQLGDLQNLNILILAGC  126

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IP+ +G+LS+L +L+LN N F G IP SLG LS++YWLDLADNQLTG IPVS  +
Sbjct  127  GFTGNIPEELGNLSELSFLALNSNNFSGRIPASLGNLSKVYWLDLADNQLTGPIPVSSPS  186

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            +PGLD+L+  KHFHF  N+ SG IPA+
Sbjct  187  SPGLDLLLKAKHFHFNKNQLSGPIPAK  213



>ref|XP_008465342.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Cucumis melo]
Length=941

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 143/205 (70%), Gaps = 1/205 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  256
            L++  LF+ F  + A  TD+ D   +++L+DGW+N PPSW   +DPCG  W+GV C  SR
Sbjct  5    LVVSLLFLAFFYLAASSTDSRDSSVLQSLKDGWQNTPPSWGTSNDPCGTPWDGVICKNSR  64

Query  257  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  436
            VV+L LSSM L G+L GDI  L+EL+ LDL+ N+DL GS+   +GNL KL  LIL  CGF
Sbjct  65   VVALKLSSMGLKGKLGGDIGGLTELRSLDLAANRDLVGSISPALGNLLKLETLILSTCGF  124

Query  437  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  616
             G IP+ +G+LS+L +LSL  N F G IP +LG+LS+LYWLDLADNQLTG++PVS   + 
Sbjct  125  SGNIPEELGNLSELTFLSLYSNNFTGTIPATLGKLSKLYWLDLADNQLTGALPVSTSGSW  184

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLD L   KHFHF  N  SG IP +
Sbjct  185  GLDKLHMAKHFHFSNNHLSGTIPPE  209



>ref|XP_006651341.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like, partial [Oryza brachyantha]
Length=964

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  304
            TD+ D   ++AL D W+N PP+W +  DPCGD  W+GV C+ SRV+S+ +S+M + G L+
Sbjct  18   TDSQDTSVLRALMDQWQNAPPTWGQSDDPCGDAPWDGVVCSNSRVISIKISTMGIKGVLA  77

Query  305  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  484
             DI +L+ELQ LDLS+NKDL G L   IGNLK+L  LIL GC F G IPD +G+L KL Y
Sbjct  78   ADIGQLTELQSLDLSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGTIPDELGTLPKLSY  137

Query  485  lslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXN  664
            ++LN N+F G IP SLG LS LYW D+ADNQLTG +P+S     GLD L+ TKHFHF  N
Sbjct  138  MALNSNQFSGKIPASLGNLSNLYWFDIADNQLTGPLPISTNGGMGLDKLLKTKHFHFNKN  197

Query  665  KFSGEIP  685
            + SG IP
Sbjct  198  QLSGSIP  204



>ref|XP_010653092.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
 ref|XP_010653093.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
 ref|XP_010653094.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
Length=961

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 141/193 (73%), Gaps = 1/193 (1%)
 Frame = +2

Query  113  GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT  292
            GI+ FT+++D   +++L+  W+N PPSW E SDPCG  WEG+ CN SRV++L LS+M L 
Sbjct  18   GILCFTNSDDAGVLQSLKGQWENTPPSW-EKSDPCGVPWEGITCNNSRVIALGLSTMGLK  76

Query  293  GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGsls  472
            G+L GDI  L+EL+ LDLS+N  LTGSL  ++GNL+ L  LIL GCGF G IPD +G+L+
Sbjct  77   GKLEGDIGGLTELRSLDLSFNLGLTGSLTPKLGNLENLNILILAGCGFTGQIPDELGNLA  136

Query  473  klkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFH  652
            +L +L+LN N   G IPPSLG+LS LYWLDLA+N+L+G  P S   +PGLD L+  KHFH
Sbjct  137  QLTFLALNSNNLTGQIPPSLGRLSNLYWLDLAENKLSGPFPTSTLTSPGLDQLLKAKHFH  196

Query  653  FGXNKFSGEIPAQ  691
            F  N+ SG IP +
Sbjct  197  FNKNQLSGPIPRK  209



>ref|XP_004485853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=934

 Score =   199 bits (505),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 132/190 (69%), Gaps = 2/190 (1%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  298
             A TD+ D+ A+ +L   WKN P  W  GSDPCG  W+G+ C  SR+  L L  ++L G+
Sbjct  22   AAQTDSGDFTALSSLIQSWKNKPSDWV-GSDPCGSDWDGIRCTNSRITELKLPGLNLVGQ  80

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            LS  I+ LSEL  LDLSYN  +TG++PREIGNLK L +L LVGCGF G IPDSIGSL KL
Sbjct  81   LSSAIQSLSELDTLDLSYNTGITGTIPREIGNLKNLNSLALVGCGFIGPIPDSIGSLKKL  140

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGLDMLVGTKHFHF  655
             +L+LN NK  G IP SLG LS L WLDLADNQL G IPVS D   PGLDML+  +HFH 
Sbjct  141  TFLALNSNKLNGNIPRSLGNLSNLDWLDLADNQLEGPIPVSNDQGQPGLDMLLKAQHFHL  200

Query  656  GXNKFSGEIP  685
            G NK SG IP
Sbjct  201  GNNKLSGPIP  210



>ref|XP_006385115.1| hypothetical protein POPTR_0004s24060g [Populus trichocarpa]
 gb|ERP62912.1| hypothetical protein POPTR_0004s24060g [Populus trichocarpa]
Length=313

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 142/207 (69%), Gaps = 6/207 (3%)
 Frame = +2

Query  86   LVPLFIQFLGIVAF-----TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  250
            + P  + FL + +F     T  +D+  +  L+D W+N P +W  G+DPCG  WEG+ C+ 
Sbjct  1    MCPKVLTFLLVASFQIYTETYGDDFTVMSILKDAWENTPRNWV-GADPCGGKWEGISCHN  59

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SRV S+TL+++ LTGELSGDI  LSEL+ LDLSYN  L+G+LP  I NLKKL  L LVGC
Sbjct  60   SRVTSITLAAVGLTGELSGDISSLSELESLDLSYNTGLSGTLPASIVNLKKLKILKLVGC  119

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
             F G IP+ IGSL  L+ L LN N+F GPIP S+G LS+L+ LDL++N L G+IPVS G 
Sbjct  120  RFSGPIPELIGSLQLLESLDLNSNRFTGPIPHSIGNLSKLFLLDLSNNMLDGAIPVSSGT  179

