BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048A15

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF69014.1|AF260827_1  cysteine protease                             326   8e-106   Ipomoea batatas [batate]
gb|EYU29312.1|  hypothetical protein MIMGU_mgv1a005315mg                279   2e-87    Erythranthe guttata [common monkey flower]
ref|XP_009616670.1|  PREDICTED: vacuolar-processing enzyme-like         276   2e-86    Nicotiana tomentosiformis
ref|XP_009616632.1|  PREDICTED: vacuolar-processing enzyme-like         274   1e-85    Nicotiana tomentosiformis
ref|XP_009780274.1|  PREDICTED: vacuolar-processing enzyme-like         273   4e-85    Nicotiana sylvestris
ref|XP_006355320.1|  PREDICTED: vacuolar-processing enzyme              271   2e-84    Solanum tuberosum [potatoes]
gb|ACC68680.1|  vacoular processing enzyme 1                            270   2e-84    Solanum tuberosum [potatoes]
ref|XP_004245113.1|  PREDICTED: vacuolar-processing enzyme-like         270   4e-84    
ref|XP_009762556.1|  PREDICTED: vacuolar-processing enzyme-like         268   3e-83    Nicotiana sylvestris
emb|CDP08231.1|  unnamed protein product                                267   5e-83    Coffea canephora [robusta coffee]
ref|NP_001275272.1|  vacoular processing enzyme 2 precursor             266   7e-83    Solanum tuberosum [potatoes]
ref|XP_004253098.1|  PREDICTED: vacuolar-processing enzyme              266   7e-83    
gb|KDO80012.1|  hypothetical protein CISIN_1g011066mg                   260   2e-82    Citrus sinensis [apfelsine]
gb|KDO80013.1|  hypothetical protein CISIN_1g011066mg                   259   2e-82    Citrus sinensis [apfelsine]
gb|ACR24644.1|  vacuolar processing enzyme                              265   4e-82    Malus hupehensis var. mengshanensis
gb|AGC94758.1|  vacuolar processing enzyme                              265   5e-82    Malus hupehensis
emb|CAH56498.1|  cysteine protease                                      265   5e-82    Solanum lycopersicum
gb|AGC94757.1|  vacuolar processing enzyme                              265   5e-82    Malus sikkimensis
gb|AGC94759.1|  vacuolar processing enzyme                              265   6e-82    Malus micromalus [Kaido crab apple]
ref|XP_008393660.1|  PREDICTED: vacuolar-processing enzyme              265   7e-82    
gb|AGC94756.1|  vacuolar processing enzyme                              264   7e-82    Malus sieversii
ref|XP_009361606.1|  PREDICTED: vacuolar-processing enzyme-like         264   8e-82    Pyrus x bretschneideri [bai li]
ref|XP_007222246.1|  hypothetical protein PRUPE_ppa004713mg             264   9e-82    Prunus persica
gb|KDO80010.1|  hypothetical protein CISIN_1g011066mg                   260   1e-81    Citrus sinensis [apfelsine]
ref|XP_011096125.1|  PREDICTED: vacuolar-processing enzyme              263   1e-81    Sesamum indicum [beniseed]
gb|KDO80009.1|  hypothetical protein CISIN_1g011066mg                   260   8e-81    Citrus sinensis [apfelsine]
ref|XP_006342509.1|  PREDICTED: vacuolar-processing enzyme-like         261   1e-80    Solanum tuberosum [potatoes]
ref|XP_006450795.1|  hypothetical protein CICLE_v10008097mg             261   1e-80    Citrus clementina [clementine]
gb|EYU20379.1|  hypothetical protein MIMGU_mgv1a005412mg                260   2e-80    Erythranthe guttata [common monkey flower]
emb|CDX68923.1|  BnaC01g05300D                                          260   2e-80    
ref|XP_002276759.2|  PREDICTED: vacuolar-processing enzyme              260   8e-80    Vitis vinifera
ref|XP_009607675.1|  PREDICTED: vacuolar-processing enzyme-like         259   1e-79    Nicotiana tomentosiformis
dbj|BAC54829.1|  vacuolar processing enzyme-2                           258   1e-79    Nicotiana tabacum [American tobacco]
ref|XP_009337146.1|  PREDICTED: vacuolar-processing enzyme-like         258   1e-79    Pyrus x bretschneideri [bai li]
ref|NP_001275777.1|  vacuolar-processing enzyme precursor               258   1e-79    Citrus sinensis [apfelsine]
ref|XP_007012236.1|  Gamma vacuolar processing enzyme                   258   2e-79    
emb|CBI20614.3|  unnamed protein product                                258   3e-79    Vitis vinifera
ref|XP_006412409.1|  hypothetical protein EUTSA_v10025034mg             257   4e-79    Eutrema salsugineum [saltwater cress]
dbj|BAJ33795.1|  unnamed protein product                                257   4e-79    Eutrema halophilum
ref|XP_010526156.1|  PREDICTED: vacuolar-processing enzyme gamma-...    257   4e-79    Tarenaya hassleriana [spider flower]
emb|CDX75302.1|  BnaA01g04000D                                          257   4e-79    
ref|XP_004501477.1|  PREDICTED: vacuolar-processing enzyme-like         257   5e-79    Cicer arietinum [garbanzo]
gb|KJB06488.1|  hypothetical protein B456_001G023700                    251   6e-79    Gossypium raimondii
emb|CAN70603.1|  hypothetical protein VITISV_040193                     256   8e-79    Vitis vinifera
gb|KFK29905.1|  hypothetical protein AALP_AA7G193600                    256   9e-79    Arabis alpina [alpine rockcress]
ref|XP_002880728.1|  alpha-vacuolar processing enzyme                   256   1e-78    
gb|ACB30368.1|  vascular processing enzyme-3                            255   2e-78    Capsicum annuum
ref|XP_009125229.1|  PREDICTED: vacuolar-processing enzyme gamma-...    255   3e-78    Brassica rapa
ref|XP_004291017.1|  PREDICTED: vacuolar-processing enzyme              254   4e-78    Fragaria vesca subsp. vesca
ref|XP_010429611.1|  PREDICTED: vacuolar-processing enzyme alpha-...    254   5e-78    
ref|XP_010429610.1|  PREDICTED: vacuolar-processing enzyme alpha-...    254   6e-78    Camelina sativa [gold-of-pleasure]
gb|KJB06490.1|  hypothetical protein B456_001G023700                    250   6e-78    Gossypium raimondii
ref|XP_010244352.1|  PREDICTED: vacuolar-processing enzyme-like         254   7e-78    Nelumbo nucifera [Indian lotus]
ref|XP_002516472.1|  Vacuolar-processing enzyme precursor, putative     254   9e-78    Ricinus communis
gb|KJB06489.1|  hypothetical protein B456_001G023700                    253   2e-77    Gossypium raimondii
gb|KJB06487.1|  hypothetical protein B456_001G023700                    253   2e-77    Gossypium raimondii
ref|XP_004159537.1|  PREDICTED: vacuolar-processing enzyme-like         253   2e-77    
ref|XP_004142919.1|  PREDICTED: vacuolar-processing enzyme-like         253   2e-77    Cucumis sativus [cucumbers]
ref|XP_006296251.1|  hypothetical protein CARUB_v10025418mg             252   3e-77    Capsella rubella
gb|KFK32531.1|  hypothetical protein AALP_AA6G255400                    252   4e-77    Arabis alpina [alpine rockcress]
ref|XP_008444493.1|  PREDICTED: vacuolar-processing enzyme-like         252   5e-77    Cucumis melo [Oriental melon]
gb|KDP34125.1|  hypothetical protein JCGZ_07696                         251   7e-77    Jatropha curcas
ref|XP_008377927.1|  PREDICTED: vacuolar-processing enzyme-like         251   7e-77    
ref|XP_010417372.1|  PREDICTED: vacuolar-processing enzyme alpha-...    250   2e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010472621.1|  PREDICTED: vacuolar-processing enzyme alpha-...    250   2e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010526069.1|  PREDICTED: vacuolar-processing enzyme gamma-...    250   2e-76    Tarenaya hassleriana [spider flower]
gb|EPS59704.1|  hypothetical protein M569_15100                         247   6e-76    Genlisea aurea
gb|KJB65605.1|  hypothetical protein B456_010G103000                    242   7e-76    Gossypium raimondii
ref|XP_011081710.1|  PREDICTED: vacuolar-processing enzyme              248   8e-76    Sesamum indicum [beniseed]
gb|KHG30636.1|  Vacuolar-processing enzyme                              248   9e-76    Gossypium arboreum [tree cotton]
ref|XP_002867219.1|  GAMMA-VPE                                          248   1e-75    
ref|NP_195020.1|  vacuolar-processing enzyme gamma                      248   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117035.1|  PREDICTED: vacuolar-processing enzyme alpha-...    248   2e-75    Brassica rapa
emb|CDY11506.1|  BnaA09g40720D                                          248   2e-75    Brassica napus [oilseed rape]
gb|KJB65603.1|  hypothetical protein B456_010G103000                    241   3e-75    Gossypium raimondii
dbj|BAA18924.1|  gamma-VPE                                              246   5e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408834.1|  hypothetical protein EUTSA_v10001970mg             246   8e-75    Eutrema salsugineum [saltwater cress]
gb|KJB65607.1|  hypothetical protein B456_010G103000                    243   8e-75    Gossypium raimondii
ref|NP_180165.1|  alpha-vacuolar processing enzyme                      245   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525979.1|  PREDICTED: vacuolar-processing enzyme-like         245   2e-74    Glycine max [soybeans]
ref|XP_010669172.1|  PREDICTED: vacuolar-processing enzyme-like         245   2e-74    Beta vulgaris subsp. vulgaris [field beet]
gb|ACU21276.1|  unknown                                                 238   2e-74    Glycine max [soybeans]
ref|XP_007136809.1|  hypothetical protein PHAVU_009G076100g             244   3e-74    Phaseolus vulgaris [French bean]
ref|XP_002324151.1|  asparaginyl endopeptidase family protein           244   4e-74    Populus trichocarpa [western balsam poplar]
gb|KJB65602.1|  hypothetical protein B456_010G103000                    244   5e-74    Gossypium raimondii
gb|EPS65165.1|  vacuolar processing enzyme-1b                           243   6e-74    Genlisea aurea
ref|XP_010437829.1|  PREDICTED: vacuolar-processing enzyme gamma-...    244   6e-74    Camelina sativa [gold-of-pleasure]
gb|KHG13131.1|  Vacuolar-processing enzyme                              244   6e-74    Gossypium arboreum [tree cotton]
ref|XP_006371860.1|  hypothetical protein POPTR_0018s04650g             243   7e-74    
gb|KHG17266.1|  Vacuolar-processing enzyme                              243   8e-74    Gossypium arboreum [tree cotton]
dbj|BAA76744.1|  asparaginyl endopeptidase (VmPE-1)                     243   9e-74    Vigna mungo [urad dal]
emb|CDX76736.1|  BnaC08g33220D                                          243   1e-73    
ref|XP_003603121.1|  Vacuolar processing enzyme                         243   1e-73    Medicago truncatula
ref|XP_008797891.1|  PREDICTED: vacuolar-processing enzyme              243   1e-73    Phoenix dactylifera
ref|XP_006578073.1|  PREDICTED: vacuolar-processing enzyme-like         242   2e-73    Glycine max [soybeans]
gb|KHN29737.1|  Vacuolar-processing enzyme                              242   2e-73    Glycine soja [wild soybean]
ref|XP_010911246.1|  PREDICTED: vacuolar-processing enzyme              242   2e-73    Elaeis guineensis
dbj|BAC86022.1|  unnamed protein product                                242   3e-73    Homo sapiens [man]
ref|XP_006382030.1|  hypothetical protein POPTR_0006s24900g             236   5e-73    
ref|XP_006285517.1|  hypothetical protein CARUB_v10006959mg             241   6e-73    Capsella rubella
ref|XP_010097094.1|  Vacuolar-processing enzyme                         240   1e-72    Morus notabilis
ref|XP_004498922.1|  PREDICTED: vacuolar-processing enzyme-like         239   3e-72    Cicer arietinum [garbanzo]
ref|XP_008220440.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    240   3e-72    Prunus mume [ume]
gb|ACQ91103.1|  vacuolar processing enzyme a                            239   4e-72    Populus tomentosa [Chinese white poplar]
ref|XP_011019532.1|  PREDICTED: vacuolar-processing enzyme isofor...    238   9e-72    Populus euphratica
gb|KCW81643.1|  hypothetical protein EUGRSUZ_C03004                     236   1e-71    Eucalyptus grandis [rose gum]
ref|XP_002308580.1|  asparaginyl endopeptidase family protein           238   2e-71    Populus trichocarpa [western balsam poplar]
ref|NP_001236564.1|  vacuolar processing enzyme 2 precursor             237   2e-71    Glycine max [soybeans]
ref|XP_006853917.1|  hypothetical protein AMTR_s00036p00187360          236   3e-71    Amborella trichopoda
gb|AET08896.1|  vacuolar processing enzyme 4                            237   3e-71    Aegilops tauschii
ref|XP_010432633.1|  PREDICTED: vacuolar-processing enzyme gamma-...    237   3e-71    Camelina sativa [gold-of-pleasure]
ref|XP_003569218.1|  PREDICTED: vacuolar-processing enzyme-like         236   3e-71    Brachypodium distachyon [annual false brome]
ref|XP_010049168.1|  PREDICTED: vacuolar-processing enzyme-like         236   3e-71    Eucalyptus grandis [rose gum]
ref|XP_010447316.1|  PREDICTED: vacuolar-processing enzyme gamma-...    236   4e-71    Camelina sativa [gold-of-pleasure]
ref|XP_003550283.1|  PREDICTED: vacuolar-processing enzyme-like         236   4e-71    Glycine max [soybeans]
emb|CAQ00099.1|  legumain                                               236   5e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AET08893.1|  vacuolar processing enzyme 4                            236   5e-71    Aegilops speltoides
ref|XP_009407316.1|  PREDICTED: vacuolar-processing enzyme-like         236   6e-71    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF79136.1|  unknown                                                 236   7e-71    Zea mays [maize]
gb|EPS60197.1|  legumain/vacuolar processing enzyme                     225   7e-71    Genlisea aurea
ref|XP_007160985.1|  hypothetical protein PHAVU_001G033500g             235   1e-70    Phaseolus vulgaris [French bean]
ref|XP_009410798.1|  PREDICTED: vacuolar-processing enzyme              235   1e-70    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT10444.1|  Vacuolar-processing enzyme                              236   2e-70    
sp|P49044.1|VPE_VICSA  RecName: Full=Vacuolar-processing enzyme; ...    234   2e-70    Vicia sativa [spring vetch]
ref|XP_004968980.1|  PREDICTED: vacuolar-processing enzyme-like         234   2e-70    Setaria italica
sp|O24325.1|VPE1_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    234   3e-70    Phaseolus vulgaris [French bean]
ref|XP_010669169.1|  PREDICTED: vacuolar-processing enzyme-like         234   3e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006646004.1|  PREDICTED: vacuolar-processing enzyme-like         234   3e-70    
gb|AET08891.1|  vacuolar processing enzyme 4                            234   3e-70    Triticum monococcum [einkorn wheat]
emb|CAB64545.1|  legumain-like protease                                 233   5e-70    Zea mays [maize]
emb|CBM41515.1|  legumain/vacuolar processing enzyme                    233   6e-70    Papaver rhoeas [field poppy]
ref|XP_002455802.1|  hypothetical protein SORBIDRAFT_03g025440          233   7e-70    Sorghum bicolor [broomcorn]
emb|CDM87100.1|  unnamed protein product                                232   1e-69    Triticum aestivum [Canadian hard winter wheat]
gb|AFK44897.1|  unknown                                                 228   1e-69    Medicago truncatula
ref|NP_001105613.1|  LOC542609 precursor                                232   2e-69    
gb|AEY68248.1|  legumain                                                232   2e-69    Saccharum hybrid cultivar SP80-3280
ref|NP_001241716.1|  uncharacterized protein LOC100856894 precursor     231   4e-69    Zea mays [maize]
gb|KHN37015.1|  Vacuolar-processing enzyme                              231   5e-69    Glycine soja [wild soybean]
gb|AEO79971.1|  vacuolar processing enzyme                              231   5e-69    Arachis diogoi
emb|CAC18100.1|  putative legumain                                      231   5e-69    Zea mays [maize]
gb|ABF00019.1|  legumain precursor                                      231   6e-69    Saccharum officinarum [noble cane]
ref|XP_004960991.1|  PREDICTED: vacuolar-processing enzyme-like         230   7e-69    Setaria italica
ref|XP_003589032.1|  Vacuolar-processing enzyme                         229   8e-69    
gb|ACG34144.1|  vacuolar processing enzyme precursor                    230   9e-69    Zea mays [maize]
ref|NP_001105119.1|  legumain-like protease precursor                   230   1e-68    
gb|KEH39941.1|  vacuolar processing enzyme                              229   2e-68    Medicago truncatula
gb|ACJ84443.1|  unknown                                                 229   2e-68    Medicago truncatula
ref|NP_001043344.1|  Os01g0559600                                       229   5e-68    
dbj|BAJ95226.1|  predicted protein                                      228   6e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009795158.1|  PREDICTED: vacuolar-processing enzyme alpha-...    218   1e-67    Nicotiana sylvestris
gb|EEE54813.1|  hypothetical protein OsJ_02232                          228   1e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420869.1|  PREDICTED: vacuolar-processing enzyme-like         227   1e-67    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR18199.1|  unknown                                                 226   4e-67    Picea sitchensis
ref|XP_001759301.1|  predicted protein                                  224   3e-66    
ref|XP_008654306.1|  PREDICTED: uncharacterized protein LOC100192...    223   4e-66    Zea mays [maize]
gb|AAK15049.1|AF238384_1  asparaginyl endopeptidase                     223   5e-66    Vigna radiata [mung bean]
gb|AIB06797.1|  cte peptide ligase                                      223   5e-66    Clitoria ternatea
ref|XP_002448237.1|  hypothetical protein SORBIDRAFT_06g023820          222   1e-65    Sorghum bicolor [broomcorn]
gb|KJB54730.1|  hypothetical protein B456_009G046800                    221   2e-65    Gossypium raimondii
ref|NP_001236678.1|  vacuolar-processing enzyme precursor               221   4e-65    
gb|KHN09785.1|  Vacuolar-processing enzyme                              221   4e-65    Glycine soja [wild soybean]
ref|XP_001755207.1|  predicted protein                                  219   5e-65    
gb|AET08888.1|  vacuolar processing enzyme 1                            221   5e-65    Triticum monococcum [einkorn wheat]
ref|NP_001291333.1|  vacuolar-processing enzyme precursor               220   5e-65    Sesamum indicum [beniseed]
gb|KCW53995.1|  hypothetical protein EUGRSUZ_J03190                     218   6e-65    Eucalyptus grandis [rose gum]
dbj|BAA76745.1|  asparaginyl endopeptidase (VmPE-1A)                    220   6e-65    Vigna mungo [urad dal]
gb|KCW53994.1|  hypothetical protein EUGRSUZ_J03190                     218   6e-65    Eucalyptus grandis [rose gum]
gb|KCW53993.1|  hypothetical protein EUGRSUZ_J03190                     219   7e-65    Eucalyptus grandis [rose gum]
ref|XP_001769381.1|  predicted protein                                  219   7e-65    
ref|XP_002509577.1|  Vacuolar-processing enzyme precursor               220   9e-65    
ref|XP_009783281.1|  PREDICTED: vacuolar-processing enzyme-like         219   1e-64    Nicotiana sylvestris
gb|AET08895.1|  vacuolar processing enzyme 2                            219   2e-64    Aegilops tauschii
ref|XP_010034097.1|  PREDICTED: vacuolar-processing enzyme alpha-...    219   2e-64    Eucalyptus grandis [rose gum]
ref|XP_006579475.1|  PREDICTED: seed maturation protein PM40 isof...    219   2e-64    
gb|AET08892.1|  vacuolar processing enzyme 2                            219   3e-64    Aegilops speltoides
emb|CAB42651.2|  putative preprolegumain                                219   3e-64    Nicotiana tabacum [American tobacco]
ref|NP_001238297.1|  seed maturation protein PM40 precursor             219   3e-64    
ref|XP_006355318.1|  PREDICTED: vacuolar-processing enzyme-like         218   3e-64    Solanum tuberosum [potatoes]
gb|EPS73966.1|  asparaginyl endopeptidase                               218   4e-64    Genlisea aurea
ref|XP_009592399.1|  PREDICTED: vacuolar-processing enzyme              218   4e-64    Nicotiana tomentosiformis
gb|KDP25622.1|  hypothetical protein JCGZ_20778                         218   5e-64    Jatropha curcas
ref|NP_001152500.1|  LOC100286140                                       216   8e-64    Zea mays [maize]
gb|KHG24041.1|  Vacuolar-processing enzyme                              217   9e-64    Gossypium arboreum [tree cotton]
ref|XP_006355332.1|  PREDICTED: vacuolar-processing enzyme-like         216   9e-64    Solanum tuberosum [potatoes]
ref|XP_004976374.1|  PREDICTED: vacuolar-processing enzyme-like         217   1e-63    Setaria italica
ref|NP_001105183.1|  vacuolar processing enzyme1 precursor              217   1e-63    Zea mays [maize]
ref|XP_009771365.1|  PREDICTED: vacuolar-processing enzyme beta-i...    217   1e-63    Nicotiana sylvestris
gb|ABK25457.1|  unknown                                                 216   1e-63    Picea sitchensis
dbj|BAC41386.1|  asparaginyl endopeptidase REP-2                        217   1e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004147613.1|  PREDICTED: vacuolar-processing enzyme-like         216   2e-63    Cucumis sativus [cucumbers]
sp|P49046.1|LEGU_CANEN  RecName: Full=Legumain; AltName: Full=Asp...    216   2e-63    Canavalia ensiformis [horse bean]
ref|XP_002304429.2|  hypothetical protein POPTR_0003s11280g             216   2e-63    
ref|XP_008668185.1|  PREDICTED: LOC100286140 isoform X1                 216   2e-63    Zea mays [maize]
ref|XP_006302155.1|  hypothetical protein CARUB_v10020164mg             217   2e-63    
ref|XP_009621616.1|  PREDICTED: vacuolar-processing enzyme gamma-...    215   2e-63    Nicotiana tomentosiformis
ref|XP_002441635.1|  hypothetical protein SORBIDRAFT_09g030710          216   3e-63    
ref|XP_004245377.1|  PREDICTED: vacuolar-processing enzyme-like         215   3e-63    
ref|XP_003569976.1|  PREDICTED: vacuolar-processing enzyme beta-i...    216   3e-63    Brachypodium distachyon [annual false brome]
gb|EYU24761.1|  hypothetical protein MIMGU_mgv1a005235mg                216   4e-63    Erythranthe guttata [common monkey flower]
gb|EYU34366.1|  hypothetical protein MIMGU_mgv1a018579mg                215   8e-63    Erythranthe guttata [common monkey flower]
ref|XP_006355333.1|  PREDICTED: vacuolar-processing enzyme-like         214   8e-63    Solanum tuberosum [potatoes]
ref|XP_006391830.1|  hypothetical protein EUTSA_v10023430mg             214   8e-63    Eutrema salsugineum [saltwater cress]
ref|XP_010933721.1|  PREDICTED: vacuolar-processing enzyme              214   1e-62    Elaeis guineensis
ref|XP_006838618.1|  hypothetical protein AMTR_s00002p00230380          208   1e-62    
gb|KHG28226.1|  Vacuolar-processing enzyme                              213   1e-62    Gossypium arboreum [tree cotton]
gb|KJB25635.1|  hypothetical protein B456_004G201300                    214   2e-62    Gossypium raimondii
ref|XP_004953273.1|  PREDICTED: vacuolar-processing enzyme beta-i...    214   2e-62    Setaria italica
gb|AFW72544.1|  vacuolar processing enzyme 1                            214   2e-62    
ref|XP_004245119.1|  PREDICTED: vacuolar-processing enzyme-like         213   2e-62    
emb|CAQ00096.1|  legumain                                               214   2e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004298668.1|  PREDICTED: legumain                                214   2e-62    Fragaria vesca subsp. vesca
ref|XP_002452849.1|  hypothetical protein SORBIDRAFT_04g033520          213   3e-62    Sorghum bicolor [broomcorn]
ref|XP_010418271.1|  PREDICTED: vacuolar-processing enzyme beta-i...    213   3e-62    Camelina sativa [gold-of-pleasure]
ref|XP_008796848.1|  PREDICTED: vacuolar-processing enzyme              213   4e-62    Phoenix dactylifera
ref|XP_010669185.1|  PREDICTED: vacuolar-processing enzyme gamma-...    212   4e-62    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007155624.1|  hypothetical protein PHAVU_003G217500g             213   4e-62    Phaseolus vulgaris [French bean]
ref|XP_006355496.1|  PREDICTED: vacuolar-processing enzyme beta-i...    213   5e-62    Solanum tuberosum [potatoes]
ref|XP_008437131.1|  PREDICTED: legumain                                213   5e-62    Cucumis melo [Oriental melon]
ref|XP_011018251.1|  PREDICTED: vacuolar-processing enzyme              213   6e-62    Populus euphratica
sp|O24326.1|VPE2_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    213   6e-62    Phaseolus vulgaris [French bean]
emb|CAQ00100.1|  legumain                                               212   6e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI28507.3|  unnamed protein product                                214   6e-62    Vitis vinifera
ref|XP_010473493.1|  PREDICTED: vacuolar-processing enzyme beta-i...    212   7e-62    Camelina sativa [gold-of-pleasure]
ref|XP_006355317.1|  PREDICTED: vacuolar-processing enzyme-like         211   9e-62    Solanum tuberosum [potatoes]
ref|XP_006355331.1|  PREDICTED: vacuolar-processing enzyme-like         211   9e-62    Solanum tuberosum [potatoes]
ref|XP_010676183.1|  PREDICTED: vacuolar-processing enzyme              212   1e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209951.1|  hypothetical protein PRUPE_ppa004795mg             212   1e-61    Prunus persica
gb|ACJ85695.1|  unknown                                                 206   1e-61    Medicago truncatula
ref|XP_010430341.1|  PREDICTED: vacuolar-processing enzyme beta-i...    212   1e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010264202.1|  PREDICTED: vacuolar-processing enzyme-like         212   1e-61    Nelumbo nucifera [Indian lotus]
ref|XP_004245378.1|  PREDICTED: vacuolar-processing enzyme-like         214   2e-61    
ref|XP_011033921.1|  PREDICTED: vacuolar-processing enzyme-like         211   2e-61    Populus euphratica
ref|XP_010053427.1|  PREDICTED: vacuolar-processing enzyme isofor...    211   2e-61    Eucalyptus grandis [rose gum]
emb|CDY39808.1|  BnaA09g10600D                                          211   2e-61    Brassica napus [oilseed rape]
emb|CDY03258.1|  BnaC09g10900D                                          211   3e-61    
ref|XP_008369533.1|  PREDICTED: legumain                                211   3e-61    Malus domestica [apple tree]
gb|KJB51882.1|  hypothetical protein B456_008G236100                    211   3e-61    Gossypium raimondii
ref|XP_010325045.1|  PREDICTED: vacuolar-processing enzyme-like         210   3e-61    Solanum lycopersicum
ref|XP_010093667.1|  Vacuolar-processing enzyme                         210   5e-61    Morus notabilis
ref|XP_003608768.1|  Vacuolar-processing enzyme                         207   5e-61    
gb|KJB70141.1|  hypothetical protein B456_011G060200                    209   5e-61    Gossypium raimondii
ref|XP_010646818.1|  PREDICTED: vacuolar-processing enzyme              210   5e-61    Vitis vinifera
dbj|BAA09615.1|  vacuolar processing enzyme                             210   5e-61    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176458.1|  vacuolar-processing enzyme beta                       210   6e-61    Arabidopsis thaliana [mouse-ear cress]
gb|AES90965.2|  vacuolar processing enzyme                              207   6e-61    Medicago truncatula
ref|XP_010259032.1|  PREDICTED: vacuolar-processing enzyme-like         209   7e-61    Nelumbo nucifera [Indian lotus]
emb|CAA07639.1|  cysteine proteinase precursor                          210   7e-61    Vicia sativa [spring vetch]
ref|XP_004245120.1|  PREDICTED: vacuolar-processing enzyme gamma-...    209   9e-61    
emb|CAB51545.1|  vacuolar processing enzyme                             209   9e-61    Solanum lycopersicum var. cerasiforme [cherry tomato]
ref|XP_002983346.1|  hypothetical protein SELMODRAFT_445464             209   1e-60    
gb|EMS56147.1|  Vacuolar-processing enzyme                              208   1e-60    Triticum urartu
ref|XP_009764212.1|  PREDICTED: vacuolar-processing enzyme-like         208   1e-60    Nicotiana sylvestris
ref|XP_009112700.1|  PREDICTED: vacuolar-processing enzyme beta-i...    209   1e-60    Brassica rapa
ref|XP_002960690.1|  hypothetical protein SELMODRAFT_75074              209   1e-60    
ref|XP_010553469.1|  PREDICTED: vacuolar-processing enzyme beta-i...    209   1e-60    Tarenaya hassleriana [spider flower]
ref|XP_010669196.1|  PREDICTED: vacuolar-processing enzyme gamma-...    208   1e-60    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006647602.1|  PREDICTED: vacuolar-processing enzyme-like         209   1e-60    Oryza brachyantha
ref|XP_008337583.1|  PREDICTED: vacuolar-processing enzyme-like         208   2e-60    
ref|XP_008367907.1|  PREDICTED: vacuolar-processing enzyme-like         202   2e-60    
gb|AGC54786.1|  beta vacuolar processing enzyme                         208   2e-60    Vitis vinifera
ref|XP_009371106.1|  PREDICTED: vacuolar-processing enzyme-like         207   2e-60    Pyrus x bretschneideri [bai li]
ref|XP_006355330.1|  PREDICTED: vacuolar-processing enzyme-like         207   3e-60    Solanum tuberosum [potatoes]
ref|XP_009371110.1|  PREDICTED: vacuolar-processing enzyme-like         207   3e-60    Pyrus x bretschneideri [bai li]
ref|XP_001784456.1|  predicted protein                                  207   3e-60    
ref|XP_003608766.1|  Vacuolar-processing enzyme                         207   4e-60    
gb|AES90963.2|  vacuolar processing enzyme                              207   4e-60    Medicago truncatula
ref|XP_004245733.1|  PREDICTED: vacuolar-processing enzyme beta-i...    207   4e-60    
ref|XP_004305798.1|  PREDICTED: vacuolar-processing enzyme-like         206   6e-60    Fragaria vesca subsp. vesca
ref|XP_011465105.1|  PREDICTED: vacuolar-processing enzyme-like         206   7e-60    Fragaria vesca subsp. vesca
ref|XP_003580236.1|  PREDICTED: vacuolar-processing enzyme beta-i...    207   9e-60    
ref|XP_008370166.1|  PREDICTED: vacuolar-processing enzyme-like         206   1e-59    Malus domestica [apple tree]
ref|XP_004515742.1|  PREDICTED: vacuolar-processing enzyme-like         207   1e-59    Cicer arietinum [garbanzo]
emb|CDP09908.1|  unnamed protein product                                206   1e-59    Coffea canephora [robusta coffee]
ref|NP_001131347.1|  uncharacterized protein LOC100192667 precursor     206   1e-59    Zea mays [maize]
emb|CAQ00098.1|  legumain                                               206   1e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD51741.1|  vacuolar processing enzyme 1b                          201   1e-59    Nicotiana benthamiana
emb|CBX26639.1|  vacuolar processing enzyme 2c                          206   2e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006440379.1|  hypothetical protein CICLE_v10019686mg             207   2e-59    Citrus clementina [clementine]
emb|CBX26640.1|  vacuolar processing enzyme 2d                          206   2e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD51740.1|  vacuolar processing enzyme 1a                          200   2e-59    
ref|XP_009616671.1|  PREDICTED: vacuolar-processing enzyme-like         206   2e-59    
ref|XP_008337584.1|  PREDICTED: vacuolar-processing enzyme-like         205   3e-59    
emb|CAB16318.1|  cysteine proteinase precursor                          205   3e-59    
ref|NP_001053428.1|  Os04g0537900                                       206   3e-59    
ref|NP_001056504.1|  Os05g0593900                                       205   3e-59    
ref|XP_008337582.1|  PREDICTED: vacuolar-processing enzyme-like         204   3e-59    
gb|AFK47471.1|  unknown                                                 198   4e-59    
emb|CAE03020.3|  OSJNBa0091D06.13                                       206   4e-59    
ref|XP_009379206.1|  PREDICTED: vacuolar-processing enzyme-like         204   5e-59    
ref|XP_006477253.1|  PREDICTED: vacuolar-processing enzyme-like         206   5e-59    
ref|XP_007039931.1|  Beta vacuolar processing enzyme                    206   5e-59    
ref|XP_009371107.1|  PREDICTED: vacuolar-processing enzyme-like         204   7e-59    
gb|ABS57371.1|  VPE1                                                    204   8e-59    
ref|XP_007202848.1|  hypothetical protein PRUPE_ppa014701mg             203   8e-59    
ref|XP_008240642.1|  PREDICTED: vacuolar-processing enzyme-like         202   1e-58    
ref|XP_008228013.1|  PREDICTED: vacuolar-processing enzyme-like         203   1e-58    
gb|EMS59602.1|  Vacuolar-processing enzyme                              198   1e-58    
ref|XP_010325261.1|  PREDICTED: vacuolar-processing enzyme-like         203   2e-58    
ref|XP_009382344.1|  PREDICTED: legumain-like                           204   2e-58    
ref|XP_004303795.1|  PREDICTED: vacuolar-processing enzyme-like         202   2e-58    
ref|XP_010669190.1|  PREDICTED: vacuolar-processing enzyme-like         202   2e-58    
ref|XP_006838617.1|  hypothetical protein AMTR_s00002p00230280          202   2e-58    
ref|XP_008367906.1|  PREDICTED: vacuolar-processing enzyme-like         202   2e-58    
sp|B8ASK4.1|VPE1_ORYSI  RecName: Full=Vacuolar-processing enzyme ...    202   3e-58    
ref|XP_008392598.1|  PREDICTED: vacuolar-processing enzyme-like         202   4e-58    
ref|XP_009344982.1|  PREDICTED: vacuolar-processing enzyme-like         202   4e-58    
ref|XP_006450041.1|  hypothetical protein CICLE_v10013934mg             201   5e-58    
emb|CAQ00097.1|  legumain                                               202   6e-58    
ref|XP_008352319.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    201   6e-58    
gb|EYU21190.1|  hypothetical protein MIMGU_mgv1a005661mg                201   6e-58    
ref|XP_008361289.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    201   7e-58    
ref|XP_006652582.1|  PREDICTED: vacuolar-processing enzyme-like         202   7e-58    
emb|CBX26638.1|  vacuolar processing enzyme 2b                          202   8e-58    
ref|XP_007216154.1|  hypothetical protein PRUPE_ppa015210mg             201   9e-58    
gb|EAY99324.1|  hypothetical protein OsI_21293                          195   1e-57    
ref|XP_010325264.1|  PREDICTED: vacuolar-processing enzyme-like         203   1e-57    
ref|XP_011033074.1|  PREDICTED: vacuolar-processing enzyme alpha-...    201   1e-57    
gb|KJB35711.1|  hypothetical protein B456_006G124900                    200   2e-57    
ref|XP_002987841.1|  hypothetical protein SELMODRAFT_126781             199   2e-57    
ref|XP_002993765.1|  hypothetical protein SELMODRAFT_137569             199   2e-57    
gb|KJB35710.1|  hypothetical protein B456_006G124900                    200   2e-57    
gb|KHG20621.1|  Vacuolar-processing enzyme                              200   2e-57    
ref|XP_010112451.1|  Vacuolar-processing enzyme                         204   6e-57    
ref|XP_006654878.1|  PREDICTED: vacuolar-processing enzyme-like         198   8e-57    
ref|XP_002310920.1|  hypothetical protein POPTR_0008s00410g             198   1e-56    
ref|XP_010545489.1|  PREDICTED: vacuolar-processing enzyme gamma-...    197   2e-56    
gb|EMT06055.1|  Vacuolar-processing enzyme                              198   2e-56    
ref|XP_010034096.1|  PREDICTED: vacuolar-processing enzyme-like         197   3e-56    
ref|XP_008380412.1|  PREDICTED: vacuolar-processing enzyme              197   4e-56    
ref|XP_002883236.1|  DELTA-VPE                                          196   4e-56    
ref|XP_007023637.1|  Delta vacuolar processing enzyme, putative         197   6e-56    
dbj|BAA90621.1|  putative asparagine-specific endopeptidase precu...    196   7e-56    
ref|XP_010545490.1|  PREDICTED: vacuolar-processing enzyme alpha-...    198   8e-56    
ref|XP_003622265.1|  Vacuolar processing enzyme-1b                      196   8e-56    
ref|NP_188656.1|  delta vacuolar processing enzyme                      196   1e-55    
gb|AAM60827.1|  vacuolar processing enzyme/asparaginyl endopeptid...    195   1e-55    
gb|KCW53991.1|  hypothetical protein EUGRSUZ_J03188                     194   1e-55    
ref|XP_010034095.1|  PREDICTED: vacuolar-processing enzyme-like         194   2e-55    
ref|XP_011467518.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    196   2e-55    
gb|EMT02419.1|  Vacuolar-processing enzyme                              195   5e-55    
ref|XP_006406410.1|  hypothetical protein EUTSA_v10020662mg             193   7e-55    
ref|NP_001189938.1|  delta vacuolar processing enzyme                   195   8e-55    
emb|CDY12724.1|  BnaC04g29170D                                          194   9e-55    
ref|XP_009111229.1|  PREDICTED: vacuolar-processing enzyme-like         192   1e-54    
emb|CDP09909.1|  unnamed protein product                                193   2e-54    
gb|EAY99261.1|  hypothetical protein OsI_21225                          191   2e-54    
emb|CAB42655.1|  putative preprolegumain                                190   2e-54    
ref|XP_008238625.1|  PREDICTED: LOW QUALITY PROTEIN: legumain           190   2e-53    
gb|EMT15482.1|  Vacuolar-processing enzyme                              191   3e-53    
gb|EMT06287.1|  Vacuolar-processing enzyme                              187   4e-53    
ref|XP_010034886.1|  PREDICTED: vacuolar-processing enzyme-like         191   6e-53    
emb|CDY29802.1|  BnaC05g31880D                                          188   7e-53    
ref|XP_009145662.1|  PREDICTED: vacuolar-processing enzyme              188   8e-53    
emb|CDY25397.1|  BnaA05g18870D                                          187   9e-53    
gb|EMS54452.1|  Vacuolar-processing enzyme                              187   9e-53    
ref|XP_002886459.1|  F23N19.7                                           189   1e-52    
emb|CDY42232.1|  BnaA01g25630D                                          188   2e-52    
ref|XP_002266627.1|  PREDICTED: vacuolar-processing enzyme              186   3e-52    
gb|KHG10620.1|  Vacuolar-processing enzyme                              186   3e-52    
gb|EMS65516.1|  Vacuolar-processing enzyme                              186   3e-52    
gb|KHG10619.1|  Vacuolar-processing enzyme                              186   5e-52    
ref|XP_010112450.1|  Vacuolar-processing enzyme                         186   5e-52    
ref|XP_006450038.1|  hypothetical protein CICLE_v100139432mg            182   5e-52    
ref|XP_010508646.1|  PREDICTED: vacuolar-processing enzyme-like i...    186   9e-52    
gb|AAF19550.1|AC007190_18  F23N19.7                                     186   1e-51    
gb|EMT07410.1|  Vacuolar-processing enzyme beta-isozyme                 184   2e-51    
ref|XP_003624089.1|  Vacuolar processing enzyme-1a                      184   4e-51    
gb|AES80307.2|  vacuolar processing enzyme                              183   4e-51    
ref|XP_006599066.1|  PREDICTED: vacuolar-processing enzyme-like         183   4e-51    
emb|CAN76990.1|  hypothetical protein VITISV_028106                     183   5e-51    
ref|XP_010508655.1|  PREDICTED: vacuolar-processing enzyme alpha-...    185   5e-51    
ref|XP_006450035.1|  hypothetical protein CICLE_v10013957mg             183   5e-51    
gb|KHN27584.1|  Vacuolar-processing enzyme                              183   5e-51    
ref|XP_006296792.1|  hypothetical protein CARUB_v10016221mg             182   1e-50    
ref|XP_009396761.1|  PREDICTED: vacuolar-processing enzyme-like         181   2e-50    
ref|XP_010487991.1|  PREDICTED: vacuolar-processing enzyme gamma-...    181   4e-50    
ref|XP_010466201.1|  PREDICTED: vacuolar-processing enzyme alpha-...    182   5e-50    
ref|XP_010487992.1|  PREDICTED: vacuolar-processing enzyme alpha-...    181   2e-49    
ref|XP_009794187.1|  PREDICTED: vacuolar-processing enzyme-like         176   9e-49    
gb|KFK39346.1|  vacuolar processing enzyme                              177   1e-48    
ref|NP_001047562.1|  Os02g0644000                                       176   1e-48    
ref|XP_009762559.1|  PREDICTED: vacuolar-processing enzyme-like         175   2e-48    
ref|XP_010695188.1|  PREDICTED: vacuolar-processing enzyme-like         174   4e-48    
ref|XP_010053430.1|  PREDICTED: vacuolar-processing enzyme isofor...    174   4e-48    
ref|XP_009616669.1|  PREDICTED: vacuolar-processing enzyme-like         174   1e-47    
emb|CAE84598.1|  putative legumain                                      174   1e-47    
ref|XP_007216228.1|  hypothetical protein PRUPE_ppa016772mg             172   2e-47    
ref|XP_006798653.1|  PREDICTED: LOW QUALITY PROTEIN: legumain-like      172   6e-47    
gb|AES79969.2|  vacuolar processing enzyme                              172   9e-47    
ref|XP_003623751.1|  Vacuolar processing enzyme-1b                      172   9e-47    
ref|XP_003445512.1|  PREDICTED: legumain-like                           171   1e-46    
ref|XP_004491991.1|  PREDICTED: vacuolar-processing enzyme-like         171   2e-46    
ref|XP_004491990.1|  PREDICTED: vacuolar-processing enzyme-like         171   2e-46    
ref|XP_005814710.1|  PREDICTED: legumain-like                           170   3e-46    
ref|XP_008311587.1|  PREDICTED: legumain                                170   3e-46    
gb|EMT33588.1|  Vacuolar-processing enzyme beta-isozyme                 168   9e-46    
ref|XP_005934073.1|  PREDICTED: legumain-like                           168   1e-45    
ref|XP_004540898.1|  PREDICTED: legumain-like                           168   2e-45    
ref|XP_004491695.1|  PREDICTED: vacuolar-processing enzyme-like         167   2e-45    
ref|XP_005746569.1|  PREDICTED: legumain-like                           168   2e-45    
emb|CDQ86798.1|  unnamed protein product                                165   2e-45    
gb|AAL40390.1|  C13 cysteine proteinase precursor                       167   4e-45    
ref|XP_004491694.1|  PREDICTED: vacuolar-processing enzyme-like         167   6e-45    
gb|EMT00724.1|  Vacuolar-processing enzyme                              167   7e-45    
ref|NP_001005720.1|  legumain precursor                                 166   7e-45    
gb|KDR20936.1|  Legumain                                                167   7e-45    
ref|NP_001158867.1|  legumain precursor                                 166   8e-45    
ref|XP_008397176.1|  PREDICTED: legumain                                166   8e-45    
gb|ABM88796.1|  asparaginyl endopeptidase                               166   8e-45    
emb|CBX26637.1|  vacuolar processing enzyme 2a                          165   9e-45    
gb|AAD04882.1|  C13 endopeptidase NP1 precursor                         165   1e-44    
ref|XP_004491696.1|  PREDICTED: vacuolar-processing enzyme-like         166   1e-44    
ref|XP_004499640.1|  PREDICTED: vacuolar-processing enzyme-like         165   2e-44    
ref|XP_010742692.1|  PREDICTED: legumain isoform X2                     165   2e-44    
ref|XP_010742690.1|  PREDICTED: legumain isoform X1                     165   2e-44    
ref|XP_004491989.1|  PREDICTED: vacuolar-processing enzyme-like         161   2e-44    
ref|XP_005651789.1|  hypothetical protein COCSUDRAFT_64138              166   3e-44    
gb|ACO55745.1|  legumain                                                164   4e-44    
ref|XP_005102987.1|  PREDICTED: legumain-like                           164   5e-44    
ref|XP_002594937.1|  hypothetical protein BRAFLDRAFT_130503             162   6e-44    
gb|ADO28000.1|  legumain                                                164   6e-44    
ref|XP_010607523.1|  PREDICTED: legumain                                164   6e-44    
ref|XP_007247684.1|  PREDICTED: legumain-like                           163   7e-44    
ref|XP_010497350.1|  PREDICTED: vacuolar-processing enzyme alpha-...    154   9e-44    
ref|XP_004082135.1|  PREDICTED: legumain                                163   1e-43    
ref|XP_007543209.1|  PREDICTED: legumain                                163   1e-43    
ref|XP_004491693.1|  PREDICTED: vacuolar-processing enzyme-like         164   1e-43    
ref|XP_005846964.1|  hypothetical protein CHLNCDRAFT_24292              163   1e-43    
ref|NP_999924.1|  legumain precursor                                    162   2e-43    
ref|XP_008300355.1|  PREDICTED: legumain                                162   3e-43    
ref|NP_001079911.1|  legumain precursor                                 161   4e-43    
ref|XP_010152101.1|  PREDICTED: legumain-like                           155   4e-43    
ref|XP_003746513.1|  PREDICTED: legumain-like                           160   6e-43    
ref|XP_003430977.1|  PREDICTED: legumain                                160   8e-43    
ref|XP_004499587.1|  PREDICTED: vacuolar-processing enzyme gamma-...    161   8e-43    
ref|XP_001624969.1|  predicted protein                                  160   1e-42    
ref|XP_005047582.1|  PREDICTED: legumain                                160   1e-42    
ref|XP_002408770.1|  asparaginyl peptidase, putative                    153   1e-42    
ref|XP_005506193.1|  PREDICTED: legumain                                160   2e-42    
dbj|BAJ97485.1|  predicted protein                                      160   2e-42    
ref|XP_010325260.1|  PREDICTED: vacuolar-processing enzyme-like         157   2e-42    
ref|XP_003726596.1|  PREDICTED: legumain-like                           155   2e-42    
ref|XP_007055499.1|  PREDICTED: legumain                                159   2e-42    
ref|XP_005520237.1|  PREDICTED: legumain isoform X1                     159   2e-42    
ref|XP_005483227.1|  PREDICTED: legumain                                159   2e-42    
ref|XP_004885825.1|  PREDICTED: legumain isoform X2                     159   2e-42    
gb|KFQ10712.1|  Legumain                                                159   2e-42    
ref|XP_009928897.1|  PREDICTED: legumain                                159   2e-42    
ref|XP_009948847.1|  PREDICTED: legumain                                159   2e-42    
gb|KFW89187.1|  Legumain                                                159   2e-42    
gb|KFP81497.1|  Legumain                                                159   2e-42    
ref|XP_009499577.1|  PREDICTED: legumain                                159   2e-42    
gb|KFO76676.1|  Legumain                                                159   2e-42    
ref|XP_009074415.1|  PREDICTED: legumain                                159   2e-42    
pdb|4AW9|A  Chain A, Crystal Structure Of Active Legumain In Comp...    155   3e-42    
ref|XP_006133723.1|  PREDICTED: legumain isoform X1                     159   3e-42    
gb|KFO14059.1|  Legumain                                                159   3e-42    
ref|XP_010307168.1|  PREDICTED: legumain                                159   3e-42    
ref|XP_010877712.1|  PREDICTED: legumain                                159   3e-42    
ref|XP_009559888.1|  PREDICTED: legumain                                159   3e-42    
gb|KGL86051.1|  Legumain                                                159   3e-42    
ref|XP_009100045.1|  PREDICTED: legumain                                159   3e-42    
ref|XP_009893669.1|  PREDICTED: legumain                                159   3e-42    
ref|XP_010392656.1|  PREDICTED: legumain                                159   3e-42    
ref|XP_005339200.1|  PREDICTED: legumain                                159   3e-42    
ref|XP_004885824.1|  PREDICTED: legumain isoform X1                     159   3e-42    
gb|KFQ37597.1|  Legumain                                                159   3e-42    
ref|XP_010184752.1|  PREDICTED: legumain                                159   4e-42    
gb|KFO87181.1|  Legumain                                                159   4e-42    
ref|XP_005285496.1|  PREDICTED: legumain                                159   4e-42    
gb|KFV58791.1|  Legumain                                                159   4e-42    
gb|KFO56104.1|  Legumain                                                159   4e-42    
ref|XP_008627939.1|  PREDICTED: legumain                                159   4e-42    
ref|XP_010130294.1|  PREDICTED: legumain                                159   4e-42    
sp|Q9R0J8.1|LGMN_RAT  RecName: Full=Legumain; AltName: Full=Aspar...    159   4e-42    
ref|XP_009971283.1|  PREDICTED: legumain                                159   4e-42    
ref|NP_071562.2|  legumain precursor                                    159   4e-42    
gb|AAH87708.1|  Legumain                                                159   4e-42    
gb|EOA99906.1|  Legumain                                                157   5e-42    
gb|KFR12503.1|  Legumain                                                158   5e-42    
ref|XP_009935106.1|  PREDICTED: legumain                                158   6e-42    
gb|KFV15585.1|  Legumain                                                158   6e-42    
ref|XP_009981958.1|  PREDICTED: legumain                                158   7e-42    
emb|CBI23452.3|  unnamed protein product                                160   7e-42    
gb|KFU94233.1|  Legumain                                                158   7e-42    
ref|XP_002200594.1|  PREDICTED: legumain                                158   7e-42    
gb|KFP11255.1|  Legumain                                                158   8e-42    
ref|XP_010002025.1|  PREDICTED: legumain                                158   8e-42    
ref|XP_009647266.1|  PREDICTED: legumain                                158   8e-42    
dbj|BAE88044.1|  unnamed protein product                                157   8e-42    
gb|KFP38901.1|  Legumain                                                158   8e-42    
dbj|BAA09530.1|  cysteine protease                                      158   8e-42    
gb|KFO95700.1|  Legumain                                                157   9e-42    
ref|XP_010127936.1|  PREDICTED: legumain                                157   9e-42    
ref|XP_005149570.1|  PREDICTED: legumain                                157   1e-41    
ref|XP_008490697.1|  PREDICTED: legumain                                157   1e-41    
gb|KFZ64948.1|  Legumain                                                157   1e-41    
gb|KFM08581.1|  Legumain                                                157   1e-41    
ref|XP_009279064.1|  PREDICTED: legumain                                157   1e-41    
gb|KFW72980.1|  Legumain                                                157   1e-41    