Query  611  TPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            T GLDMLV   HFH G N+ SG IP +
Sbjct  180  TSGLDMLVNANHFHLGGNQLSGTIPKE  206



>ref|XP_006279556.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
 gb|EOA12454.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
Length=1844

 Score =   201 bits (511),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = +2

Query  122   AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  301
             A  D     A++AL+  W   P +W EGSDPCG +W G+ C   R++S++L ++DL G+L
Sbjct  916   ATFDEASAAALQALKSEWTKFPKNW-EGSDPCGTNWVGITCTNDRIISISLGNLDLEGKL  974

Query  302   SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
             S DI  LSELQILDL+ N  LTG LP  IGNLKKL  L L+GCGF G IP+SIGSL +L 
Sbjct  975   SADIAALSELQILDLTSNPKLTGPLPSNIGNLKKLNALNLMGCGFSGQIPESIGSLEQLT  1034

Query  482   ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDMLVGTKHFHFG  658
              LSLN NKFIG IP S+G+LS+L+W D+ADNQ+ G +PVS+G ++PGLDML+   HFHFG
Sbjct  1035  TLSLNSNKFIGTIPASIGRLSKLFWFDIADNQIEGKLPVSNGTSSPGLDMLLQAGHFHFG  1094

Query  659   XNKFSGEIPAQ  691
              NK SG+IP +
Sbjct  1095  NNKLSGDIPEK  1105


 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 141/193 (73%), Gaps = 2/193 (1%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            + AFTD +D+  ++ L+  WK +   W +GSDPCG  W G+ CN +RVV+++L +++L G
Sbjct  21   VSAFTDGSDFTVLETLKGEWKTLSEKW-KGSDPCGAEWVGISCNNNRVVNISLGNLNLQG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +L  DI  L ELQILDL+ N +LTG LP  IGNLKKL  L L+GC F G IPDSIGSL +
Sbjct  80   KLHEDISNLFELQILDLTSNPNLTGQLPLNIGNLKKLTILNLMGCNFTGQIPDSIGSLEQ  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDMLVGTKHFH  652
            LK LSLNLN F G IPPS+G+LS+LYW D+ADN++ G +PVSDG ++PGLDML    HFH
Sbjct  140  LKTLSLNLNNFTGDIPPSIGRLSKLYWFDIADNKIEGGLPVSDGKSSPGLDMLHAVGHFH  199

Query  653  FGXNKFSGEIPAQ  691
            FG N  SGEIP +
Sbjct  200  FGNNLLSGEIPER  212



>ref|XP_002311479.2| hypothetical protein POPTR_0008s12450g, partial [Populus trichocarpa]
 gb|EEE88846.2| hypothetical protein POPTR_0008s12450g, partial [Populus trichocarpa]
Length=433

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 0/191 (0%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  298
            ++ TD  D   +++L+  W+N PPSW +  DPCG  W GV CN SR+ SL L  M L G 
Sbjct  24   LSATDPGDAAELQSLKSHWQNTPPSWDQTDDPCGAPWVGVTCNNSRITSLKLPCMSLAGN  83

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            LS  I  L+EL+ LDLS+N ++TGSL   +G+LK L  LIL GCGF G IPD +G+L++L
Sbjct  84   LSDRIGGLTELRSLDLSFNPNVTGSLTPRLGDLKNLKILILAGCGFSGSIPDELGNLAEL  143

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG  658
             +L+LN N   G IP SLG+LS+LYWLDLA+NQLTG+IP+S  ++PGLD L+  KHFHF 
Sbjct  144  SFLALNSNILSGRIPASLGKLSKLYWLDLAENQLTGTIPISKNSSPGLDQLLNAKHFHFN  203

Query  659  XNKFSGEIPAQ  691
             N+ SG IP +
Sbjct  204  RNQLSGFIPPE  214



>ref|XP_002864015.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40274.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
Length=944

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 142/193 (74%), Gaps = 2/193 (1%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            + A TD++D  A++AL+  WK +  SW + SDPCG  W G+ CN +RVVS++L++ +L G
Sbjct  21   VYAITDDSDSTALQALKSEWKTLSKSW-KSSDPCGSGWVGITCNNNRVVSISLTNRNLNG  79

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +L  +I  L+ELQ LDL+ N +L+G LP  IGNLKKL  L L+GC F G IPDSIG+L +
Sbjct  80   KLPTEISTLAELQTLDLTGNPELSGPLPANIGNLKKLIVLSLMGCDFNGEIPDSIGNLEQ  139

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-PGLDMLVGTKHFH  652
            L  LSLNLNKF G IPPS+G+LS+LYW D+ADNQ+ G +PVSDG +  GLDML+ T HFH
Sbjct  140  LTRLSLNLNKFTGTIPPSMGRLSKLYWFDIADNQIEGKLPVSDGASLSGLDMLLQTGHFH  199

Query  653  FGXNKFSGEIPAQ  691
            F  NK SGEIP +
Sbjct  200  FSNNKLSGEIPEK  212



>ref|XP_009364675.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=937

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 137/205 (67%), Gaps = 6/205 (3%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD-HWEGVGCNGSR  256
            L+++P F+    I    +N +YV +K L D W   P SW  GSDPCGD  WEG+ C  S 
Sbjct  14   LVMIPFFV----IAVEANNQEYVPMKILMDEWNIRPTSWV-GSDPCGDGSWEGITCTNSH  68

Query  257  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  436
            V S+ L+ M LTG L  DIE LSEL++L+LS+N+ L G LP  IG L KL  L LVGC F
Sbjct  69   VTSIALADMALTGSLPSDIERLSELEVLNLSFNRGLKGLLPASIGKLTKLVYLNLVGCSF  128

Query  437  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  616
            FG IPD++GSL +L YLSL  N F G IPPS+G ++ L +LDL+DNQL GSIPVS+   P
Sbjct  129  FGRIPDTMGSLKQLSYLSLKNNSFSGRIPPSIGNMTNLSFLDLSDNQLQGSIPVSNRTAP  188

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML   +HFHF  N+ SG IP +
Sbjct  189  GLDMLHKARHFHFQNNQLSGTIPPR  213



>ref|XP_009391655.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=960

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 131/188 (70%), Gaps = 0/188 (0%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD  D  A+ +L   W+N PPSW +  DPCG  WEGV C+ SRV SLTLS+M + G L  
Sbjct  22   TDAQDAAALLSLMTQWQNTPPSWGKTDDPCGTPWEGVRCSNSRVTSLTLSTMGIKGTLGD  81

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI +LSEL+ILDLSYN  L G+L   IGNL +L  LILVGC F G IPD +GSL  L YL
Sbjct  82   DIGQLSELKILDLSYNTMLGGTLTPNIGNLMELTILILVGCSFNGNIPDELGSLGNLSYL  141

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            +LN N+F G IP SLG+LS L W D+ADNQLTG +P+S   +PGLD LV T+HFHF  N+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLNWFDIADNQLTGPLPISTETSPGLDQLVRTQHFHFNKNQ  201

Query  668  FSGEIPAQ  691
             SG IP +
Sbjct  202  LSGAIPEK  209



>ref|XP_010682227.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Beta vulgaris subsp. vulgaris]
Length=866

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 144/208 (69%), Gaps = 6/208 (3%)
 Frame = +2

Query  83   LLVPLFIQFLGI-VAFTDNNDYVAIKALRDG---WKNVPPSWAEGSDPCGDHWEGVGCNG  250
            L + L + F+ I +A  D    +     +DG   W+N+PP+W+ G DPC + W G+ C+ 
Sbjct  11   LRIGLLVAFICISIAIGDVTSQIQTNR-QDGLGDWRNLPPNWSIGGDPCVNEWLGIKCSD  69

Query  251  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  430
            SR+  + L +M+LTG+L+GD+  L ELQILDLSYN+ LTG LP+ IG L KL +LIL+ C
Sbjct  70   SRITEIKLLNMNLTGQLTGDLAVLRELQILDLSYNRGLTGPLPQSIGQLLKLTSLILMDC  129

Query  431  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  610
            GF G IPD IGSL +L  L LN N F GP+P ++G L  LYWLDL  NQL+GSIPVS+G+
Sbjct  130  GFSGRIPDYIGSLKQLDSLYLNGNNFTGPVPATIGNLLNLYWLDLGTNQLSGSIPVSNGD  189

Query  611  TPGLDMLVGTKHFH-FGXNKFSGEIPAQ  691
            TPGLDMLV TKH + FG N+ SG IP +
Sbjct  190  TPGLDMLVHTKHLYSFGQNQLSGTIPPR  217



>ref|XP_009365992.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=997

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = +2

Query  116  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  295
            I + T  +D  A+++LR  W N+PPSW + +DPCG+HWEG+ CNGSRV +L LS M++ G
Sbjct  59   ISSSTHPDDANALQSLRQTWSNIPPSWDKSNDPCGEHWEGITCNGSRVTALELSGMNVKG  118

Query  296  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  475
            +  GDI  LSEL+ L LS+NK L GSL   +G+L  L  L+L GC F G IP  +G L +
Sbjct  119  KFEGDIGGLSELRSLVLSFNKGLAGSLSPRLGDLSNLNILVLAGCSFSGTIPSELGKLGE  178

Query  476  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF  655
            L +L+LN N F G IP SLG LS LYWLDLA NQLTG +PVS G TPGLD L   +HFH 
Sbjct  179  LTFLALNTNSFTGSIPASLGNLSNLYWLDLAYNQLTGPLPVSSGTTPGLDQLFEARHFHL  238

Query  656  GXNKFSGEIP  685
              N+ SG IP
Sbjct  239  NHNQLSGTIP  248



>ref|XP_006279961.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
 gb|EOA12859.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
Length=953

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 149/205 (73%), Gaps = 4/205 (2%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+ L  Q     A T+  D  A+KA++D W   P  W EGSDPCG +W GV C    V
Sbjct  9    MLLILLCFQICS--ALTNVFDTTALKAMKDEWTTPPDGW-EGSDPCGTNWVGVKCRNDSV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            +S++LS+++L G+L+ DI  LSEL+ILDLSYN  LTG LP +IG+LKKL +LI+V C F 
Sbjct  66   ISISLSNLNLEGKLAPDITILSELEILDLSYNTGLTGPLPVKIGDLKKLKSLIVVRCSFS  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+  ++P
Sbjct  126  GEIPESIGSLKELVYLSLNLNKFTGMIPASIGRLSKLYWFDIADNQIEGELPVSNSTSSP  185

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+   HFHFG N+ SG+IP +
Sbjct  186  GLDMLLQAGHFHFGKNRLSGKIPKE  210



>ref|XP_006371696.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa]
 gb|ERP49493.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa]
Length=204

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = +2

Query  146  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  325
              +  L+D W+N P +W  G+DPCG  WEG+ C  SRV S+TL+++ LTGELSGDI  LS
Sbjct  15   TVMSILKDAWQNTPRNWV-GADPCGGKWEGISCYNSRVTSITLAAVGLTGELSGDISSLS  73

Query  326  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  505
            EL++LDLSYN  L+G+LP  I NLKKL  L LVGC F G IP+ IGSL  L+ L LN N+
Sbjct  74   ELEVLDLSYNTGLSGTLPASIVNLKKLKILKLVGCSFSGPIPELIGSLQLLESLDLNSNR  133

Query  506  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            F GPIP S+G LS+L+ LDL++N L G+IPVS G T GLDMLV  KHFH G N+ SG IP
Sbjct  134  FTGPIPHSIGNLSKLFLLDLSNNMLDGAIPVSSGTTSGLDMLVNAKHFHLGGNQLSGTIP  193

Query  686  AQ  691
             +
Sbjct  194  KE  195



>emb|CAQ58615.1| ATP binding / kinase/ protein serine / threonine kinase [Vitis 
vinifera]
Length=946

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 140/193 (73%), Gaps = 1/193 (1%)
 Frame = +2

Query  113  GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT  292
            GI+ FT+++D   +++L+  W+N PPSW E SDPCG  WEG+ CN SRV++L LS+M L 
Sbjct  3    GILCFTNSDDAGVLQSLKGQWENTPPSW-EKSDPCGVPWEGITCNNSRVIALGLSTMGLK  61