>gb|AAF69014.1|AF260827_1 cysteine protease [Ipomoea batatas]
Length=492

 Score =   326 bits (836),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            MIRSV ASLLLLT SIVAVADGR FLKLPSEARRFFRPAEEENREADGDDSVGTRWAVLI
Sbjct  1    MIRSVVASLLLLTVSIVAVADGRGFLKLPSEARRFFRPAEEENREADGDDSVGTRWAVLI  60

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKG+IIN+PHGED
Sbjct  61   AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGIIINSPHGED  120

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VYHGVPKDYTGDDVT +NLLAVILGDKSAVKGGSGKVVDSGPNDHIF+YYSDHGGPGVLG
Sbjct  121  VYHGVPKDYTGDDVTANNLLAVILGDKSAVKGGSGKVVDSGPNDHIFIYYSDHGGPGVLG  180

Query  614  MPTSPYLYADDLNAALKKKHAAG  682
            MPTSPYLYAD+LNAALKKKHAAG
Sbjct  181  MPTSPYLYADELNAALKKKHAAG  203



>gb|EYU29312.1| hypothetical protein MIMGU_mgv1a005315mg [Erythranthe guttata]
Length=489

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            MIR  A +   L  SI+ VA+GRD +KLPSEARRFF  +EE N EA GDDSVGTRWAVL+
Sbjct  1    MIRYAAGTFFFLALSILTVANGRDLIKLPSEARRFFAGSEEANDEA-GDDSVGTRWAVLL  59

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS+GYWNYRHQAD+CHAYQILK GGL+DENIVVFMYDDIA NEENPR GVIIN+PHGED
Sbjct  60   AGSSGYWNYRHQADVCHAYQILKRGGLRDENIVVFMYDDIANNEENPRPGVIINSPHGED  119

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDY GDDVTVDN  AV+LG+K+AVKGGSGKVVDSGPNDHIFVYYSDHGGPGVLG
Sbjct  120  VYKGVPKDYVGDDVTVDNFFAVLLGNKTAVKGGSGKVVDSGPNDHIFVYYSDHGGPGVLG  179

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPTSPYLYA+DL   LK KHA+GT
Sbjct  180  MPTSPYLYANDLIDVLKTKHASGT  203



>ref|XP_009616670.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
 dbj|BAC54828.1| vacuolar processing enzyme-1b [Nicotiana tabacum]
Length=489

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 176/205 (86%), Gaps = 2/205 (1%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSI-VAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            MIR VA +L L+  ++ VAV++ R+ LKLPSE  RFF   E    + D DDSVGTRWA+L
Sbjct  1    MIRYVAGTLFLIGLALNVAVSESRNVLKLPSEVSRFFGADESNAGDHD-DDSVGTRWAIL  59

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA NEENPR+GVIIN+PHGE
Sbjct  60   LAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNEENPRRGVIINSPHGE  119

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDVTVDN  AVILG+K+A+ GGSGKVV+SGPNDHIF++YSDHGGPGVL
Sbjct  120  DVYKGVPKDYTGDDVTVDNFFAVILGNKTALSGGSGKVVNSGPNDHIFIFYSDHGGPGVL  179

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT PYLYA+DL   LKKKHA+GT
Sbjct  180  GMPTDPYLYANDLIDVLKKKHASGT  204



>ref|XP_009616632.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
 dbj|BAC54830.1| vacuolar processing enzyme-3 [Nicotiana tabacum]
Length=481

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 171/204 (84%), Gaps = 9/204 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            MI   A    L+ FSI A ADGR+ LKLPSEA RFF          + DDSVGTRWAVL+
Sbjct  1    MISYAAGIFFLVGFSIAAAADGRNVLKLPSEASRFFD---------EADDSVGTRWAVLL  51

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYRHQAD+CHAYQ+L+ GGLKDENI++FMYDDIAYNEENPR+GVIIN+P GED
Sbjct  52   AGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIMFMYDDIAYNEENPRQGVIINSPAGED  111

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTGDDV VDN LAV+LG+K+A+ GGSGKVVDSGPNDHIF++YSDHGGPGVLG
Sbjct  112  VYKGVPKDYTGDDVNVDNFLAVLLGNKTALTGGSGKVVDSGPNDHIFIFYSDHGGPGVLG  171

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT+PYLYA DL   LKKKHA+GT
Sbjct  172  MPTNPYLYASDLIDVLKKKHASGT  195



>ref|XP_009780274.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
Length=481

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 171/204 (84%), Gaps = 9/204 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            MI  VA    L+  S++A A GR+ LKLPSEA RFF          + DDSVGTRWAVL+
Sbjct  1    MISYVAGIFFLVGLSVIAAAAGRNVLKLPSEASRFFD---------EADDSVGTRWAVLL  51

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYRHQAD+CHAYQ+L+ GGLKDENI+VFMYDDIAYNEENPR+GVIIN+P GED
Sbjct  52   AGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAYNEENPRQGVIINSPAGED  111

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTGDDV VDN LAV+LG+K+A+ GGSGKVVDSGPNDHIFV+YSDHGGPGVLG
Sbjct  112  VYKGVPKDYTGDDVNVDNFLAVLLGNKTALTGGSGKVVDSGPNDHIFVFYSDHGGPGVLG  171

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT+PYLYA DL   LKKKHA+GT
Sbjct  172  MPTNPYLYASDLIDVLKKKHASGT  195



>ref|XP_006355320.1| PREDICTED: vacuolar-processing enzyme [Solanum tuberosum]
Length=482

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 174/205 (85%), Gaps = 9/205 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSI-VAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M RS+A  L L+  S+ V+V++ R+FLKLPSE  RFF          D +DSVGTRWA+L
Sbjct  1    MNRSIAGVLFLIALSLNVSVSESRNFLKLPSEGSRFFDA--------DENDSVGTRWAIL  52

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA NEENPR+GVIIN+PHGE
Sbjct  53   LAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNEENPRQGVIINSPHGE  112

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDVTV+N LA +LG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG GV+
Sbjct  113  DVYKGVPKDYTGDDVTVNNFLAALLGNKTAITGGSGKVVDSGPNDHIFIFYSDHGGAGVI  172

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT PYLYA+DL  ALKKKHA+GT
Sbjct  173  GMPTDPYLYANDLIDALKKKHASGT  197



>gb|ACC68680.1| vacoular processing enzyme 1 [Solanum tuberosum]
Length=482

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 174/205 (85%), Gaps = 9/205 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSI-VAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M RS+A  L L+  S+ V+V++ R+FLKLPSE  RFF          D +DSVGTRWA+L
Sbjct  1    MNRSIAGVLFLIALSLNVSVSESRNFLKLPSEGSRFFDA--------DENDSVGTRWAIL  52

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA NEENPR+GVIIN+PHGE
Sbjct  53   LAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNEENPRQGVIINSPHGE  112

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDVTV+N LA +LG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG GV+
Sbjct  113  DVYKGVPKDYTGDDVTVNNFLAALLGNKTAITGGSGKVVDSGPNDHIFIFYSDHGGAGVI  172

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT PYLYA+DL  ALKKKHA+GT
Sbjct  173  GMPTDPYLYANDLIDALKKKHASGT  197



>ref|XP_004245113.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=482

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 174/205 (85%), Gaps = 9/205 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSI-VAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M RSVA  L L+  S+ V+V++ R+FLKLPSE  RFF          D  DSVGTRWA+L
Sbjct  1    MNRSVAGVLFLIALSLNVSVSESRNFLKLPSEGSRFFDA--------DEIDSVGTRWAIL  52

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA NEENPR+GVIIN+PHGE
Sbjct  53   LAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNEENPRQGVIINSPHGE  112

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY+GVPKDYTGDDVTVDN LA +LG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG GVL
Sbjct  113  DVYNGVPKDYTGDDVTVDNFLAALLGNKTALTGGSGKVVDSGPNDHIFIFYSDHGGAGVL  172

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT+PYLYA+DL  ALK KHA+GT
Sbjct  173  GMPTNPYLYANDLIDALKMKHASGT  197



>ref|XP_009762556.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
 dbj|BAC54827.1| vacuolar processing enzyme-1a [Nicotiana tabacum]
Length=490

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSI-VAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            MIR +A +L ++  ++ VAV++ R+ LKLPSE  RFF   +    +   DDSVGTRWA+L
Sbjct  1    MIRHIAGTLFIIGLALNVAVSESRNVLKLPSEVSRFFGADKSNVGDDHDDDSVGTRWAIL  60

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA NEENPR GVIIN+PHGE
Sbjct  61   LAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNEENPRPGVIINSPHGE  120

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDVTV+N  A +LG+K+A+ GGSGKVV+SGPNDHI ++YSDHGGPGVL
Sbjct  121  DVYKGVPKDYTGDDVTVNNFFAALLGNKTALSGGSGKVVNSGPNDHILIFYSDHGGPGVL  180

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT PYLYA+DL   LKKKHA+GT
Sbjct  181  GMPTDPYLYANDLIDVLKKKHASGT  205



>emb|CDP08231.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 172/205 (84%), Gaps = 4/205 (2%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRD-FLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M+R   A+LLLL  SI+AVA+ RD FLKLPSE   FF P E  +    G DSVGTRWAVL
Sbjct  1    MMRYATAALLLLALSIIAVAEARDNFLKLPSEIADFFHPKERSDA---GGDSVGTRWAVL  57

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            IAGSNGYWNYRHQAD+CHAYQILK GGLKDENIVVFMYDDIAYNEENPR GVIIN+PHG 
Sbjct  58   IAGSNGYWNYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAYNEENPRPGVIINSPHGA  117

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDV   N LA ILGDK+A+ GGSGKVVDSGPNDHIF+YY+DHGGPGVL
Sbjct  118  DVYQGVPKDYTGDDVNAKNFLAAILGDKTAITGGSGKVVDSGPNDHIFIYYTDHGGPGVL  177

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            G P+ PYLYADDLN  LKKKHA+GT
Sbjct  178  GTPSGPYLYADDLNEVLKKKHASGT  202



>ref|NP_001275272.1| vacoular processing enzyme 2 precursor [Solanum tuberosum]
 gb|ACC68681.1| vacoular processing enzyme 2 [Solanum tuberosum]
Length=461

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 9/205 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSI-VAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M RS+A  L L+  S+ V+V++ R+FLKLPSE  RFF          D  DSVGTRWA+L
Sbjct  1    MNRSIAGVLFLIALSLNVSVSESRNFLKLPSEGSRFFDA--------DESDSVGTRWAIL  52

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA NEENPR+GVIIN+PHGE
Sbjct  53   LAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNEENPRQGVIINSPHGE  112

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDVTV+N LA +LG+K+A+ GGSGKVVDSGPNDHIF++ SDHGG GV+
Sbjct  113  DVYKGVPKDYTGDDVTVNNFLAALLGNKTALTGGSGKVVDSGPNDHIFIFCSDHGGAGVI  172

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT PYLYA+DL  ALKKKHA+GT
Sbjct  173  GMPTDPYLYANDLIDALKKKHASGT  197



>ref|XP_004253098.1| PREDICTED: vacuolar-processing enzyme [Solanum lycopersicum]
Length=480

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 170/200 (85%), Gaps = 9/200 (5%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSN  265
            VA   +L+  +++A  +GR+ LKLPSEA RFF          D DDSVGTRWAVL+AGSN
Sbjct  4    VAGVFILVGIAVLAAVEGRNVLKLPSEASRFFD---------DADDSVGTRWAVLLAGSN  54

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GYWNYRHQAD+CHAYQ+L+ GGLKDENI+VFMYDDIA++EENPR GVIIN+P GEDVY G
Sbjct  55   GYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAHHEENPRPGVIINSPAGEDVYEG  114

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTS  625
            VPKDYTGDDV V N LAV+LG+K+A+ GGSGKVV+SGPNDHIF++YSDHGGPGVLGMPT+
Sbjct  115  VPKDYTGDDVNVHNFLAVLLGNKTALTGGSGKVVNSGPNDHIFIFYSDHGGPGVLGMPTN  174

Query  626  PYLYADDLNAALKKKHAAGT  685
            PYLYADDL A LKKKHAAGT
Sbjct  175  PYLYADDLIAVLKKKHAAGT  194



>gb|KDO80012.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=300

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +  L+ L  ++  +ADG      D LKLPSEA RFF       +  D DDSVGTR
Sbjct  1    MTRLASGVLITLLVALAGIADGSRDIAGDILKLPSEAYRFFHNGGGGAKVNDDDDSVGTR  60

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVL+AGSNG+WNYRHQADICHAYQ+L+ GGLKDENI+VFMYDDIA+NEENPR GVIIN+
Sbjct  61   WAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRPGVIINH  120

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTG+DVTV+N  AVILG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG
Sbjct  121  PHGDDVYKGVPKDYTGEDVTVENFFAVILGNKTALTGGSGKVVDSGPNDHIFIFYSDHGG  180

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAG  682
            PGVLGMPTS Y+YAD+L   LKKKHA+G
Sbjct  181  PGVLGMPTSRYIYADELIDVLKKKHASG  208



>gb|KDO80013.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
 gb|KDO80014.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=300

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +  L+ L  ++  +ADG      D LKLPSEA RFF       +  D DDSVGTR
Sbjct  1    MTRLASGVLITLLVALAGIADGSRDIAGDILKLPSEAYRFFHNGGGGAKVNDDDDSVGTR  60

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVL+AGSNG+WNYRHQADICHAYQ+L+ GGLKDENI+VFMYDDIA+NEENPR GVIIN+
Sbjct  61   WAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRPGVIINH  120

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTG+DVTV+N  AVILG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG
Sbjct  121  PHGDDVYKGVPKDYTGEDVTVENFFAVILGNKTALTGGSGKVVDSGPNDHIFIFYSDHGG  180

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAG  682
            PGVLGMPTS Y+YAD+L   LKKKHA+G
Sbjct  181  PGVLGMPTSRYIYADELIDVLKKKHASG  208



>gb|ACR24644.1| vacuolar processing enzyme [Malus hupehensis var. mengshanensis]
Length=494

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S++A A G      D L+LPSEA RFF   ++   + D D +VGTR
Sbjct  1    MTRLASAVVLLFLASVLASAAGSRDLIGDVLRLPSEASRFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  120  PHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PG+LGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGILGMPTSPYIYANDLIEVLKKKHAAGT  208



>gb|AGC94758.1| vacuolar processing enzyme [Malus hupehensis]
Length=494

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S++A A G      D L+LPSEA RFF   ++   + D D +VGTR
Sbjct  1    MTRLASAVVLLFLASVLASAAGSRDLIGDVLRLPSEASRFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  120  PHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PG+LGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGILGMPTSPYIYANDLIEVLKKKHAAGT  208



>emb|CAH56498.1| cysteine protease [Solanum lycopersicum]
Length=480

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 169/200 (85%), Gaps = 9/200 (5%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSN  265
            VA   +L+  +++A  +GR+ LKLPSEA RFF          D DDSVGTRWAVL+AGSN
Sbjct  4    VAGVFILVGIAVLAAVEGRNVLKLPSEASRFFD---------DADDSVGTRWAVLLAGSN  54

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GYWNYRHQAD+CHAYQ+L+ GGLKDENI+VFMYDDIA++EENPR GVIIN+P GEDVY G
Sbjct  55   GYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAHHEENPRPGVIINSPAGEDVYEG  114

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTS  625
            VPKDYTGDDV V N LAV+LG+K+A+ GGSGKVV+SGPNDHIF++YSDHGGPGVLGMPT+
Sbjct  115  VPKDYTGDDVNVHNFLAVLLGNKTALTGGSGKVVNSGPNDHIFIFYSDHGGPGVLGMPTN  174

Query  626  PYLYADDLNAALKKKHAAGT  685
            PYLYADDL A LKKKHA GT
Sbjct  175  PYLYADDLIAVLKKKHAPGT  194



>gb|AGC94757.1| vacuolar processing enzyme [Malus sikkimensis]
Length=494

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S++A A G      D L+LPSEA +FF   ++   + D D +VGTR
Sbjct  1    MTRLASAVVLLFFASVLASAAGSRDLIGDILRLPSEASKFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  120  PHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PG+LGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGILGMPTSPYIYANDLIEVLKKKHAAGT  208



>gb|AGC94759.1| vacuolar processing enzyme [Malus micromalus]
Length=494

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S++A A G      D L+LPSEA +FF   ++   + D D +VGTR
Sbjct  1    MTRLASAVVLLFFASVLASAAGSRDLIGDVLRLPSEASKFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  120  PHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PG+LGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGILGMPTSPYIYANDLIEVLKKKHAAGT  208



>ref|XP_008393660.1| PREDICTED: vacuolar-processing enzyme [Malus domestica]
 ref|XP_008360960.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=494

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S++A A G      D L+LPSEA +FF   ++   + D D +VGTR
Sbjct  1    MTRLASAVVLLFFASVLASAAGSRDLIGDVLRLPSEASKFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  120  PHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PG+LGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGILGMPTSPYIYANDLIEVLKKKHAAGT  208



>gb|AGC94756.1| vacuolar processing enzyme [Malus sieversii]
Length=494

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S++A A G      D L+LPSEA +FF   ++   + D D +VGTR
Sbjct  1    MTRLASAVVLLFFASVLASAAGSRDLIGDVLRLPSEASKFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  120  PHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PG+LGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGILGMPTSPYIYANDLIEVLKKKHAAGT  208



>ref|XP_009361606.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=494

 Score =   264 bits (675),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 171/209 (82%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R   A +LL   S++A A G      D L+LPSEA RFF   ++   + D D +VGTR
Sbjct  1    MTRFAGAVVLLFLASVLASAAGSRDLIGDVLRLPSEASRFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIINN
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINN  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            P G DVY GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  120  PQGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PGVLGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGVLGMPTSPYIYANDLIEVLKKKHAAGT  208



>ref|XP_007222246.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
 gb|EMJ23445.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
Length=494

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 172/209 (82%), Gaps = 6/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S+ + A G      D L+LPSEA RFF   ++   E D D +VGTR
Sbjct  1    MTRLASAVVLLFLVSLSSFAAGSRDLIGDVLRLPSEASRFFGRGDDGPDEQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRPGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTGDDVTV+N  A ILG+K+A+ GG+GKVVDSGPNDHIF+YYSDHGG
Sbjct  120  PHGDDVYKGVPKDYTGDDVTVNNFFAAILGNKTALTGGTGKVVDSGPNDHIFIYYSDHGG  179

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PGVLGMPTSPY+YA+DL   LKKKHAAGT
Sbjct  180  PGVLGMPTSPYIYANDLIEVLKKKHAAGT  208



>gb|KDO80010.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
 gb|KDO80011.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=372

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +  L+ L  ++  +ADG      D LKLPSEA RFF       +  D DDSVGTR
Sbjct  1    MTRLASGVLITLLVALAGIADGSRDIAGDILKLPSEAYRFFHNGGGGAKVNDDDDSVGTR  60

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVL+AGSNG+WNYRHQADICHAYQ+L+ GGLKDENI+VFMYDDIA+NEENPR GVIIN+
Sbjct  61   WAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRPGVIINH  120

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTG+DVTV+N  AVILG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG
Sbjct  121  PHGDDVYKGVPKDYTGEDVTVENFFAVILGNKTALTGGSGKVVDSGPNDHIFIFYSDHGG  180

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAG  682
            PGVLGMPTS Y+YAD+L   LKKKHA+G
Sbjct  181  PGVLGMPTSRYIYADELIDVLKKKHASG  208



>ref|XP_011096125.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=491

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = +2

Query  128  VADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHA  307
            VADGRDF+KLPS+ARRFF   EE+N   D DDSVGTRWA+LIAGSNGYWNYRHQAD+CHA
Sbjct  20   VADGRDFIKLPSDARRFFGGPEEDNGGDD-DDSVGTRWAILIAGSNGYWNYRHQADVCHA  78

Query  308  YQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDN  487
            YQILK GGLKDENIVVFMYDDIAYNEENPR GVIINNPHGEDVY GVPKDY GDDVTV+N
Sbjct  79   YQILKRGGLKDENIVVFMYDDIAYNEENPRPGVIINNPHGEDVYKGVPKDYVGDDVTVNN  138

Query  488  LLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKK  667
              AV+LG+K+AV+GGSGKVVDSGP+DHIF+YY+DHGGPGVLGMPTSPY+YADDL   LKK
Sbjct  139  FFAVLLGNKTAVRGGSGKVVDSGPSDHIFIYYTDHGGPGVLGMPTSPYIYADDLINVLKK  198

Query  668  KHAAGT  685
            KHA+GT
Sbjct  199  KHASGT  204



>gb|KDO80009.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=445

 Score =   260 bits (665),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +  L+ L  ++  +ADG      D LKLPSEA RFF       +  D DDSVGTR
Sbjct  1    MTRLASGVLITLLVALAGIADGSRDIAGDILKLPSEAYRFFHNGGGGAKVNDDDDSVGTR  60

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVL+AGSNG+WNYRHQADICHAYQ+L+ GGLKDENI+VFMYDDIA+NEENPR GVIIN+
Sbjct  61   WAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRPGVIINH  120

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTG+DVTV+N  AVILG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG
Sbjct  121  PHGDDVYKGVPKDYTGEDVTVENFFAVILGNKTALTGGSGKVVDSGPNDHIFIFYSDHGG  180

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAG  682
            PGVLGMPTS Y+YAD+L   LKKKHA+G
Sbjct  181  PGVLGMPTSRYIYADELIDVLKKKHASG  208



>ref|XP_006342509.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=480

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 168/200 (84%), Gaps = 9/200 (5%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSN  265
            VA   +L+  +++A  +GR+ LKLPSEA RFF            DDSVGTRWAVL+AGSN
Sbjct  4    VAGVFILVGVAVLAAVEGRNVLKLPSEASRFFDV---------ADDSVGTRWAVLLAGSN  54

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GYWNYRHQAD+CHAYQ+L+ GGLKDENI+VFMYDDIA++EENPR GVIIN+P GEDVY G
Sbjct  55   GYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAHHEENPRPGVIINSPAGEDVYEG  114

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTS  625
            VPKDYTGDDV V N L V+LG+K+A+ GGSGKVV+SGPNDHIF++YSDHGGPGVLGMPT+
Sbjct  115  VPKDYTGDDVNVHNFLTVLLGNKTALTGGSGKVVNSGPNDHIFIFYSDHGGPGVLGMPTN  174

Query  626  PYLYADDLNAALKKKHAAGT  685
            PYLYA+DL A LKKKHAAGT
Sbjct  175  PYLYANDLIAVLKKKHAAGT  194



>ref|XP_006450795.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|ESR64035.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|KDO80005.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=494

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +  L+ L  ++  +ADG      D LKLPSEA RFF       +  D DDSVGTR
Sbjct  1    MTRLASGVLITLLVALAGIADGSRDIAGDILKLPSEAYRFFHNGGGGAKVNDDDDSVGTR  60

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVL+AGSNG+WNYRHQADICHAYQ+L+ GGLKDENI+VFMYDDIA+NEENPR GVIIN+
Sbjct  61   WAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRPGVIINH  120

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTG+DVTV+N  AVILG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG
Sbjct  121  PHGDDVYKGVPKDYTGEDVTVENFFAVILGNKTALTGGSGKVVDSGPNDHIFIFYSDHGG  180

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAG  682
            PGVLGMPTS Y+YAD+L   LKKKHA+G
Sbjct  181  PGVLGMPTSRYIYADELIDVLKKKHASG  208



>gb|EYU20379.1| hypothetical protein MIMGU_mgv1a005412mg [Erythranthe guttata]
Length=484

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 167/208 (80%), Gaps = 12/208 (6%)
 Frame = +2

Query  65   VLTMIRSVAASLLLLTFSIVAVADGR-DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            ++ MIR VA +L L   SI+ VADGR DF+KLPS+                 DDSVGTRW
Sbjct  2    MVMMIRYVAGALFLTALSILTVADGRHDFIKLPSDGTAGAD-----------DDSVGTRW  50

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVL+AGS+GYWNYRHQADICHAYQIL+ GGLKDENI+VFMYDDIAYN ENPR GV+IN+P
Sbjct  51   AVLLAGSSGYWNYRHQADICHAYQILRKGGLKDENIIVFMYDDIAYNIENPRPGVLINSP  110

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            HGEDVY GVPKDY G+DVT +N  A +LG+K+A+ GGSGKVVDSGPNDHIFV+YSDHGGP
Sbjct  111  HGEDVYKGVPKDYIGNDVTPNNFYAALLGNKTALTGGSGKVVDSGPNDHIFVFYSDHGGP  170

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPTS Y+YA+DL   L KKHA+GT
Sbjct  171  GVLGMPTSHYIYANDLIEVLIKKHASGT  198



>emb|CDX68923.1| BnaC01g05300D [Brassica napus]
Length=487

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 10/202 (5%)
 Frame = +2

Query  95   SLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAG  259
            ++ +L  S++AV+  R     D +KLPS+A RFFRP  +     D   S GTRWAVL+AG
Sbjct  5    AVAVLVLSLIAVSAARQNPDDDVIKLPSQASRFFRPNND-----DESSSSGTRWAVLVAG  59

Query  260  SNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVY  439
            S+GYWNYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIA NEENPRKG+IIN+PHG DVY
Sbjct  60   SSGYWNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIADNEENPRKGIIINSPHGSDVY  119