Query  293  GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGsls  472
            G+L GDI  L+EL+ LDLS+N  LTGSL  ++GNL+ L  LIL GCGF G IPD +G+L+
Sbjct  62   GKLEGDIGGLTELRSLDLSFNLGLTGSLTPKLGNLENLNILILAGCGFTGQIPDELGNLA  121

Query  473  klkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFH  652
            +L +L+LN N   G IPPSLG+LS LYWLDLA+N+L+G  P S   +PGLD L+  KH H
Sbjct  122  QLTFLALNSNNLTGQIPPSLGRLSNLYWLDLAENKLSGPFPTSTLTSPGLDQLLKAKHLH  181

Query  653  FGXNKFSGEIPAQ  691
            F  N+ SG IP +
Sbjct  182  FNKNQLSGPIPRK  194



>ref|XP_009391654.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD+ D  A+KAL + WKN PPSW   +DPC D W+GV C GSRV  L L SM++ G LSG
Sbjct  22   TDSQDVSALKALSNQWKNTPPSWRRSNDPC-DQWDGVNCTGSRVKELKLFSMNIEGRLSG  80

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
            DI+ L+EL +LDLS NK+L G LPR IGNLK+L  L L+GC F G IP  +G+L  LK L
Sbjct  81   DIQNLTELTLLDLSSNKNLGGPLPRSIGNLKQLQTLRLIGCSFSGSIPVEVGNLLNLKIL  140

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK  667
            SLN N+F G IP SLG+LS L WLDLA+NQLTG IP S     GLD LV   HFH   N+
Sbjct  141  SLNSNQFNGTIPGSLGRLSNLEWLDLAENQLTGIIPTSSNGASGLDQLVNNLHFHLNLNQ  200

Query  668  FSGEIPA  688
             SG IP+
Sbjct  201  LSGPIPS  207



>gb|KHN40214.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=871

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 142/210 (68%), Gaps = 4/210 (2%)
 Frame = +2

Query  59   TMIPRIQLLLVPLFIQFLGI-VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  235
             M+P   L+L+  +I  + + VA T+N+D+ A+ +L   W+N P +W    DPC D W+G
Sbjct  21   AMLP---LMLILNYIMLVSVAVAQTNNDDFTALVSLTSTWQNKPLNWKGSPDPCNDGWDG  77

Query  236  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  415
            + C  S V S+ L+ +D+ GELS DI  LSEL+ LDLS+NK LTGSLP  IGNL KL NL
Sbjct  78   IKCINSHVTSIRLTGLDIKGELSEDIGLLSELETLDLSHNKGLTGSLPHSIGNLTKLSNL  137

Query  416  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  595
             LV CGF G IPD IGSL +L +LSLN N F G IP S+G L +L WLD+ADNQL G+IP
Sbjct  138  FLVDCGFTGPIPDEIGSLKELVFLSLNSNSFSGGIPASIGNLPKLNWLDIADNQLEGTIP  197

Query  596  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            +S G+TPGLDML+ TKH     N   G +P
Sbjct  198  ISSGSTPGLDMLLSTKHLRLDDNLLRGHVP  227



>ref|NP_001242669.1| probable leucine-rich repeat receptor-like protein kinase At5g49770-like 
precursor [Glycine max]
 gb|ACM89577.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=723

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 2/189 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ S++  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSKITQLRLPGLNLAGQLSS  82

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFL  142

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TPGLDMLVGTKHFHFGXN  664
            +LN N+F G IP SLG LS + WLDLA+NQL G+IPVSD    PGLD+L+  +HFH G N
Sbjct  143  ALNSNRFSGTIPRSLGNLSNIDWLDLAENQLEGTIPVSDDQGRPGLDLLLKAQHFHMGSN  202

Query  665  KFSGEIPAQ  691
            K +G IP +
Sbjct  203  KLTGTIPEE  211



>ref|XP_008359275.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Malus domestica]
Length=272

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 132/204 (65%), Gaps = 6/204 (3%)
 Frame = +2

Query  83   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD-HWEGVGCNGSRV  259
            +L+P F+    I       +YV +K L D W   P SW  GSDPCG+  WEGV C  S V
Sbjct  15   VLIPFFV----IAVEASIQEYVPMKILMDEWNIRPTSWV-GSDPCGNGSWEGVTCTNSHV  69

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ L+ M LTG +  DIE LSEL++L+LS+N+ L G LP  IG L KL  L LVGC FF
Sbjct  70   TSIALADMALTGSVPSDIELLSELEVLNLSFNRGLKGLLPASIGKLTKLVYLNLVGCSFF  129

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IPD++GSL  L YLSL  N F G IPPS+G ++ L +LDL+DNQL G IPVS+   PG
Sbjct  130  GPIPDTMGSLKHLSYLSLKNNSFSGRIPPSIGNMTNLSFLDLSDNQLXGPIPVSNRTAPG  189

Query  620  LDMLVGTKHFHFGXNKFSGEIPAQ  691
            LDML   +HFHF  N+ SG IP +
Sbjct  190  LDMLHRARHFHFQNNQLSGTIPPR  213



>gb|EMT14100.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=902

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 135/202 (67%), Gaps = 1/202 (0%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNVQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICIQDRV  65

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  619
            G IP  IG LSKL +LSLN N+F G IPPSL  LS+LYW DLA+N+LTG +PV DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGHIPPSLSGLSKLYWFDLAENKLTGGLPVFDGTNPG  185

Query  620  LDMLVGTKHFHFGXNKFSGEIP  685
            LD L  TKHF    N FSG IP
Sbjct  186  LDNLTNTKHFLVDNNNFSGSIP  207



>ref|XP_007208107.1| hypothetical protein PRUPE_ppa000924mg [Prunus persica]
 gb|EMJ09306.1| hypothetical protein PRUPE_ppa000924mg [Prunus persica]
Length=960

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 143/202 (71%), Gaps = 6/202 (3%)
 Frame = +2

Query  95   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR  256
            LF+ F       I + T++ D     +L++ W ++PPSW + S DPCG +WEGV CN SR
Sbjct  8    LFLAFCSAGIHVIFSETNSRDAAVFISLKEAWTDLPPSWNDKSNDPCGMNWEGVKCNNSR  67

Query  257  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  436
            V +L LS+MDL G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GCGF
Sbjct  68   VTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGF  127

Query  437  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  616
             G IP+ +G+L +L +L+LN NKF G IPPSLG+LS+LYWLDL DNQLTG++P+S   T 
Sbjct  128  SGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLYWLDLVDNQLTGTLPISTPLTS  187