Query  440  HGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMP  619
             GVPKDYTGDDVTVDNL AVILGDK+AVKGGSGKVVDSGPNDHIF++YSDHGGPGVLGMP
Sbjct  120  EGVPKDYTGDDVTVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMP  179

Query  620  TSPYLYADDLNAALKKKHAAGT  685
            TSPYLYADDLN  LKKKHA+GT
Sbjct  180  TSPYLYADDLNDVLKKKHASGT  201



>ref|XP_002276759.2| PREDICTED: vacuolar-processing enzyme [Vitis vinifera]
Length=526

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 175/215 (81%), Gaps = 9/215 (4%)
 Frame = +2

Query  56   ISTVLTMIRSVAASLLLLTFSIVAVADGRDF-----LKLPSearrffrpaeeenreaDGD  220
            +S  +T+  +  A+ L L+     VA GR F     L LPSEA RFFRP    + +  G 
Sbjct  30   LSAPMTIFPAAVAAFLALS---TLVAGGRHFAGDNGLLLPSEASRFFRPGGAADDDT-GA  85

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            +S GTRWAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENI+VFMYDDI++NEENPR 
Sbjct  86   ESAGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIIVFMYDDISFNEENPRP  145

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            G+IIN+PHGEDVY GVPKDYTG+DVTVDN  AVILG+K+A+ GGSGKV+DSGPNDHIF+Y
Sbjct  146  GIIINSPHGEDVYEGVPKDYTGEDVTVDNFFAVILGNKTALSGGSGKVLDSGPNDHIFIY  205

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YSDHGGPGVLGMPTSPYLYA+DL   LKKKHA+GT
Sbjct  206  YSDHGGPGVLGMPTSPYLYANDLIEVLKKKHASGT  240



>ref|XP_009607675.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
Length=484

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 170/204 (83%), Gaps = 7/204 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            ++R V +++L++  S+VA  DGRD LKLPSEA  FF    +       DDS+GT+WAVL+
Sbjct  2    IVRYVVSAILIIGLSVVAAVDGRDVLKLPSEASTFFSGNYD-------DDSIGTKWAVLV  54

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS GYWNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA+N ENPR GVIIN+P+G+D
Sbjct  55   AGSRGYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAHNFENPRPGVIINSPNGDD  114

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG  VT +N LAVILG+K+A+ GGSGKVV+SGPNDHIF++YSDHGGPGVLG
Sbjct  115  VYKGVPKDYTGHHVTANNFLAVILGNKAALSGGSGKVVESGPNDHIFIFYSDHGGPGVLG  174

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MP+ PYLYADDL   LK+KHA+GT
Sbjct  175  MPSGPYLYADDLIDVLKRKHASGT  198



>dbj|BAC54829.1| vacuolar processing enzyme-2 [Nicotiana tabacum]
Length=484

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 170/204 (83%), Gaps = 7/204 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            ++R V +++L++  S+VA  DGRD LKLPSEA  FF    +       DDS+GT+WAVL+
Sbjct  2    IVRYVVSAILIIGLSVVAAVDGRDVLKLPSEASTFFSGNYD-------DDSIGTKWAVLV  54

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS GYWNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA+N ENPR GVIIN+P+G+D
Sbjct  55   AGSRGYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAHNFENPRPGVIINSPNGDD  114

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG  VT +N LAVILG+K+A+ GGSGKVV+SGPNDHIF++YSDHGGPGVLG
Sbjct  115  VYKGVPKDYTGHHVTANNFLAVILGNKAALSGGSGKVVESGPNDHIFIFYSDHGGPGVLG  174

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MP+ PYLYADDL   LK+KHA+GT
Sbjct  175  MPSGPYLYADDLIDVLKRKHASGT  198



>ref|XP_009337146.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=495

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   SI+A A G      D L+LPSEA RFF   ++   + D D +VGTR
Sbjct  1    MTRLASALVLLFLASILASAAGSRDLNGDVLRLPSEASRFFGRGDDAPDQQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG DVTV+N  A ILGDKSA+ GGSGKVVDSGPNDHIF+YYSDHGG
Sbjct  120  PHGSDVYKGVPKDYTGQDVTVNNFFAAILGDKSALTGGSGKVVDSGPNDHIFIYYSDHGG  179

Query  599  PGVLGMP-TSPYLYADDLNAALKKKHAAGT  685
            PGVLGMP  SPY+YA+DL   LKKKHAAGT
Sbjct  180  PGVLGMPGISPYIYANDLIEVLKKKHAAGT  209



>ref|NP_001275777.1| vacuolar-processing enzyme precursor [Citrus sinensis]
 sp|P49043.1|VPE_CITSI RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Citrus sinensis]
 emb|CAA87720.1| cystein proteinase (by similarity) [Citrus sinensis]
 prf||2208463A vascular processing protease
Length=494

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +  L+ L  ++  +ADG      D LKLPSEA RFF       +  D DDSVGTR
Sbjct  1    MTRLASGVLITLLVALAGIADGSRDIAGDILKLPSEAYRFFHNGGGGAKVNDDDDSVGTR  60

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVL+AGSNG+WNYRHQADICHAYQ+L+ GGLKDENI+VFMYDDIA+NEENPR GVIIN+
Sbjct  61   WAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRPGVIINH  120

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTG+DVTV+   AV+LG+K+A+ GGSGKVVDSGPNDHIF++YSDHGG
Sbjct  121  PHGDDVYKGVPKDYTGEDVTVEKFFAVVLGNKTALTGGSGKVVDSGPNDHIFIFYSDHGG  180

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAG  682
            PGVLGMPTS Y+YAD+L   LKKKHA+G
Sbjct  181  PGVLGMPTSRYIYADELIDVLKKKHASG  208



>ref|XP_007012236.1| Gamma vacuolar processing enzyme [Theobroma cacao]
 gb|EOY29855.1| Gamma vacuolar processing enzyme [Theobroma cacao]
Length=487

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 171/208 (82%), Gaps = 11/208 (5%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDF----LKLPSearrffrpaeeenreaDGDDSVGTRW  241
            M R V+  +LLL      V+ GRD     L+LPSEA +FFR +       + D+  GTRW
Sbjct  1    MTRLVSGVILLLLSLTGIVSAGRDITGDVLRLPSEASKFFRGS-------NDDEVEGTRW  53

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGSNGYWNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA+NEENPR G+IIN+P
Sbjct  54   AVLIAGSNGYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAFNEENPRPGIIINSP  113

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            HG+DVY GVPKDYTG+DVTV+NLLA ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGGP
Sbjct  114  HGDDVYEGVPKDYTGEDVTVNNLLAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGGP  173

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT PYLYADDL   LKKKHA+GT
Sbjct  174  GVLGMPTFPYLYADDLIEVLKKKHASGT  201



>emb|CBI20614.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 173/211 (82%), Gaps = 9/211 (4%)
 Frame = +2

Query  68   LTMIRSVAASLLLLTFSIVAVADGRDF-----LKLPSearrffrpaeeenreaDGDDSVG  232
            +T+  +  A+ L L+     VA GR F     L LPSEA RFFRP    + +  G +S G
Sbjct  1    MTIFPAAVAAFLALS---TLVAGGRHFAGDNGLLLPSEASRFFRPGGAADDDT-GAESAG  56

Query  233  TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVII  412
            TRWAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENI+VFMYDDI++NEENPR G+II
Sbjct  57   TRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIIVFMYDDISFNEENPRPGIII  116

Query  413  NNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDH  592
            N+PHGEDVY GVPKDYTG+DVTVDN  AVILG+K+A+ GGSGKV+DSGPNDHIF+YYSDH
Sbjct  117  NSPHGEDVYEGVPKDYTGEDVTVDNFFAVILGNKTALSGGSGKVLDSGPNDHIFIYYSDH  176

Query  593  GGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GGPGVLGMPTSPYLYA+DL   LKKKHA+GT
Sbjct  177  GGPGVLGMPTSPYLYANDLIEVLKKKHASGT  207



>ref|XP_006412409.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
 gb|ESQ53862.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
Length=488

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 5/181 (3%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            D +KLPS+A  FFRPA++     D D S GTRWAVL+AGSNGYWNYRHQADICHAYQ+L+
Sbjct  27   DIIKLPSQASMFFRPADD-----DNDSSAGTRWAVLVAGSNGYWNYRHQADICHAYQLLR  81

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GG+K++NIVVFMYDDIA NEENPR+G+IIN+PHG+DVY GVPKDYTGDDVTVDNL AVI
Sbjct  82   KGGVKEDNIVVFMYDDIANNEENPRRGIIINSPHGKDVYQGVPKDYTGDDVTVDNLFAVI  141

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LG+K+A KGGSGKVVDSGPNDHIF++YSDHGGPGVLGMPTSPYLYA+DLN  LKKKHA+G
Sbjct  142  LGNKTATKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASG  201

Query  683  T  685
            T
Sbjct  202  T  202



>dbj|BAJ33795.1| unnamed protein product [Thellungiella halophila]
Length=478

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 5/181 (3%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            D +KLPS+A  FFRPA++     D D S GTRWAVL+AGSNGYWNYRHQADICHAYQ+L+
Sbjct  27   DIIKLPSQASMFFRPADD-----DNDSSAGTRWAVLVAGSNGYWNYRHQADICHAYQLLR  81

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GG+K++NIVVFMYDDIA NEENPR+G+IIN+PHG+DVY GVPKDYTGDDVTVDNL AVI
Sbjct  82   KGGVKEDNIVVFMYDDIANNEENPRRGIIINSPHGKDVYQGVPKDYTGDDVTVDNLFAVI  141

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LG+K+A KGGSGKVVDSGPNDHIF++YSDHGGPGVLGMPTSPYLYA+DLN  LKKKHA+G
Sbjct  142  LGNKTATKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASG  201

Query  683  T  685
            T
Sbjct  202  T  202



>ref|XP_010526156.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=496

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 170/200 (85%), Gaps = 5/200 (3%)
 Frame = +2

Query  98   LLLLTFSIVAVADGRDF----LKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSN  265
            +L+L+ ++ AV+  RD     +KLPSE+  FFRP    +   DG  +VGTRWAVL+AGSN
Sbjct  12   VLILSVAVSAVSGRRDLPGDVIKLPSESSSFFRPTRTADSGDDGS-TVGTRWAVLVAGSN  70

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GYWNYRHQAD+CHAYQ+LK GGLK+ENIVVFMYDDIA NEENPR G+IIN+PHGEDVY G
Sbjct  71   GYWNYRHQADVCHAYQLLKKGGLKEENIVVFMYDDIANNEENPRPGIIINSPHGEDVYEG  130

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTS  625
            VPKDYTGD+V VDNL AVILG+K+A+KGGSGKVVDSGPNDHIF+YY+DHGGPGVLGMPTS
Sbjct  131  VPKDYTGDEVNVDNLFAVILGNKTALKGGSGKVVDSGPNDHIFIYYTDHGGPGVLGMPTS  190

Query  626  PYLYADDLNAALKKKHAAGT  685
            PYLYA DL   LKKKHA+GT
Sbjct  191  PYLYAKDLIDTLKKKHASGT  210



>emb|CDX75302.1| BnaA01g04000D [Brassica napus]
Length=487

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 12/205 (6%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            VA ++L L  S++A++  R     D +KLPS+A RFF P  +     D   S GTRWAVL
Sbjct  4    VAVAVLFL--SLIALSAARQNPDDDVIKLPSQASRFFLPNND-----DDSSSSGTRWAVL  56

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGS+GYWNYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIA NEENPRKG+IIN+PHG 
Sbjct  57   VAGSSGYWNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIADNEENPRKGIIINSPHGS  116

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDVTV+NL AVILGDK AVKGGSGKVVDSGPNDHIF++YSDHGGPGVL
Sbjct  117  DVYEGVPKDYTGDDVTVENLFAVILGDKGAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVL  176

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPTSPYLYADDLN  LKKKHA+GT
Sbjct  177  GMPTSPYLYADDLNDVLKKKHASGT  201



>ref|XP_004501477.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=488

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 170/206 (83%), Gaps = 6/206 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAV--ADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAV  247
            M R    +LL L  +++A+  ++  DFL+LPSE+ RFF     +    D +++ GTRWA+
Sbjct  1    MYRFPTPTLLFLIVTLIALVSSNPEDFLRLPSESSRFFHSPSAD----DKENNEGTRWAI  56

Query  248  LIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHG  427
            LIAGSNGYWNYRHQ+D+CHAYQ+L+ GGLK+ENIVVFMYDDIA+NEENPR GVIIN+PHG
Sbjct  57   LIAGSNGYWNYRHQSDVCHAYQVLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHG  116

Query  428  EDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGV  607
            +DVY GVPKDYTG+DV VDN  A +LG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGGPGV
Sbjct  117  DDVYKGVPKDYTGEDVNVDNFFAALLGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGV  176

Query  608  LGMPTSPYLYADDLNAALKKKHAAGT  685
            LGMPTSPY+YA DL   LKKKHA+GT
Sbjct  177  LGMPTSPYMYASDLIEVLKKKHASGT  202



>gb|KJB06488.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=292

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 168/204 (82%), Gaps = 12/204 (6%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            V A LLLL+ + + V+ GRD     L+LPSEA +FF          D D+  GTRWAVLI
Sbjct  6    VGAILLLLSLTGI-VSAGRDVTGDILRLPSEANKFFHGG-------DDDEVEGTRWAVLI  57

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYNEENPR G+IINNPHG+D
Sbjct  58   AGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNEENPRPGIIINNPHGDD  117

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG++VTV+N  A ILG+KSA+ GGSGKVV+SGPNDHIF+YYSDHGGPGVLG
Sbjct  118  VYKGVPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPNDHIFIYYSDHGGPGVLG  177

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT PYLYADDL   LKKKHA+GT
Sbjct  178  MPTLPYLYADDLIDVLKKKHASGT  201



>emb|CAN70603.1| hypothetical protein VITISV_040193 [Vitis vinifera]
Length=493

 Score =   256 bits (655),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  215  GDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENP  394
            G +S GTRWAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENI+VFMYDDI++NEENP
Sbjct  51   GGESAGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIIVFMYDDISFNEENP  110

Query  395  RKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIF  574
            R G+IIN+PHGEDVY GVPKDYTG+DVTVDN  AVILG+K+A+ GGSGKV+DSGPNDHIF
Sbjct  111  RPGIIINSPHGEDVYEGVPKDYTGEDVTVDNFFAVILGNKTALSGGSGKVLDSGPNDHIF  170

Query  575  VYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YYSDHGGPGVLGMPTSPYLYA+DL   LKKKHA+GT
Sbjct  171  IYYSDHGGPGVLGMPTSPYLYANDLIEVLKKKHASGT  207



>gb|KFK29905.1| hypothetical protein AALP_AA7G193600 [Arabis alpina]
Length=488

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 175/207 (85%), Gaps = 9/207 (4%)
 Frame = +2

Query  77   IRSVAASLLLLTFSIVAVADGR----DFLKLPSearrffrpaeeenreaDGDDSVGTRWA  244
            ++   + +L+L  S++ V+  R    D +KLPSEA RFFRP        D D + GTRWA
Sbjct  1    MKPFFSGVLVLFLSLITVSAVRKSPDDIIKLPSEASRFFRPDVN-----DDDSNSGTRWA  55

Query  245  VLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPH  424
            VL+AGS+GYWNYRHQADICHAYQ+L+ GGLK+ENIVVFMYDDIA NEENPRKG+IIN+PH
Sbjct  56   VLVAGSSGYWNYRHQADICHAYQLLRKGGLKEENIVVFMYDDIADNEENPRKGIIINSPH  115

Query  425  GEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPG  604
            G+DVY GVPKDYTGDDV+V+NL AV+LGDK+AVKGGSGKVVDSGPNDHIF++YSDHGGPG
Sbjct  116  GKDVYQGVPKDYTGDDVSVENLFAVLLGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGPG  175

Query  605  VLGMPTSPYLYADDLNAALKKKHAAGT  685
            VLGMPTSPYLYA+DLN  LKKKHA+GT
Sbjct  176  VLGMPTSPYLYANDLNDVLKKKHASGT  202



>ref|XP_002880728.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56987.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 173/203 (85%), Gaps = 9/203 (4%)
 Frame = +2

Query  77   IRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIA  256
            + +VA + L L   +VA   G D +KLPS+A +FF P E      + DDS  TRWAVL+A
Sbjct  1    MTTVAVTFLALFLYLVAAVSG-DVIKLPSQASKFFHPTE------NDDDS--TRWAVLVA  51

Query  257  GSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDV  436
            GS+GYWNYRHQAD+CHAYQ+LK GG+K+ENIVVFMYDDIA NEENPR GVIIN+P+GEDV
Sbjct  52   GSSGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIAKNEENPRPGVIINSPNGEDV  111

Query  437  YHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGM  616
            Y+GVPKDYTGDDV VDNLLAVILG+K+AVKGGSGKVVDSGPNDHIF+YYSDHGGPGVLGM
Sbjct  112  YNGVPKDYTGDDVNVDNLLAVILGNKTAVKGGSGKVVDSGPNDHIFIYYSDHGGPGVLGM  171

Query  617  PTSPYLYADDLNAALKKKHAAGT  685
            PTSPYLYA+DLN  LKKKHA+GT
Sbjct  172  PTSPYLYANDLNDVLKKKHASGT  194



>gb|ACB30368.1| vascular processing enzyme-3 [Capsicum annuum]
Length=484

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 167/206 (81%), Gaps = 11/206 (5%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSI---VAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWA  244
            M   VA  L ++  S+   V   DGR+ LKLP+EA RFF  A+        DDSVGTRWA
Sbjct  1    MNYQVAGILFIVGLSVAIAVTAVDGRNVLKLPTEASRFFDHAD--------DDSVGTRWA  52

Query  245  VLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPH  424
            VL+AGSNGYWNYRHQAD+CHAYQ+L+ GGLKDENI+VFMYDDIAYNEENPR GVIINNP 
Sbjct  53   VLLAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAYNEENPRPGVIINNPA  112

Query  425  GEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPG  604
             EDVY GVPKDYT D+V V N LAV+LG+K+A+ GGSGKVV+SGPNDHIF++YSDHGGPG
Sbjct  113  AEDVYEGVPKDYTRDEVNVHNFLAVLLGNKTALTGGSGKVVNSGPNDHIFIFYSDHGGPG  172

Query  605  VLGMPTSPYLYADDLNAALKKKHAAG  682
            VLGMPT+PYLYA DL  ALKKKHAAG
Sbjct  173  VLGMPTNPYLYASDLINALKKKHAAG  198



>ref|XP_009125229.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Brassica 
rapa]
Length=487

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 169/199 (85%), Gaps = 10/199 (5%)
 Frame = +2

Query  104  LLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNG  268
            ++  S++A++  R     D +KLPS+A RFFRP  +     D   S GTRWAVL+AGS+G
Sbjct  8    VIFLSLIALSAARQNPDDDVIKLPSQASRFFRPNND-----DDSSSSGTRWAVLVAGSSG  62

Query  269  YWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGV  448
            YWNYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIA NEENPRKG+IIN+PHG DVY GV
Sbjct  63   YWNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIADNEENPRKGIIINSPHGSDVYEGV  122

Query  449  PKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSP  628
            PKDYTGDDVTV+NL AVILGDK AVKGGSGKVVDSGPNDHIF++YSDHGGPGVLGMPTSP
Sbjct  123  PKDYTGDDVTVENLFAVILGDKGAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSP  182

Query  629  YLYADDLNAALKKKHAAGT  685
            YLYADDLN  LKKKHA+GT
Sbjct  183  YLYADDLNDVLKKKHASGT  201



>ref|XP_004291017.1| PREDICTED: vacuolar-processing enzyme [Fragaria vesca subsp. 
vesca]
Length=494

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            D +VGTRWAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR
Sbjct  52   DGTVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPR  111

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
            +GVIIN+PHG+DVY GVPKDYTG+DVTV N  A ILG+K+A+ GGSGKVVDSGPNDHIF+
Sbjct  112  QGVIINSPHGDDVYKGVPKDYTGEDVTVGNFFAAILGNKTAISGGSGKVVDSGPNDHIFI  171

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMPTSPY+YAD L   LKKKHAAGT
Sbjct  172  YYSDHGGPGVLGMPTSPYIYADRLIEVLKKKHAAGT  207



>ref|XP_010429611.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X2 [Camelina sativa]
Length=479

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 170/204 (83%), Gaps = 6/204 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            M R   + L+L   S+VA A   + ++LPS+A +FFRP  +E      +D   TRWAVL+
Sbjct  1    MTRVAVSFLVLFVISLVAAAASDNIIRLPSQASKFFRPPTQE------NDDGSTRWAVLV  54

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS+GYWNYRHQAD+CHAYQ+LK GG+K+ENIVVFMYDDIA +EENPR GVIIN+P+GED
Sbjct  55   AGSSGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIAKHEENPRPGVIINSPNGED  114

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY+GVPKDYTGD+V VDNL AVILG+K A+KGGSGKVV+SGPNDHIF+YYSDHGGPGVLG
Sbjct  115  VYNGVPKDYTGDEVNVDNLFAVILGNKKALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLG  174

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPTSPYLYA DLN  LKKKHA+GT
Sbjct  175  MPTSPYLYAKDLNDVLKKKHASGT  198



>ref|XP_010429610.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X1 [Camelina sativa]
Length=484

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 170/204 (83%), Gaps = 6/204 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            M R   + L+L   S+VA A   + ++LPS+A +FFRP  +E      +D   TRWAVL+
Sbjct  1    MTRVAVSFLVLFVISLVAAAASDNIIRLPSQASKFFRPPTQE------NDDGSTRWAVLV  54

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS+GYWNYRHQAD+CHAYQ+LK GG+K+ENIVVFMYDDIA +EENPR GVIIN+P+GED
Sbjct  55   AGSSGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIAKHEENPRPGVIINSPNGED  114

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY+GVPKDYTGD+V VDNL AVILG+K A+KGGSGKVV+SGPNDHIF+YYSDHGGPGVLG
Sbjct  115  VYNGVPKDYTGDEVNVDNLFAVILGNKKALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLG  174

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPTSPYLYA DLN  LKKKHA+GT
Sbjct  175  MPTSPYLYAKDLNDVLKKKHASGT  198



>gb|KJB06490.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=370

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 168/204 (82%), Gaps = 12/204 (6%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            V A LLLL+ + + V+ GRD     L+LPSEA +FF          D D+  GTRWAVLI
Sbjct  6    VGAILLLLSLTGI-VSAGRDVTGDILRLPSEANKFFHGG-------DDDEVEGTRWAVLI  57

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYNEENPR G+IINNPHG+D
Sbjct  58   AGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNEENPRPGIIINNPHGDD  117

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG++VTV+N  A ILG+KSA+ GGSGKVV+SGPNDHIF+YYSDHGGPGVLG
Sbjct  118  VYKGVPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPNDHIFIYYSDHGGPGVLG  177

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT PYLYADDL   LKKKHA+GT
Sbjct  178  MPTLPYLYADDLIDVLKKKHASGT  201



>ref|XP_010244352.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=485

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 167/208 (80%), Gaps = 14/208 (7%)
 Frame = +2

Query  74   MIRSVAA-SLLLLTFSIVAVA---DGRDFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            M R      LLL+ F+IVA +   DG D L+LPSE  R            + DDS GTRW
Sbjct  1    MFRCTGGVCLLLVLFAIVAESRNLDG-DVLRLPSEFLRGGD---------NEDDSAGTRW  50

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGSNGYWNYRHQADICHAYQ+L+ GGLKDENI+VFMYDDIA+NEENPR G+IIN+P
Sbjct  51   AVLIAGSNGYWNYRHQADICHAYQLLRNGGLKDENIIVFMYDDIAFNEENPRPGIIINHP  110

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            HG+DVY GVPKDYTG+DV V N  AV+LG+++A+ GGSGKVVDSGPNDHIF+YYSDHGGP
Sbjct  111  HGDDVYEGVPKDYTGEDVNVGNFFAVLLGNRTALTGGSGKVVDSGPNDHIFIYYSDHGGP  170

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPTSPYLYADDL   LKKK+A+GT
Sbjct  171  GVLGMPTSPYLYADDLIDVLKKKYASGT  198



>ref|XP_002516472.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
 gb|EEF45813.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
Length=492

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 175/210 (83%), Gaps = 8/210 (4%)
 Frame = +2

Query  68   LTMIRSVAASLLLLTFSIVAVADGRDF----LKLPSearrffrpaeeenreaDGDDSVGT  235
            +T+  S    L+LLT   V V+  RD     ++LPSEA RFFRPA+ +N +   DDS GT
Sbjct  1    MTIRLSTGIILILLTLCGV-VSSSRDIVGDVIRLPSEASRFFRPADGKNGD---DDSAGT  56

Query  236  RWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIIN  415
            RWA+LIAGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYNEENPR+G+IIN
Sbjct  57   RWAILIAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAYNEENPRQGIIIN  116

Query  416  NPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHG  595
            NPHGEDVY GVPKDYTG++VTV N  A ILG+++A+ GG GKVVDSGPNDHIFVYY+DHG
Sbjct  117  NPHGEDVYKGVPKDYTGENVTVGNFFAAILGNRTALTGGRGKVVDSGPNDHIFVYYTDHG  176

Query  596  GPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GPGVLGMPT+PYLYA+DL   LKKKHA+GT
Sbjct  177  GPGVLGMPTNPYLYANDLIDVLKKKHASGT  206



>gb|KJB06489.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=488

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 168/204 (82%), Gaps = 12/204 (6%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            V A LLLL+ + + V+ GRD     L+LPSEA +FF          D D+  GTRWAVLI
Sbjct  6    VGAILLLLSLTGI-VSAGRDVTGDILRLPSEANKFFHGG-------DDDEVEGTRWAVLI  57

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYNEENPR G+IINNPHG+D
Sbjct  58   AGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNEENPRPGIIINNPHGDD  117

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG++VTV+N  A ILG+KSA+ GGSGKVV+SGPNDHIF+YYSDHGGPGVLG
Sbjct  118  VYKGVPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPNDHIFIYYSDHGGPGVLG  177

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT PYLYADDL   LKKKHA+GT
Sbjct  178  MPTLPYLYADDLIDVLKKKHASGT  201



>gb|KJB06487.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=487

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 168/204 (82%), Gaps = 12/204 (6%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            V A LLLL+ + + V+ GRD     L+LPSEA +FF          D D+  GTRWAVLI
Sbjct  6    VGAILLLLSLTGI-VSAGRDVTGDILRLPSEANKFFHGG-------DDDEVEGTRWAVLI  57

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYNEENPR G+IINNPHG+D
Sbjct  58   AGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNEENPRPGIIINNPHGDD  117

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG++VTV+N  A ILG+KSA+ GGSGKVV+SGPNDHIF+YYSDHGGPGVLG
Sbjct  118  VYKGVPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPNDHIFIYYSDHGGPGVLG  177

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT PYLYADDL   LKKKHA+GT
Sbjct  178  MPTLPYLYADDLIDVLKKKHASGT  201



>ref|XP_004159537.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
Length=493

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 166/201 (83%), Gaps = 8/201 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGS  262
            L LL  +++ +  G      DFL+LPSEA +FFR    +  +   +DSVGTRWAVLIAGS
Sbjct  10   LSLLFLAVIGLPAGARDLPGDFLRLPSEALKFFRGGASDASD---EDSVGTRWAVLIAGS  66

Query  263  NGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYH  442
            NGYWNYRHQADICHAYQ+L+  GLKDENI+VFMYDDIA+N ENPR GVIIN+P G DVYH
Sbjct  67   NGYWNYRHQADICHAYQLLRKNGLKDENIIVFMYDDIAFNPENPRPGVIINHPKGSDVYH  126

Query  443  GVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPT  622
            GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT
Sbjct  127  GVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPT  186

Query  623  SPYLYADDLNAALKKKHAAGT  685
             PY+YADDLN  LKKKHAAG+
Sbjct  187  YPYMYADDLNKVLKKKHAAGS  207



>ref|XP_004142919.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 gb|KGN62401.1| Vacuolar processing enzyme [Cucumis sativus]
Length=493

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 166/201 (83%), Gaps = 8/201 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGS  262
            L LL  +++ +  G      DFL+LPSEA +FFR    +  +   +DSVGTRWAVLIAGS
Sbjct  10   LSLLFLAVIGLPAGARDLPGDFLRLPSEALKFFRGGASDASD---EDSVGTRWAVLIAGS  66

Query  263  NGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYH  442
            NGYWNYRHQADICHAYQ+L+  GLKDENI+VFMYDDIA+N ENPR GVIIN+P G DVYH
Sbjct  67   NGYWNYRHQADICHAYQLLRKNGLKDENIIVFMYDDIAFNPENPRPGVIINHPKGSDVYH  126

Query  443  GVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPT  622
            GVPKDYTG+DVTV+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT
Sbjct  127  GVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPT  186

Query  623  SPYLYADDLNAALKKKHAAGT  685
             PY+YADDLN  LKKKHAAG+
Sbjct  187  YPYMYADDLNKVLKKKHAAGS  207



>ref|XP_006296251.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
 gb|EOA29149.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
Length=481

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 173/204 (85%), Gaps = 9/204 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            M R VA  +++L  S+VA A   +F++LPSEA +FFRP        + DDS  TRWAVL+
Sbjct  1    MTRIVAVIVVVLFLSLVAAASD-NFIRLPSEASKFFRPNN------ENDDS--TRWAVLV  51

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS+GYWNYRHQAD+CHAYQ+LK GG+K+ENIVVFMYDDIA NEENPR GVIIN+P+GED
Sbjct  52   AGSSGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIANNEENPRPGVIINSPNGED  111

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY+GVPKDYTGD+V V+N  AV+LG+K+A+KGGSGKVV+SGPNDHIF+YYSDHGGPGVLG
Sbjct  112  VYNGVPKDYTGDEVNVNNFFAVLLGNKTALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLG  171

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPTSPYLYA DLN  LKKKHA+GT
Sbjct  172  MPTSPYLYAKDLNDVLKKKHASGT  195



>gb|KFK32531.1| hypothetical protein AALP_AA6G255400 [Arabis alpina]
Length=484

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 172/207 (83%), Gaps = 9/207 (4%)
 Frame = +2

Query  65   VLTMIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWA  244
            + T   ++A S L++  S++AV    D ++LPS+A +FFRP        + D SVG RWA
Sbjct  1    MTTQRLNIAVSFLVIFVSLIAVFG--DVIRLPSQASKFFRPT-------EDDSSVGVRWA  51

Query  245  VLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPH  424
            VL+AGS GYWNYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIA N+ENPR GVIIN+P+
Sbjct  52   VLVAGSKGYWNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIAKNKENPRPGVIINSPY  111

Query  425  GEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPG  604
            GEDVY GVPKDYTGDDV V+NL AVIL +++A+KGGSGKV+DSGPNDHIF+YYSDHGGPG
Sbjct  112  GEDVYSGVPKDYTGDDVNVNNLSAVILRNRTALKGGSGKVLDSGPNDHIFIYYSDHGGPG  171

Query  605  VLGMPTSPYLYADDLNAALKKKHAAGT  685
            VLGMPTSP+LYA+DLN  LKKKHA+GT
Sbjct  172  VLGMPTSPHLYANDLNDVLKKKHASGT  198



>ref|XP_008444493.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis melo]
Length=493

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 166/201 (83%), Gaps = 8/201 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGS  262
            L LL  +++ +A G      DFL+LPSEA +FFR    +  +   +DSVGTRWAVLIAGS
Sbjct  10   LSLLLLAVIGLAFGSRDLPGDFLRLPSEALKFFRGGASDASD---EDSVGTRWAVLIAGS  66

Query  263  NGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYH  442
            NGYWNYRHQADICHAYQ+L+  GLKDENI+VFMYDDIA+N ENPR GVIIN+P G DVYH
Sbjct  67   NGYWNYRHQADICHAYQLLRKNGLKDENIIVFMYDDIAFNPENPRPGVIINHPKGSDVYH  126

Query  443  GVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPT  622
            GVPKDYTG+DV V+N  A ILG+++A+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT
Sbjct  127  GVPKDYTGEDVNVNNFFAAILGNRTALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPT  186

Query  623  SPYLYADDLNAALKKKHAAGT  685
             PY+YADDLN  LKKKHAAG+
Sbjct  187  YPYIYADDLNEVLKKKHAAGS  207



>gb|KDP34125.1| hypothetical protein JCGZ_07696 [Jatropha curcas]
Length=493

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 166/200 (83%), Gaps = 6/200 (3%)
 Frame = +2

Query  98   LLLLTFSIVAVADGRDF----LKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSN  265
            LLLL   +V+ A  RD     L+LPSEA RFFRP      + D  DS GTRWA+LIAGSN
Sbjct  10   LLLLALCVVSSAGSRDIVGDVLRLPSEASRFFRPGGAHVAKED--DSTGTRWAILIAGSN  67

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GYWNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA+N+ENPR GVIINNP+GEDVY G
Sbjct  68   GYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAFNKENPRPGVIINNPYGEDVYKG  127

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTS  625
            VPKDYTG+DV V+N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGGPGVLGMPT+
Sbjct  128  VPKDYTGEDVNVNNFFAAILGNKTAITGGSGKVVDSGPNDHIFIYYTDHGGPGVLGMPTN  187

Query  626  PYLYADDLNAALKKKHAAGT  685
            PYLYA+DL   L KKHA+GT
Sbjct  188  PYLYANDLIDVLIKKHASGT  207



>ref|XP_008377927.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
 ref|XP_008357361.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=492

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 168/210 (80%), Gaps = 8/210 (4%)
 Frame = +2

Query  74   MIRSVAA-SLLLLTFSIVAVADGRDF----LKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A  LL L     + A  RD     L+LPSEA RFF   +    + DG  +VGTR
Sbjct  1    MTRLASALVLLFLASVSASAAGSRDLNGNVLRLPSEASRFFGRGDNAPDQDDG--TVGTR  58

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR+GVIIN+
Sbjct  59   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRQGVIINS  118

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG DVY GVPKDYTG DVTV+N  A ILG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGG
Sbjct  119  PHGSDVYKGVPKDYTGQDVTVNNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGG  178

Query  599  PGVLGMP-TSPYLYADDLNAALKKKHAAGT  685
            PGVLGMP TSPY+YA+DL   LKKKHAAGT
Sbjct  179  PGVLGMPATSPYIYANDLIEVLKKKHAAGT  208



>ref|XP_010417372.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Camelina 
sativa]
Length=484

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 171/201 (85%), Gaps = 7/201 (3%)
 Frame = +2

Query  86   VAASLLLLTF-SIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGS  262
            +A S L+L+  S+VA A   + ++LPS+A +FFRP  +E      +D   TRWAVL+AGS
Sbjct  4    LAVSFLVLSLISLVAAAASDNIIRLPSQASKFFRPPTQE------NDDGSTRWAVLVAGS  57

Query  263  NGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYH  442
            +GYWNYRHQAD+CHAYQ+LK GG+K+ENIVVFMYDDIA +EENPR GVIIN+P+GEDVY+
Sbjct  58   SGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIAEHEENPRPGVIINSPNGEDVYN  117

Query  443  GVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPT  622
            GVPKDYTGD+V VDNL AVILG+K A+KGGSGKVV+SGPNDHIF+YYSDHGGPGVLGMPT
Sbjct  118  GVPKDYTGDEVNVDNLFAVILGNKKALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPT  177

Query  623  SPYLYADDLNAALKKKHAAGT  685
            SPYLYA DLN  LKKKHA+GT
Sbjct  178  SPYLYAKDLNDVLKKKHASGT  198



>ref|XP_010472621.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like [Camelina 
sativa]
Length=485

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 168/205 (82%), Gaps = 7/205 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRD-FLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M R   + L L   S+VA A   D  ++LPS+A +FF P  +E      +D   TRWAVL
Sbjct  1    MTRVAVSFLALFLISLVAAAASSDNIIRLPSQASKFFGPPTQE------NDDGSTRWAVL  54

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGS+GYWNYRHQAD+CHAYQ+LK GG+K+ENIVVFMYDDIA +EENPR GVIIN+P+GE
Sbjct  55   VAGSSGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIAKHEENPRPGVIINSPNGE  114

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY+GVPKDYTGD+V VDNL AVILG+K A+KGGSGKVV+SGPNDHIF+YYSDHGGPGVL
Sbjct  115  DVYNGVPKDYTGDEVNVDNLFAVILGNKKALKGGSGKVVNSGPNDHIFIYYSDHGGPGVL  174

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPTSPYLYA DLN  LKKKHA+GT
Sbjct  175  GMPTSPYLYAKDLNDVLKKKHASGT  199



>ref|XP_010526069.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=498

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            D +KLPSEA RFFRP        D D +VGTRWAVL+AGSNGYWNYRHQAD+CHAYQ+L+
Sbjct  33   DVIKLPSEASRFFRPTGSAGSGDD-DSTVGTRWAVLVAGSNGYWNYRHQADVCHAYQLLR  91

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLK+ENIVVFMYDDIA NEENPR G+IIN+PHGEDVY GVPKDYTGD+V+VDNL AVI
Sbjct  92   KGGLKEENIVVFMYDDIANNEENPRPGIIINSPHGEDVYKGVPKDYTGDEVSVDNLFAVI  151

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LG+K+A+KGGSGKVVDSGPNDHIF+YY+DHGGPGVLGMPTSPYLY  DL   LKKKHA+G
Sbjct  152  LGNKTALKGGSGKVVDSGPNDHIFIYYTDHGGPGVLGMPTSPYLYGKDLVDVLKKKHASG  211

Query  683  T  685
            T
Sbjct  212  T  212



>gb|EPS59704.1| hypothetical protein M569_15100, partial [Genlisea aurea]
Length=431

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD VGTRWAVL+AGSNGYWNYRHQAD+CHAYQ LK GGLKDENI+VFMYDDIAYN+ENPR
Sbjct  2    DDIVGTRWAVLVAGSNGYWNYRHQADVCHAYQTLKKGGLKDENIIVFMYDDIAYNDENPR  61