Query  617  GLDMLVGTKHFHFGXNKFSGEI  682
            GLD L+  +HFHF  N+ SG I
Sbjct  188  GLDNLLKAEHFHFSRNQLSGTI  209



>ref|XP_008345657.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Malus domestica]
Length=1223

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 142/225 (63%), Gaps = 9/225 (4%)
 Frame = +2

Query  17   VVCFDCWSGMVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSW  196
            V+C    SG       I  ++ L  P F + +  V F+      A+++LR  W NVPPSW
Sbjct  258  VICEPMISGQ----KAISVVKSLGFPCF-EIMDAVGFSA----XALQSLRQTWSNVPPSW  308

Query  197  AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL  376
             + +DPC + WEG+ CN SRV +L LS M++ GE+  DI  LSEL+ LDLS+NK LTGSL
Sbjct  309  DKSNDPCXERWEGITCNXSRVTALXLSGMNVKGEIEXDIAGLSELRSLDLSFNKGLTGSL  368

Query  377  PREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYW  556
               +G+L  L  LIL GC F G+IP  +G L  L +L+LN N F G IP SLG LS LYW
Sbjct  369  SPRLGDLSNLNXLILAGCXFSGIIPSELGKLGXLXFLALNTNNFTGSIPASLGNLSNLYW  428

Query  557  LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            LDLADNQLTG +PVS G TPGLD L   KHFH   N+ SG IP +
Sbjct  429  LDLADNQLTGPLPVSSGTTPGLDQLFNAKHFHLNQNQLSGTIPPR  473



>ref|XP_011088110.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=954

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 137/210 (65%), Gaps = 1/210 (0%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            M  R+ + L+ +  + L I A T + D  A+ AL+  WKN+PP+W  G DPCG  W+G+ 
Sbjct  12   MSSRVLVFLLLVSTRILAIFAVTYSGDLAALIALKATWKNLPPNWV-GGDPCGSKWDGIN  70

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            C  +RV SL L+   L G    DI  L+ LQ LDLS N  L G LP  IGNLK L  LIL
Sbjct  71   CTDTRVTSLMLAGTGLEGSEFSDISSLTGLQFLDLSNNIGLKGVLPSSIGNLKNLTVLIL  130

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
            +GC FFG IPDSIGSL +L Y+SLN N F G IPPS+G LS+L WLDL+ N+L G+IPVS
Sbjct  131  IGCSFFGPIPDSIGSLQQLVYISLNSNSFSGSIPPSIGNLSQLSWLDLSMNKLNGTIPVS  190

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
                PGLD+L+  +HFHF  N+ SG IP Q
Sbjct  191  TETAPGLDLLLRARHFHFSNNQLSGSIPDQ  220



>gb|KHN48167.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=931

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 133/189 (70%), Gaps = 2/189 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ SR+  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSRITQLRLPGLNLGGQLSS  82

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTVPQEIGNLKKLKSLSLVGCGFSGRIPDSIGSLKQLTFL  142

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TPGLDMLVGTKHFHFGXN  664
            +LN N F G IP SLG LS + WLDLA+NQL G+IPVSD    PGLD+L+   HFH G N
Sbjct  143  ALNSNNFSGTIPRSLGNLSNVDWLDLAENQLEGTIPVSDDQGRPGLDLLLKAHHFHMGSN  202

Query  665  KFSGEIPAQ  691
            K +G IP +
Sbjct  203  KLTGTIPEK  211



>ref|XP_006588460.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 gb|KHN32231.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=932

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 2/189 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  307
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ S++  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSKITQLRLPGLNLAGQLSS  82

Query  308  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  487
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFL  142

Query  488  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TPGLDMLVGTKHFHFGXN  664
            +LN N+F G IP SLG LS + WLDLA+NQL G+IPVSD    PGLD+L+  +HFH G N
Sbjct  143  ALNSNRFSGTIPRSLGNLSNIDWLDLAENQLEGTIPVSDDQGRPGLDLLLKAQHFHMGSN  202

Query  665  KFSGEIPAQ  691
            K +G IP +
Sbjct  203  KLTGTIPEE  211



>ref|XP_011084699.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=953

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 142/210 (68%), Gaps = 2/210 (1%)
 Frame = +2

Query  65   IPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  241
            I R+    +  F  ++ +V A T+  D   +++L+D     PPSW    DPC D WEGV 
Sbjct  4    IRRLLFYCLLPFCAWIRVVDAMTNPQDAAVLRSLKDQLGGTPPSWDNSDDPCAD-WEGVA  62

Query  242  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  421
            CN S+V SL LS+M LTG++SGDI  L+EL  LDLS+N  LTGSL + +G+L+KL  LIL
Sbjct  63   CNNSKVTSLGLSTMGLTGKMSGDIGGLNELVSLDLSFNPGLTGSLSQRLGDLQKLTILIL  122

Query  422  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  601
             GC F G IP  +G+LS+L +L+LN N   G IPPSLG+LS+LYWLDLA+NQL G +PVS
Sbjct  123  AGCSFTGNIPSELGNLSELTFLALNSNNLTGEIPPSLGKLSKLYWLDLAENQLRGPLPVS  182

Query  602  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
                PGLD L   KHFHF  N+ SGEIP+Q
Sbjct  183  SAFGPGLDQLKKAKHFHFNKNQLSGEIPSQ  212



>ref|XP_002441283.1| hypothetical protein SORBIDRAFT_09g023790 [Sorghum bicolor]
 gb|EES19713.1| hypothetical protein SORBIDRAFT_09g023790 [Sorghum bicolor]
Length=678

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 127/184 (69%), Gaps = 0/184 (0%)
 Frame = +2

Query  131  DNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGD  310
            ++ D  A+ AL+  W N P SW+  SDPC   W+GV CN  RV SL LSS+++ G LS  
Sbjct  33   NSQDGSALNALKSQWTNAPSSWSSASDPCDGGWDGVMCNNGRVTSLRLSSVNIQGTLSDS  92

Query  311  IEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyls  490
            I +L++L  LD+S+N  L G +P  IGNL +L  LIL GC F G IP  +G+L KL +L+
Sbjct  93   IGQLTQLVYLDVSFNIGLNGRMPATIGNLAELTTLILAGCSFTGSIPPELGNLQKLTFLA  152