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+PHGE+VY GVPKDY GDDVTVDN  AV+LG+K+A+ GGSGKVVDSGPNDHIFV
Sbjct  62   PGVIINHPHGENVYDGVPKDYVGDDVTVDNFFAVLLGNKTALSGGSGKVVDSGPNDHIFV  121

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMPT PYLYA+DL   LK+KHA+GT
Sbjct  122  YYSDHGGPGVLGMPTDPYLYANDLIDVLKRKHASGT  157



>gb|KJB65605.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=273

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 163/208 (78%), Gaps = 11/208 (5%)
 Frame = +2

Query  77   IRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            + ++   + LL  S+  V         D L+LPSEA RFFR         D D+  GTRW
Sbjct  1    MTTLVTGVFLLLLSVAGVVSAARYITGDVLRLPSEASRFFRWRS------DDDEVGGTRW  54

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA+NEENPR GVIINNP
Sbjct  55   AVLIAGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAFNEENPRPGVIINNP  114

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            HG+DVY GVPKDYTG+DV V N  A +LG+KSA+ GGSGKVVDSGP+DHIF+YY+DHGGP
Sbjct  115  HGDDVYKGVPKDYTGEDVNVHNFFAALLGNKSAITGGSGKVVDSGPDDHIFIYYTDHGGP  174

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT PYLYADDL   LKKKHA+GT
Sbjct  175  GVLGMPTFPYLYADDLIDVLKKKHASGT  202



>ref|XP_011081710.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=485

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 166/205 (81%), Gaps = 6/205 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M+R  AA L LL  SI++VADGR DFLKLPSE RR F  +         DDS GT+WAVL
Sbjct  2    MVRCTAA-LFLLALSILSVADGRHDFLKLPSEGRRLFGSSPVGAY----DDSAGTKWAVL  56

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGY NYRHQAD+CHAYQILK GGLKDENI+VFMYDDIA N ENPR GVIIN+PHGE
Sbjct  57   VAGSNGYENYRHQADVCHAYQILKRGGLKDENIIVFMYDDIANNVENPRPGVIINSPHGE  116

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDY G+DVT  N  AV+LG+K+A+KGGSGKVVDSGPNDHIF+YY+DHG  G+L
Sbjct  117  DVYKGVPKDYVGEDVTAHNFFAVLLGNKTALKGGSGKVVDSGPNDHIFIYYADHGAAGLL  176

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPTS  +YAD+L   LKKKHA+GT
Sbjct  177  GMPTSREIYADELINVLKKKHASGT  201



>gb|KHG30636.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   248 bits (634),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 167/200 (84%), Gaps = 11/200 (6%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSN  265
            LLLL+F+ V V+  R    D L+LPSEA RFFR         D D+  GTRWAVLIAGSN
Sbjct  10   LLLLSFAGV-VSAARYITGDVLRLPSEASRFFRWRS------DDDEVGGTRWAVLIAGSN  62

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYNEENPR G+IINNPHG+DVY G
Sbjct  63   GYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNEENPRPGIIINNPHGDDVYKG  122

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTS  625
            VPKDYTG++VTV+N  A ILG+KSA+ GGSGKVV+SGP+DHIF+YYSDHGGPGVLGMPT 
Sbjct  123  VPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPSDHIFIYYSDHGGPGVLGMPTL  182

Query  626  PYLYADDLNAALKKKHAAGT  685
            PYLYADDL   LKKKHA+GT
Sbjct  183  PYLYADDLIDVLKKKHASGT  202



>ref|XP_002867219.1| GAMMA-VPE [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43478.1| GAMMA-VPE [Arabidopsis lyrata subsp. lyrata]
Length=494

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 161/181 (89%), Gaps = 5/181 (3%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            D +KLPS+A RFFRPA++     D D + GTRWAVL+AGS+GYWNYRHQADICHAYQ+L+
Sbjct  33   DVIKLPSQASRFFRPAQD-----DDDSNAGTRWAVLVAGSSGYWNYRHQADICHAYQLLR  87

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLK+ENIVVFMYDDIA N ENPR G +IN+PHG+DVY GVPKDYTGDDV VDNL AVI
Sbjct  88   KGGLKEENIVVFMYDDIANNYENPRPGTLINSPHGKDVYQGVPKDYTGDDVNVDNLFAVI  147

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LGDK+AVKGGSGKVVDSGPNDHIF++YSDHGGPGVLGMPTSPYLYA+DLN  LKKKHA+G
Sbjct  148  LGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASG  207

Query  683  T  685
            T
Sbjct  208  T  208



>ref|NP_195020.1| vacuolar-processing enzyme gamma [Arabidopsis thaliana]
 sp|Q39119.2|VPEG_ARATH RecName: Full=Vacuolar-processing enzyme gamma-isozyme; AltName: 
Full=Asparaginyl endopeptidase gamma-VPE; AltName: Full=Gamma-VPE; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK43975.1|AF370160_1 putative vacuolar processing enzyme gamma-VPE [Arabidopsis thaliana]
 gb|AAL11612.1|AF424619_1 AT4g32940/F26P21_60 [Arabidopsis thaliana]
 emb|CAA21203.1| gamma-VPE (vacuolar processing enzyme) [Arabidopsis thaliana]
 emb|CAB80011.1| gamma-VPE (vacuolar processing enzyme) [Arabidopsis thaliana]
 gb|AAL15210.1| putative vacuolar processing enzyme gamma-VPE [Arabidopsis thaliana]
 gb|AAM91361.1| At4g32940/F26P21_60 [Arabidopsis thaliana]
 gb|AEE86150.1| vacuolar-processing enzyme gamma [Arabidopsis thaliana]
Length=494

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 159/181 (88%), Gaps = 5/181 (3%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            D +KLPS+A RFFRPAE      D D + GTRWAVL+AGS+GYWNYRHQADICHAYQ+L+
Sbjct  33   DVIKLPSQASRFFRPAEN-----DDDSNSGTRWAVLVAGSSGYWNYRHQADICHAYQLLR  87

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLK+ENIVVFMYDDIA N ENPR G IIN+PHG+DVY GVPKDYTGDDV VDNL AVI
Sbjct  88   KGGLKEENIVVFMYDDIANNYENPRPGTIINSPHGKDVYQGVPKDYTGDDVNVDNLFAVI  147

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LGDK+AVKGGSGKVVDSGPNDHIF++YSDHGGPGVLGMPTSPYLYA+DLN  LKKKHA G
Sbjct  148  LGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHALG  207

Query  683  T  685
            T
Sbjct  208  T  208



>ref|XP_009117035.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Brassica 
rapa]
Length=489

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 175/207 (85%), Gaps = 7/207 (3%)
 Frame = +2

Query  68   LTMIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDS-VGTRWA  244
            +T + +V  S L L  S+V V+   D ++LPS+A +FFRP E++     GDDS  GT+WA
Sbjct  1    MTAVFTVVVSFLALFLSLVVVSG--DVIRLPSQASKFFRPTEDDV----GDDSSAGTKWA  54

Query  245  VLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPH  424
            VL+AGS GYWNYRHQAD+CHAYQ+L+ GG+K+ENIVVFMYDDIA N+ENPR G+IIN+P+
Sbjct  55   VLVAGSRGYWNYRHQADVCHAYQLLRKGGVKEENIVVFMYDDIAKNKENPRPGIIINSPN  114

Query  425  GEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPG  604
            G DVY+G+PKDYTGDDV VDNL AVILG+K+A+KGGSGKVVDSGP+DHIF+YYSDHGGPG
Sbjct  115  GNDVYNGIPKDYTGDDVNVDNLFAVILGNKTALKGGSGKVVDSGPDDHIFIYYSDHGGPG  174

Query  605  VLGMPTSPYLYADDLNAALKKKHAAGT  685
            VLGMPTSP LYA+DLN  LKKKHA+GT
Sbjct  175  VLGMPTSPALYANDLNDVLKKKHASGT  201



>emb|CDY11506.1| BnaA09g40720D [Brassica napus]
Length=489

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 175/207 (85%), Gaps = 7/207 (3%)
 Frame = +2

Query  68   LTMIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDS-VGTRWA  244
            +T + +V  S L L  S+V V+   D ++LPS+A +FFRP E++     GDDS  GT+WA
Sbjct  1    MTAVFTVVVSFLALFLSLVVVSG--DVIRLPSQASKFFRPTEDDV----GDDSSAGTKWA  54

Query  245  VLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPH  424
            VL+AGS GYWNYRHQAD+CHAYQ+L+ GG+K+ENIVVFMYDDIA N+ENPR G+IIN+P+
Sbjct  55   VLVAGSRGYWNYRHQADVCHAYQLLRKGGVKEENIVVFMYDDIAKNKENPRPGIIINSPN  114

Query  425  GEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPG  604
            G DVY+G+PKDYTGDDV VDNL AVILG+K+A+KGGSGKVVDSGP+DHIF+YYSDHGGPG
Sbjct  115  GNDVYNGIPKDYTGDDVNVDNLFAVILGNKTALKGGSGKVVDSGPDDHIFIYYSDHGGPG  174

Query  605  VLGMPTSPYLYADDLNAALKKKHAAGT  685
            VLGMPTSP LYA+DLN  LKKKHA+GT
Sbjct  175  VLGMPTSPALYANDLNDVLKKKHASGT  201



>gb|KJB65603.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=297

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 163/208 (78%), Gaps = 11/208 (5%)
 Frame = +2

Query  77   IRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            + ++   + LL  S+  V         D L+LPSEA RFFR         D D+  GTRW
Sbjct  1    MTTLVTGVFLLLLSVAGVVSAARYITGDVLRLPSEASRFFRWRS------DDDEVGGTRW  54

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA+NEENPR GVIINNP
Sbjct  55   AVLIAGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAFNEENPRPGVIINNP  114

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            HG+DVY GVPKDYTG+DV V N  A +LG+KSA+ GGSGKVVDSGP+DHIF+YY+DHGGP
Sbjct  115  HGDDVYKGVPKDYTGEDVNVHNFFAALLGNKSAITGGSGKVVDSGPDDHIFIYYTDHGGP  174

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT PYLYADDL   LKKKHA+GT
Sbjct  175  GVLGMPTFPYLYADDLIDVLKKKHASGT  202



>dbj|BAA18924.1| gamma-VPE [Arabidopsis thaliana]
Length=490

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 159/181 (88%), Gaps = 5/181 (3%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            D +KLPS+A RFFRPAE      D D + GTRWAVL+AGS+GYWNYRHQADICHAYQ+L+
Sbjct  29   DVIKLPSQASRFFRPAEN-----DDDSNSGTRWAVLVAGSSGYWNYRHQADICHAYQLLR  83

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLK+ENIVVFMYDDIA N ENPR G IIN+PHG+DVY GVPKDYTGDDV VDNL AVI
Sbjct  84   KGGLKEENIVVFMYDDIANNYENPRPGTIINSPHGKDVYQGVPKDYTGDDVNVDNLFAVI  143

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LGDK+AVKGGSGKVVDSGPNDHIF++YSDHGGPGVLGMPTSPYLYA+DLN  LKKKHA G
Sbjct  144  LGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHALG  203

Query  683  T  685
            T
Sbjct  204  T  204



>ref|XP_006408834.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
 gb|ESQ50287.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
Length=490

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 167/196 (85%), Gaps = 5/196 (3%)
 Frame = +2

Query  98   LLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWN  277
             L L  S+V V+   D +KLPS+A +FFR  +  +   DGD S GT+WAVL+AGS+GYWN
Sbjct  14   FLALFISLVTVS--CDVIKLPSQASKFFRTTKHND---DGDSSAGTKWAVLVAGSSGYWN  68

Query  278  YRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKD  457
            YRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N+ENPR G+IIN+P+G DVY+GVPKD
Sbjct  69   YRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAKNKENPRPGIIINSPNGNDVYNGVPKD  128

Query  458  YTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLY  637
            YTGDDV VDNL AVIL +K+A+KGGSGKVVDSGP+DHIF+YYSDHGGPGVLGMPTSP+LY
Sbjct  129  YTGDDVNVDNLFAVILANKTALKGGSGKVVDSGPDDHIFIYYSDHGGPGVLGMPTSPHLY  188

Query  638  ADDLNAALKKKHAAGT  685
            A+DL   LKKKHA+GT
Sbjct  189  ANDLIDILKKKHASGT  204



>gb|KJB65607.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=369

 Score =   243 bits (619),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 163/208 (78%), Gaps = 11/208 (5%)
 Frame = +2

Query  77   IRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            + ++   + LL  S+  V         D L+LPSEA RFFR         D D+  GTRW
Sbjct  1    MTTLVTGVFLLLLSVAGVVSAARYITGDVLRLPSEASRFFRWRS------DDDEVGGTRW  54

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA+NEENPR GVIINNP
Sbjct  55   AVLIAGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAFNEENPRPGVIINNP  114

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            HG+DVY GVPKDYTG+DV V N  A +LG+KSA+ GGSGKVVDSGP+DHIF+YY+DHGGP
Sbjct  115  HGDDVYKGVPKDYTGEDVNVHNFFAALLGNKSAITGGSGKVVDSGPDDHIFIYYTDHGGP  174

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT PYLYADDL   LKKKHA+GT
Sbjct  175  GVLGMPTFPYLYADDLIDVLKKKHASGT  202



>ref|NP_180165.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
 sp|P49047.2|VPEA_ARATH RecName: Full=Vacuolar-processing enzyme alpha-isozyme; AltName: 
Full=Alpha-VPE; AltName: Full=Asparaginyl endopeptidase 
alpha-VPE; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC31241.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 dbj|BAA09614.2| alpha-VPE [Arabidopsis thaliana]
 gb|AAL24163.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAL90957.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAM15043.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 gb|AEC07775.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
Length=478

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 172/203 (85%), Gaps = 10/203 (5%)
 Frame = +2

Query  77   IRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIA  256
            + +V + L L  F + AV+   D +KLPS A +FFRP E      + DDS  T+WAVL+A
Sbjct  1    MTTVVSFLALFLFLVAAVSG--DVIKLPSLASKFFRPTE------NDDDS--TKWAVLVA  50

Query  257  GSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDV  436
            GS+GYWNYRHQAD+CHAYQ+LK GG+K+ENIVVFMYDDIA NEENPR GVIIN+P+GEDV
Sbjct  51   GSSGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIAKNEENPRPGVIINSPNGEDV  110

Query  437  YHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGM  616
            Y+GVPKDYTGD+V VDNLLAVILG+K+A+KGGSGKVVDSGPNDHIF+YYSDHGGPGVLGM
Sbjct  111  YNGVPKDYTGDEVNVDNLLAVILGNKTALKGGSGKVVDSGPNDHIFIYYSDHGGPGVLGM  170

Query  617  PTSPYLYADDLNAALKKKHAAGT  685
            PTSP LYA+DLN  LKKK+A+GT
Sbjct  171  PTSPNLYANDLNDVLKKKYASGT  193



>ref|XP_003525979.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
 gb|KHN32223.1| Vacuolar-processing enzyme [Glycine soja]
Length=484

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 163/198 (82%), Gaps = 7/198 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADG--RDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGY  271
            +L L  +++ +A G   D L+LPSEA RFF+         D +D  GTRWAVL+AGSNGY
Sbjct  6    ILFLVATLITLASGARHDILRLPSEASRFFKAPANA----DQNDE-GTRWAVLVAGSNGY  60

Query  272  WNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVP  451
            WNYRHQ+D+CHAYQ+L+ GG+K+ENIVVFMYDDIA+NEENPR GVIIN+PHG DVY GVP
Sbjct  61   WNYRHQSDVCHAYQLLRKGGVKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVP  120

Query  452  KDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPY  631
            KDY G+DVTVDN  A ILG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT+PY
Sbjct  121  KDYVGEDVTVDNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPY  180

Query  632  LYADDLNAALKKKHAAGT  685
            +YA DL   LKKKHA+GT
Sbjct  181  MYASDLIEVLKKKHASGT  198



>ref|XP_010669172.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
 emb|CAC43295.1| putative vacuolar processing enzyme [Beta vulgaris]
Length=486

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 162/208 (78%), Gaps = 13/208 (6%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            MIR  +  L++L   + +V D R    + ++ PS+    F            DDSVGTRW
Sbjct  2    MIRYTSGVLIVLCVLMSSVVDSRLMVDNLIRWPSDHPSIFESD---------DDSVGTRW  52

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGS+GYWNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIAY+EENPR GV+IN+P
Sbjct  53   AVLIAGSSGYWNYRHQADVCHAYQVLKKGGLKDENIIVFMYDDIAYDEENPRPGVLINSP  112

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            +G DVY GVPKDYTG+DVTV+N  A ILG+K A+ GGSGKVV+SGPNDHIF++YSDHGG 
Sbjct  113  YGHDVYAGVPKDYTGEDVTVNNFFAAILGNKDAITGGSGKVVNSGPNDHIFIFYSDHGGA  172

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT PYLYAD+L   LK+KHA+GT
Sbjct  173  GVLGMPTYPYLYADELIETLKEKHASGT  200



>gb|ACU21276.1| unknown [Glycine max]
Length=279

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 161/198 (81%), Gaps = 8/198 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADG--RDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGY  271
            +L L  +++ +A G   D L+LPSEA  FF+         D +D  GTRWAVLIAGSNGY
Sbjct  6    ILFLLATLITLASGARHDILRLPSEASTFFKAPGG-----DQNDE-GTRWAVLIAGSNGY  59

Query  272  WNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVP  451
            W+YRHQ+D+CHAYQ+L+ GGLK+ENIVVFMYDDIA+NEENPR GVIIN+PHG DVY GVP
Sbjct  60   WDYRHQSDVCHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVP  119

Query  452  KDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPY  631
            KDY G+DVTV N  A ILG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT+PY
Sbjct  120  KDYIGEDVTVGNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPY  179

Query  632  LYADDLNAALKKKHAAGT  685
            +YA DL   LKKKHA+G+
Sbjct  180  MYASDLIEVLKKKHASGS  197



>ref|XP_007136809.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
 gb|ESW08803.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
Length=483

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 160/197 (81%), Gaps = 7/197 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADGRD-FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYW  274
            L LL   I  V+ GRD  L+LPSEA RFF+    +       +  GTRWA+LIAGSNGYW
Sbjct  7    LFLLATLITLVSGGRDEILRLPSEASRFFQAPAAD------QNQEGTRWALLIAGSNGYW  60

Query  275  NYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPK  454
            NYRHQ+D+CHAYQ+L+ GGLK+ENIVVFMYDDIA+NEENPR GVIIN+PHG DVY GVPK
Sbjct  61   NYRHQSDVCHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPK  120

Query  455  DYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYL  634
            DY G+DVTV+N  A ILG+KSA+ GGSGKV+DSGPNDHIF+YYSDHGGPGVLGMPTSPY+
Sbjct  121  DYVGEDVTVNNFFAAILGNKSALTGGSGKVIDSGPNDHIFIYYSDHGGPGVLGMPTSPYM  180

Query  635  YADDLNAALKKKHAAGT  685
            YA DL   LKKKHA+ T
Sbjct  181  YASDLIEVLKKKHASET  197



>ref|XP_002324151.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEF02716.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 166/205 (81%), Gaps = 10/205 (5%)
 Frame = +2