Query  491  lnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKF  670
            LN NKF G IPP LG LS L+WLDLADNQLTGSIPV+  NTPGLD L+ TKHFHF  N+ 
Sbjct  153  LNSNKFTGTIPPQLGLLSSLFWLDLADNQLTGSIPVTTANTPGLDQLIHTKHFHFNKNQL  212

Query  671  SGEI  682
            SG +
Sbjct  213  SGTL  216



>ref|XP_008227086.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Prunus mume]
Length=934

 Score =   193 bits (491),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 133/199 (67%), Gaps = 1/199 (1%)
 Frame = +2

Query  95   LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  274
            + I F  I A     +Y  +K L D W   PPSW  GSDPC   WEG+ C  SR+ S+ L
Sbjct  19   VLISFFVIAAEGAIEEYAPMKILMDEWDIRPPSWV-GSDPCVGGWEGIECTNSRITSIAL  77

Query  275  SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  454
            + M LTG+L  DIE LSEL+IL+LS+NK L G LP  IG L KL  L LVGC F G IPD
Sbjct  78   ADMSLTGQLPSDIELLSELEILNLSFNKGLKGPLPASIGKLTKLVYLNLVGCSFVGPIPD  137

Query  455  SIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV  634
            +IGSL +L YLSL  N F G IPPS+G L++L++LDL+DN+L GS PVS+G  PGLD L 
Sbjct  138  TIGSLKQLSYLSLKNNSFNGLIPPSIGNLTKLFFLDLSDNKLVGSFPVSNGAAPGLDQLE  197

Query  635  GTKHFHFGXNKFSGEIPAQ  691
              +HFHF  N+ SG+IP +
Sbjct  198  NARHFHFQNNQLSGKIPPE  216



>ref|XP_008643850.1| PREDICTED: uncharacterized protein LOC100382229 isoform X2 [Zea 
mays]
 ref|XP_008643856.1| PREDICTED: uncharacterized protein LOC100382229 isoform X2 [Zea 
mays]
 tpg|DAA45171.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=984

 Score =   193 bits (491),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  304
            TD+ D   ++AL D W+N PPSW +  DPCG+  WEGV C G +V+S+ LS+M + G L+
Sbjct  41   TDSQDTSVLRALMDQWQNAPPSWGQSDDPCGESPWEGVTCGGDKVISIKLSTMGIQGSLA  100

Query  305  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  484
             DI +LS+LQ +DLS+N +L G L   IGNLK+L  LIL GC F G IPD +GSL KL Y
Sbjct  101  ADIGQLSDLQSMDLSFNNELGGVLTPTIGNLKQLTTLILSGCSFHGTIPDELGSLPKLSY  160

Query  485  lslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXN  664
            ++LN N+F G IP SLG LS LYW D+ADNQL+G +PVS     GLD L+ T+HFHF  N
Sbjct  161  MALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPVSTDGGMGLDKLIKTRHFHFNKN  220

Query  665  KFSGEIP  685
            + SG IP
Sbjct  221  QLSGPIP  227



>ref|XP_010252250.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=955

 Score =   193 bits (490),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 143/212 (67%), Gaps = 6/212 (3%)
 Frame = +2

Query  62   MIPRIQ-LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            M  RIQ  LLV   I  L + A +   D   + +LR  W   P SW +  DPC + W G+
Sbjct  1    MNHRIQACLLVLCPISILAVQAISP--DAGPLYSLRSLWPKTPTSW-DNPDPC-NGWVGI  56

Query  239  GCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  415
             CN   RV+S+ LSS+ L G+L GDI  L++LQILD+SYNK L G +   I  L  L NL
Sbjct  57   ICNNEFRVISIKLSSLGLKGQLPGDIGSLTQLQILDMSYNKGLNGPISGAIAGLTNLTNL  116

Query  416  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  595
            IL+GC F G+IPD+IGSL +L  LSLN N F G IP S+G+LS+LYWLDLADN+LTG+IP
Sbjct  117  ILIGCSFSGVIPDNIGSLQQLVILSLNFNSFSGTIPSSIGKLSKLYWLDLADNKLTGTIP  176

Query  596  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            VS GN PGLDML  TKHFHFG N+  GEIPAQ
Sbjct  177  VSSGNQPGLDMLTHTKHFHFGKNQLGGEIPAQ  208



>gb|ABF95747.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EEE58993.1| hypothetical protein OsJ_10704 [Oryza sativa Japonica Group]
Length=975

 Score =   193 bits (491),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 132/189 (70%), Gaps = 1/189 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGE  298
            A TD+ D   ++AL D W+N PP+W +  DPC D  W+GV C+ +RV+S+ +S+M + G 
Sbjct  32   AVTDSQDTSVLRALMDQWQNAPPTWGQSDDPCSDSPWDGVVCSNNRVISIKISTMGIKGV  91

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            L+ DI +L+ELQ LD+S+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL
Sbjct  92   LAADIGQLTELQSLDMSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGNIPDELGSLPKL  151

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG  658
             Y++LN N+F G IP S+G LS LYW D+ADNQL+G +P+S     GLD L  TKHFHF 
Sbjct  152  SYMALNSNQFSGKIPASMGNLSNLYWFDIADNQLSGPLPISTNGGMGLDKLFKTKHFHFN  211

Query  659  XNKFSGEIP  685
             N+ SG IP
Sbjct  212  KNQLSGPIP  220



>ref|XP_002864016.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40275.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=967

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 140/192 (73%), Gaps = 2/192 (1%)
 Frame = +2

Query  119  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  298
            +AF  N  ++A++AL+      P +W +G DPC + W G+ CN  R+V+++L +++L G+
Sbjct  64   LAFLPNLFFIALQALKSSLTMPPRNW-KGFDPCVNKWVGISCNNDRIVNISLGNLNLEGK  122

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            L   I  L+ELQ LDL+ N +LTG LP  IGNLKKL NL L+GCGF G IP+SIGSL +L
Sbjct  123  LPAYITTLTELQTLDLTSNPNLTGPLPPNIGNLKKLTNLNLMGCGFSGQIPESIGSLEQL  182

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-PGLDMLVGTKHFHF  655
              LSLN NKF G IP S+GQLS+LYW D+ADNQ+ G +PVSDG + PGLDML+ TKHFHF
Sbjct  183  ITLSLNSNKFNGTIPASIGQLSKLYWFDIADNQIEGKLPVSDGASLPGLDMLLETKHFHF  242

Query  656  GXNKFSGEIPAQ  691
            G NK SG+IP +
Sbjct  243  GKNKLSGDIPEK  254



>ref|XP_011461107.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Fragaria vesca subsp. vesca]
Length=881

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 137/211 (65%), Gaps = 4/211 (2%)
 Frame = +2

Query  59   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            T+  R+ +LLV    +F GI A  ++ DY ++K L   W   PPSW + SDPC   WEG+
Sbjct  21   TLATRVFMLLV--LFKF-GIAAEANSMDYNSLKNLMQEWDIRPPSW-KSSDPCAHGWEGI  76

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
             C  SRV S+ L+ M L G+L  DI+ LSE++ LDLS NK+LTG +P  IGNL KL NL 
Sbjct  77   DCTNSRVTSIKLAGMGLKGQLPADIQSLSEIETLDLSLNKELTGPIPTSIGNLTKLVNLN  136

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            L GC F+G IP +IGSL  L YL LN N   G IPPS+G LSEL +LDL  N+L G+IP+
Sbjct  137  LAGCSFYGPIPQTIGSLKHLYYLDLNNNNLSGQIPPSIGNLSELNYLDLTSNKLGGNIPI  196

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            S   T GLDML   +HFH G N FSG IP Q
Sbjct  197  SSETTLGLDMLHNAQHFHLGNNHFSGSIPTQ  227



>ref|XP_003561670.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brachypodium distachyon]
Length=978

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 138/211 (65%), Gaps = 3/211 (1%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLGIV--AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WE  232
            M PR   LL  L +     V  A T++ D   ++AL D W++ PP+W +  DPCGD  WE
Sbjct  11   MRPRAVFLLAALVLSVCLRVSHAVTNSQDTSVLRALMDQWQDAPPTWGQSDDPCGDSPWE  70

Query  233  GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  412
            GV C+  RV+ + +S+M + G L+ DI +LSELQ LDLS+N DL G L   IGNLK+L  
Sbjct  71   GVTCSNDRVIFIKVSTMGIKGVLAADIGQLSELQSLDLSFNHDLGGVLTPTIGNLKQLTT  130

Query  413  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  592
            LIL GC F G IPD +GS+ KL Y++LN N+F G IP SLG LS+LYW D+ADN LTG +
Sbjct  131  LILAGCSFHGNIPDELGSVPKLSYMALNSNRFSGNIPASLGNLSDLYWFDIADNLLTGPL  190

Query  593  PVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP  685
            P+S     GLD L  TKHFHF  N+ SG IP
Sbjct  191  PISSNGGMGLDKLTKTKHFHFNKNQLSGPIP  221



>ref|XP_010482266.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
Length=952

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 144/205 (70%), Gaps = 2/205 (1%)
 Frame = +2

Query  80   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  259
            +LL+  F Q   + A T++ D VA+ AL+      P +W +G DPCG +W G+ C+  RV
Sbjct  9    MLLILFFFQISSVSAHTNSIDAVALLALKSELTGTPKNW-KGFDPCGTNWVGISCSNDRV  67

Query  260  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  439
            V+++L +++L G+L  DI  LSEL  LDL+ N ++TG LP  IGNL KL  L L+GCGF 
Sbjct  68   VTISLGNLNLQGKLPADISTLSELVTLDLTSNSNMTGQLPPNIGNLTKLTELNLMGCGFD  127

Query  440  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  616
            G IP+SIG+L KL  LSLN NKF G I  S+G+LS+LYW D+ADNQ+ G IPVS+G ++P
Sbjct  128  GQIPESIGNLEKLTKLSLNSNKFNGKILASMGRLSKLYWFDIADNQIEGEIPVSNGTSSP  187

Query  617  GLDMLVGTKHFHFGXNKFSGEIPAQ  691
            GLDML+ T HFHFG NK SG+IP +
Sbjct  188  GLDMLLQTVHFHFGKNKLSGKIPKE  212



>ref|XP_008643846.1| PREDICTED: uncharacterized protein LOC100382229 isoform X1 [Zea 
mays]
 tpg|DAA45172.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1029

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  304
            TD+ D   ++AL D W+N PPSW +  DPCG+  WEGV C G +V+S+ LS+M + G L+
Sbjct  86   TDSQDTSVLRALMDQWQNAPPSWGQSDDPCGESPWEGVTCGGDKVISIKLSTMGIQGSLA  145

Query  305  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  484
             DI +LS+LQ +DLS+N +L G L   IGNLK+L  LIL GC F G IPD +GSL KL Y
Sbjct  146  ADIGQLSDLQSMDLSFNNELGGVLTPTIGNLKQLTTLILSGCSFHGTIPDELGSLPKLSY  205

Query  485  lslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXN  664
            ++LN N+F G IP SLG LS LYW D+ADNQL+G +PVS     GLD L+ T+HFHF  N
Sbjct  206  MALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPVSTDGGMGLDKLIKTRHFHFNKN  265

Query  665  KFSGEIP  685
            + SG IP
Sbjct  266  QLSGPIP  272



>gb|EEC75182.1| hypothetical protein OsI_11410 [Oryza sativa Indica Group]
Length=975

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 132/189 (70%), Gaps = 1/189 (1%)
 Frame = +2

Query  122  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGE  298
            A TD+ D   ++AL D W+N PP+W +  DPC D  W+GV C+ +RV+S+ +S+M + G 
Sbjct  32   AVTDSQDTSVLRALMDQWQNAPPTWGQSDDPCSDSPWDGVVCSNNRVISIKISTMGIKGV  91

Query  299  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  478
            L+ DI +L+ELQ LD+S+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL
Sbjct  92   LAADIGQLTELQSLDMSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGNIPDELGSLPKL  151

Query  479  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG  658
             Y++LN N+F G IP S+G LS LYW D+ADNQL+G +P+S     GLD L  TKHFHF 
Sbjct  152  SYMALNSNQFSGKIPASMGNLSNLYWFDIADNQLSGPLPISTNGGMGLDKLFKTKHFHFN  211

Query  659  XNKFSGEIP  685
             N+ SG IP
Sbjct  212  KNQLSGPIP  220



>ref|XP_004972229.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=961

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 133/203 (66%), Gaps = 0/203 (0%)
 Frame = +2

Query  74   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  253
            I LLLV            TD  D  A+++L  GW+N P SW   +DPCG  W+G+ CN  
Sbjct  6    IPLLLVMFSASLRAGFCDTDPQDVAALQSLMRGWQNFPSSWKASNDPCGAQWDGITCNNG  65

Query  254  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  433
            RV S+ LSS++L G LS  I +LSEL  LDLS N  L+G LP  IGNLK+L  LILVGC 
Sbjct  66   RVTSMRLSSINLQGTLSNSIGQLSELVYLDLSSNSGLSGPLPTSIGNLKQLTTLILVGCS  125

Query  434  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  613
            F G IP  +G+L +L +L+LN N F G IP S+G L+ L+WLDLA+NQL+G IP+S   +
Sbjct  126  FTGGIPQELGNLVQLSFLALNSNNFTGRIPASIGLLTNLFWLDLAENQLSGPIPISSTTS  185

Query  614  PGLDMLVGTKHFHFGXNKFSGEI  682
            PGLD+L  TKHFHF  N+ +G +
Sbjct  186  PGLDLLTHTKHFHFNKNQLTGTL  208



>ref|XP_004295860.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Fragaria vesca subsp. vesca]
Length=926

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 137/211 (65%), Gaps = 4/211 (2%)
 Frame = +2

Query  59   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            T+  R+ +LLV    +F GI A  ++ DY ++K L   W   PPSW + SDPC   WEG+
Sbjct  21   TLATRVFMLLV--LFKF-GIAAEANSMDYNSLKNLMQEWDIRPPSW-KSSDPCAHGWEGI  76

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
             C  SRV S+ L+ M L G+L  DI+ LSE++ LDLS NK+LTG +P  IGNL KL NL 
Sbjct  77   DCTNSRVTSIKLAGMGLKGQLPADIQSLSEIETLDLSLNKELTGPIPTSIGNLTKLVNLN  136

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            L GC F+G IP +IGSL  L YL LN N   G IPPS+G LSEL +LDL  N+L G+IP+
Sbjct  137  LAGCSFYGPIPQTIGSLKHLYYLDLNNNNLSGQIPPSIGNLSELNYLDLTSNKLGGNIPI  196

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            S   T GLDML   +HFH G N FSG IP Q
Sbjct  197  SSETTLGLDMLHNAQHFHLGNNHFSGSIPTQ  227



>ref|XP_011461106.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Fragaria vesca subsp. vesca]
Length=925

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 137/211 (65%), Gaps = 4/211 (2%)
 Frame = +2

Query  59   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  238
            T+  R+ +LLV    +F GI A  ++ DY ++K L   W   PPSW + SDPC   WEG+
Sbjct  21   TLATRVFMLLV--LFKF-GIAAEANSMDYNSLKNLMQEWDIRPPSW-KSSDPCAHGWEGI  76

Query  239  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  418
             C  SRV S+ L+ M L G+L  DI+ LSE++ LDLS NK+LTG +P  IGNL KL NL 
Sbjct  77   DCTNSRVTSIKLAGMGLKGQLPADIQSLSEIETLDLSLNKELTGPIPTSIGNLTKLVNLN  136

Query  419  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  598
            L GC F+G IP +IGSL  L YL LN N   G IPPS+G LSEL +LDL  N+L G+IP+
Sbjct  137  LAGCSFYGPIPQTIGSLKHLYYLDLNNNNLSGQIPPSIGNLSELNYLDLTSNKLGGNIPI  196

Query  599  SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            S   T GLDML   +HFH G N FSG IP Q
Sbjct  197  SSETTLGLDMLHNAQHFHLGNNHFSGSIPTQ  227



>gb|EMT31021.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=943

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 130/188 (69%), Gaps = 1/188 (1%)
 Frame = +2

Query  125  FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCG-DHWEGVGCNGSRVVSLTLSSMDLTGEL  301
             TD+ D   ++AL D W+N PP+W +  DPCG   W+GV C+  RV+S+ +S+M + G L
Sbjct  24   LTDSQDTSVLRALMDQWQNSPPTWGQSDDPCGVSPWDGVTCSNDRVISIKVSTMGIKGLL  83

Query  302  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  481
            + DI +L+ELQ LDLS+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL 
Sbjct  84   AADIGQLTELQSLDLSFNKDLGGVLTPTIGNLKQLATLILAGCSFHGNIPDELGSLPKLS  143

Query  482  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX  661
            Y++LN N+F G IP SLG LS LYW D+ADNQLTG +P+S     GLD L  TKHFHF  
Sbjct  144  YMALNSNQFSGKIPASLGNLSSLYWFDVADNQLTGPLPISSNGGMGLDKLTKTKHFHFNK  203

Query  662  NKFSGEIP  685
            N+ SG IP
Sbjct  204  NQLSGPIP  211



>gb|EYU39493.1| hypothetical protein MIMGU_mgv1a025586mg [Erythranthe guttata]
Length=950

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 142/214 (66%), Gaps = 9/214 (4%)
 Frame = +2

Query  62   MIPRIQLLLVPLFIQFLG---IVAFTDNNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHW  229
            M  + QLL   + +  L    + A TD+ D   +++L+D W NVPPSW   G DPC   W
Sbjct  1    MAEKRQLLFCYMLVFSLWSCIVYAVTDSQDAAVLRSLKDQWGNVPPSWDTSGGDPCAS-W  59

Query  230  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  409
            EGV CN SRV +L LS+M LTG +SGDI  LSEL  LDLS+N+ LTGSL   +G+L+KL 
Sbjct  60   EGVVCNNSRVTTLGLSTMGLTGTMSGDIGGLSELISLDLSFNRGLTGSLSPRLGDLRKLT  119

Query  410  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  589
             LIL GC F   IP  +G+LS+L +L+LN N+  G IP SLGQLS LYWLDLADNQLTG 
Sbjct  120  VLILAGCSFTNSIPTELGNLSELTFLALNSNQLSGEIPASLGQLSNLYWLDLADNQLTGQ  179

Query  590  IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ  691
            IPV+    PGLD L   KHFHF  N+ SG IP +
Sbjct  180  IPVN----PGLDNLKVAKHFHFNKNQLSGGIPGK  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520