Query  83   SVAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            +  A  LL++   +A A GRD     L+LPSEA RFF   +  + +     S GTRWA+L
Sbjct  5    ATGAIFLLISLCGIAAA-GRDTVGDVLRLPSEASRFFHNDDNSDDD-----STGTRWAIL  58

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYN ENPR+GVIIN+P GE
Sbjct  59   LAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAYNSENPRRGVIINSPQGE  118

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTG+DVTV N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGGPGVL
Sbjct  119  DVYKGVPKDYTGEDVTVGNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGGPGVL  178

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT+PYLYADDL   LKKKHA+GT
Sbjct  179  GMPTNPYLYADDLIDVLKKKHASGT  203



>gb|KJB65602.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=488

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 163/208 (78%), Gaps = 11/208 (5%)
 Frame = +2

Query  77   IRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            + ++   + LL  S+  V         D L+LPSEA RFFR         D D+  GTRW
Sbjct  1    MTTLVTGVFLLLLSVAGVVSAARYITGDVLRLPSEASRFFRWRS------DDDEVGGTRW  54

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA+NEENPR GVIINNP
Sbjct  55   AVLIAGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAFNEENPRPGVIINNP  114

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            HG+DVY GVPKDYTG+DV V N  A +LG+KSA+ GGSGKVVDSGP+DHIF+YY+DHGGP
Sbjct  115  HGDDVYKGVPKDYTGEDVNVHNFFAALLGNKSAITGGSGKVVDSGPDDHIFIYYTDHGGP  174

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT PYLYADDL   LKKKHA+GT
Sbjct  175  GVLGMPTFPYLYADDLIDVLKKKHASGT  202



>gb|EPS65165.1| vacuolar processing enzyme-1b, partial [Genlisea aurea]
Length=478

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 154/187 (82%), Gaps = 9/187 (5%)
 Frame = +2

Query  128  VADGRD-FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICH  304
             +D R+ F+KLPSE   +   +E        DDSVGTRWAVL+AGS+GYWNYRHQAD+CH
Sbjct  12   TSDCRNQFIKLPSEVFSYGGESE--------DDSVGTRWAVLVAGSSGYWNYRHQADVCH  63

Query  305  AYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVD  484
            AYQILK GGLKDENI+VFMYDDIA N ENPR G++INNPHGEDVYHGVPKDY G  VT  
Sbjct  64   AYQILKRGGLKDENIIVFMYDDIAQNLENPRPGIVINNPHGEDVYHGVPKDYVGRQVTAH  123

Query  485  NLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALK  664
            N  +V+LGDK+ + GGSGKV++SGPNDHIF+YY+DHGGPGVLGMP+ PY+YADDLN  LK
Sbjct  124  NFYSVLLGDKAGLTGGSGKVIESGPNDHIFIYYTDHGGPGVLGMPSGPYIYADDLNDVLK  183

Query  665  KKHAAGT  685
            KKHA+GT
Sbjct  184  KKHASGT  190



>ref|XP_010437829.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=491

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 170/204 (83%), Gaps = 8/204 (4%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGR----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            V   LLLL  + +AV+  R    D +KLPS+A RFFRPA++     D D + GTRWAVL+
Sbjct  6    VGVPLLLLFLAPIAVSAARNGPDDVIKLPSQATRFFRPAQDN----DDDSNAGTRWAVLV  61

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS+GY NYRHQAD+CHAYQ+L+ GGLKDENIVVFMYDDIAY+  NPR G +IN+PHG+D
Sbjct  62   AGSSGYDNYRHQADVCHAYQLLRKGGLKDENIVVFMYDDIAYHHANPRPGTLINSPHGKD  121

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTGDDV VDNL AVILGDK+AVKGGSGKVVDSGPNDHIF++Y+DHGGPG+LG
Sbjct  122  VYQGVPKDYTGDDVNVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYTDHGGPGILG  181

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPTSPYLYA+DLN  L+KKHA GT
Sbjct  182  MPTSPYLYANDLNDVLRKKHALGT  205



>gb|KHG13131.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 164/199 (82%), Gaps = 11/199 (6%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSN  265
            LLLL+F+ V V+  R    D L+LPSEA RFFR         D D+  GTRWAVLIAGSN
Sbjct  10   LLLLSFAGV-VSAARYITGDVLRLPSEASRFFRWRS------DDDEVGGTRWAVLIAGSN  62

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA+NEENPR GVIINNPHG+DVY G
Sbjct  63   GYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAFNEENPRPGVIINNPHGDDVYKG  122

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTS  625
            VPKDYTG+DV V N  A +LG+KSA+ GGSGKVVDSGP+DHIF+YY+DHGGPGVLGMPT 
Sbjct  123  VPKDYTGEDVNVHNFFAALLGNKSAITGGSGKVVDSGPDDHIFIYYTDHGGPGVLGMPTF  182

Query  626  PYLYADDLNAALKKKHAAG  682
            PYLYADDL   LKKKHA+G
Sbjct  183  PYLYADDLIEVLKKKHASG  201



>ref|XP_006371860.1| hypothetical protein POPTR_0018s04650g [Populus trichocarpa]
 gb|ERP49657.1| hypothetical protein POPTR_0018s04650g [Populus trichocarpa]
Length=478

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 166/205 (81%), Gaps = 10/205 (5%)
 Frame = +2

Query  83   SVAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            +  A  LL++   +A A GRD     L+LPSEA RFF   +  + +     S GTRWA+L
Sbjct  5    ATGAIFLLISLCGIAAA-GRDTVGDVLRLPSEASRFFHNDDNSDDD-----STGTRWAIL  58

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYN ENPR+GVIIN+P GE
Sbjct  59   LAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAYNSENPRRGVIINSPQGE  118

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTG+DVTV N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGGPGVL
Sbjct  119  DVYKGVPKDYTGEDVTVGNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGGPGVL  178

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT+PYLYADDL   LKKKHA+GT
Sbjct  179  GMPTNPYLYADDLIDVLKKKHASGT  203



>gb|KHG17266.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=463

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 165/204 (81%), Gaps = 12/204 (6%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            V A LLLL+ + + V+ GRD     L+L SEA +FF          D D   GTRWAVLI
Sbjct  6    VGAILLLLSLTGI-VSAGRDVTGDILRLHSEANKFFHGG-------DDDKVEGTRWAVLI  57

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            A SNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIAYNEENPR G+IINNPHG+D
Sbjct  58   ARSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNEENPRPGIIINNPHGDD  117

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG++VTV+N  A ILG+KSA+ GGSGKVV+SGP+DHIF+YYSDHGGPGVLG
Sbjct  118  VYKGVPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPSDHIFIYYSDHGGPGVLG  177

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT PYLYADDL   LKKKHA+GT
Sbjct  178  MPTLPYLYADDLIDVLKKKHASGT  201



>dbj|BAA76744.1| asparaginyl endopeptidase (VmPE-1) [Vigna mungo]
Length=483

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 7/190 (4%)
 Frame = +2

Query  119  IVAVADGRD-FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQAD  295
            I  V+ GRD  L++PSEA RFF+         D +D  GTRWAVLIAGSNGYWNYRHQ+D
Sbjct  14   ITLVSGGRDEILRMPSEASRFFQAPAT-----DENDE-GTRWAVLIAGSNGYWNYRHQSD  67

Query  296  ICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDV  475
            +CHAYQ+L  GGLK+ENIVVFMYDDIA+NEENPR GVIIN+PHG DVY GVPKDY G+DV
Sbjct  68   VCHAYQLLTKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPKDYVGEDV  127

Query  476  TVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNA  655
            TV+N  A ILG+KSA+ GGSGKVV+SGPNDHIF+YYSDHGGPGVLGMPTSPY+YA DL  
Sbjct  128  TVNNFFAAILGNKSALTGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPTSPYMYASDLIE  187

Query  656  ALKKKHAAGT  685
             LKKKHA+GT
Sbjct  188  VLKKKHASGT  197



>emb|CDX76736.1| BnaC08g33220D [Brassica napus]
Length=486

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 175/210 (83%), Gaps = 10/210 (5%)
 Frame = +2

Query  56   ISTVLTMIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGT  235
            ++ V T++     S L    S+V V+   D ++LPS+A RFFRP E++  +   D S GT
Sbjct  1    MTAVFTVV-----SFLAFFLSLVVVSG--DVIRLPSQASRFFRPTEDDVCD---DSSAGT  50

Query  236  RWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIIN  415
            +WAVL+AGS GYWNYRHQAD+CHAYQ+L+ GG+K+ENIVVFMYDDIA N+ENPR G+IIN
Sbjct  51   KWAVLVAGSRGYWNYRHQADVCHAYQLLRKGGVKEENIVVFMYDDIAKNKENPRPGIIIN  110

Query  416  NPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHG  595
            +P+G+DVY+GVPKDYTGDDV VDNL AVILG+K+A+KGGSGKVVDSGPNDHIF+YYSDHG
Sbjct  111  SPNGDDVYNGVPKDYTGDDVNVDNLFAVILGNKTALKGGSGKVVDSGPNDHIFIYYSDHG  170

Query  596  GPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GPGVLGMPTSP LYA+DLN  LKKKHA+GT
Sbjct  171  GPGVLGMPTSPALYANDLNDVLKKKHASGT  200



>ref|XP_003603121.1| Vacuolar processing enzyme [Medicago truncatula]
 gb|AES73372.1| vacuolar processing enzyme [Medicago truncatula]
Length=484

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 160/197 (81%), Gaps = 8/197 (4%)
 Frame = +2

Query  95   SLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYW  274
            + L+  FS      G DFL+LPS+A RFF+         D D++ GT+WA+LIAGSNGYW
Sbjct  10   ATLIPIFSAATATAGDDFLRLPSQASRFFQS--------DDDNNEGTKWAILIAGSNGYW  61

Query  275  NYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPK  454
            NYRHQ+D+CHAYQ+L+ GGLK+ENI+VFMYDDIA N+ENPR GVIIN+PHG+DVY GVPK
Sbjct  62   NYRHQSDVCHAYQVLRKGGLKEENIIVFMYDDIADNQENPRPGVIINSPHGDDVYKGVPK  121

Query  455  DYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYL  634
            DYTGDDV V+N  A +LG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT P++
Sbjct  122  DYTGDDVNVNNFFAALLGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTGPFM  181

Query  635  YADDLNAALKKKHAAGT  685
            YA DL   LKKKHA+ T
Sbjct  182  YATDLIEVLKKKHASET  198



>ref|XP_008797891.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=486

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD+VGTRWAVLIAGS+GY NYRHQAD+CHAYQI+K GGLKDENI+VFMYDDIA+NEENPR
Sbjct  44   DDAVGTRWAVLIAGSSGYGNYRHQADVCHAYQIMKKGGLKDENIIVFMYDDIAHNEENPR  103

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
            +G+IIN+P GEDVY GVPKDY GDDV V+N  AV+LG+K+A+ GGSGKV+DSGP+DHIF+
Sbjct  104  RGIIINHPEGEDVYAGVPKDYVGDDVNVNNFFAVLLGNKTALTGGSGKVLDSGPDDHIFI  163

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLYADDL A LKKKHAAGT
Sbjct  164  FYSDHGGPGVLGMPTYPYLYADDLIAVLKKKHAAGT  199



>ref|XP_006578073.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=483

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 161/198 (81%), Gaps = 8/198 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADG--RDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGY  271
            +L L  +++ +A G   D L+LPSEA  FF+         D +D  GTRWAVLIAGSNGY
Sbjct  6    ILFLLATLITLASGARHDILRLPSEASTFFKAPGG-----DQNDE-GTRWAVLIAGSNGY  59

Query  272  WNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVP  451
            WNYRHQ+D+CHAYQ+L+ GGLK+ENIVVFMYDDIA+NEENPR GVIIN+PHG DVY GVP
Sbjct  60   WNYRHQSDVCHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVP  119

Query  452  KDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPY  631
            KDY G+DVTV N  A ILG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT+PY
Sbjct  120  KDYIGEDVTVGNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPY  179

Query  632  LYADDLNAALKKKHAAGT  685
            +YA DL   LKKKHA+G+
Sbjct  180  MYASDLIEVLKKKHASGS  197



>gb|KHN29737.1| Vacuolar-processing enzyme [Glycine soja]
Length=483

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 161/198 (81%), Gaps = 8/198 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADG--RDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGY  271
            +L L  +++ +A G   D L+LPSEA  FF+         D +D  GTRWAVLIAGSNGY
Sbjct  6    ILFLLATLITLASGARHDILRLPSEASTFFKAPGG-----DQNDE-GTRWAVLIAGSNGY  59

Query  272  WNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVP  451
            WNYRHQ+D+CHAYQ+L+ GGLK+ENIVVFMYDDIA+NEENPR GVIIN+PHG DVY GVP
Sbjct  60   WNYRHQSDVCHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVP  119

Query  452  KDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPY  631
            KDY G+DVTV N  A ILG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT+PY
Sbjct  120  KDYIGEDVTVGNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPY  179

Query  632  LYADDLNAALKKKHAAGT  685
            +YA DL   LKKKHA+G+
Sbjct  180  MYASDLIEVLKKKHASGS  197



>ref|XP_010911246.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=491

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD+VGTRWAVLIAGS+GY NYRHQAD+CHAYQI+K GGLKDENI+VFMYDDIAYNEENPR
Sbjct  49   DDTVGTRWAVLIAGSSGYGNYRHQADVCHAYQIMKKGGLKDENIIVFMYDDIAYNEENPR  108

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
            +G+IIN+P GEDVY GVPKDY G+DV V+N  AV+LG+K+A+ GGSGKVVDSGP+DHIF+
Sbjct  109  RGIIINHPQGEDVYAGVPKDYVGEDVNVNNFFAVLLGNKTALTGGSGKVVDSGPDDHIFI  168

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLYADDL A LKKKHAAGT
Sbjct  169  FYSDHGGPGVLGMPTYPYLYADDLIAVLKKKHAAGT  204



>dbj|BAC86022.1| unnamed protein product [Homo sapiens]
Length=483

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 161/198 (81%), Gaps = 8/198 (4%)
 Frame = +2

Query  98   LLLLTFSIVAVADG--RDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGY  271
            +L L  +++ +A G   D L+LPSEA  FF+         D +D  GTRWAVLIAGSNGY
Sbjct  6    ILFLLATLITLASGARHDILRLPSEASTFFKAPGG-----DQNDE-GTRWAVLIAGSNGY  59

Query  272  WNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVP  451
            WNYRHQ+D+CHAYQ+L+ GGLK+ENIVVFMYDDIA+NEENPR GVIIN+PHG DVY GVP
Sbjct  60   WNYRHQSDVCHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVP  119

Query  452  KDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPY  631
            KDY G+DVTV N  A ILG+KSA+ GGSGKVVDSGPNDHIF+YYSDHGGPGVLGMPT+PY
Sbjct  120  KDYIGEDVTVGNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPY  179

Query  632  LYADDLNAALKKKHAAGT  685
            +YA DL   LKKKHA+G+
Sbjct  180  VYASDLIEVLKKKHASGS  197



>ref|XP_006382030.1| hypothetical protein POPTR_0006s24900g [Populus trichocarpa]
 gb|ERP59827.1| hypothetical protein POPTR_0006s24900g [Populus trichocarpa]
Length=324

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 168/209 (80%), Gaps = 7/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R +A  + LL  S   +A G      D L+LPSEA RFFRP +  +  +D DDS GTR
Sbjct  1    MTRLIAGVIFLL-ISFCGIAVGVRDIVGDVLRLPSEASRFFRPGKFNDDNSD-DDSSGTR  58

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WA+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVIINN
Sbjct  59   WAILLAGSNGYWNYRHQADVCHAYQLLRQGGLKEENIIVFMYDDIADNPENPRPGVIINN  118

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            P GEDVY GVPKDYTG DVTV N  A ILG+K+A+ GGSGKV+DSGPNDHIF+YY+DHGG
Sbjct  119  PQGEDVYKGVPKDYTGPDVTVGNFFAAILGNKTALTGGSGKVIDSGPNDHIFIYYTDHGG  178

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PGVLGMPT+PYLYADDL   LKKKHA+GT
Sbjct  179  PGVLGMPTNPYLYADDLIDVLKKKHASGT  207



>ref|XP_006285517.1| hypothetical protein CARUB_v10006959mg [Capsella rubella]
 gb|EOA18415.1| hypothetical protein CARUB_v10006959mg [Capsella rubella]
Length=482

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 10/205 (5%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRD-FLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            M R     L L   ++ A  +G D  +KLPS+A RFFRP          ++  GTRWAVL
Sbjct  1    MTRLTVGVLFLSLIALSAARNGPDDVIKLPSQASRFFRPP---------ENDAGTRWAVL  51

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGS+GY NYRHQADICHAYQ+L+ GGLK+ENIVVFMYDDIA N ENPR G IIN+PHG+
Sbjct  52   VAGSSGYGNYRHQADICHAYQLLRKGGLKEENIVVFMYDDIANNYENPRPGTIINSPHGK  111

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTGDDVTVDNL AVILGDK+A+KGGSGKVVDSGPNDHIF++YSDHGGPGVL
Sbjct  112  DVYQGVPKDYTGDDVTVDNLFAVILGDKTAIKGGSGKVVDSGPNDHIFIFYSDHGGPGVL  171

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMPT PY+YA+DLN  LKKKHA GT
Sbjct  172  GMPTFPYIYANDLNDVLKKKHALGT  196



>ref|XP_010097094.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB66895.1| Vacuolar-processing enzyme [Morus notabilis]
Length=484

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 165/209 (79%), Gaps = 16/209 (8%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            MIR     LLL   +I  VA        D L+LPSEA RFFR         + +D+VGTR
Sbjct  1    MIRFATGVLLLSFLAISVVASCSRDLIGDVLRLPSEASRFFRSGGVS----EDNDAVGTR  56

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQAD+CHAYQ+L+ GGLKDENI+VFMYDD+AY+EENPR G+IIN+
Sbjct  57   WAVLIAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDVAYDEENPRPGIIINS  116

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHGEDVY+GVPKDYTGDDVTVDN  AV+LG+K+AVKGGSGKVVDSGPNDHIF++YSDHGG
Sbjct  117  PHGEDVYNGVPKDYTGDDVTVDNFFAVVLGNKTAVKGGSGKVVDSGPNDHIFIFYSDHGG  176

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PGVLG+       ADDL   LKKKHAAGT
Sbjct  177  PGVLGI-------ADDLLEVLKKKHAAGT  198



>ref|XP_004498922.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=492

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 169/213 (79%), Gaps = 14/213 (7%)
 Frame = +2

Query  53   KISTVLTMIRSVAASLLLLTFSIVAVAD-GRDFLKLPSearrffrpaeeenreaDGDDSV  229
            KIST+L +I  VA + L    ++ AV D   D+L+LPS+A RFF          + DD+V
Sbjct  5    KISTLLFLI--VALTFLA---AVSAVRDLPGDYLRLPSDASRFFHEP-------ENDDNV  52

Query  230  -GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGV  406
             GTRWA+L+AGSNGYWNYRHQAD+CHAYQIL+ GGLK+ENI+VFMYDDIA++ ENPR GV
Sbjct  53   QGTRWAILLAGSNGYWNYRHQADVCHAYQILRKGGLKEENIIVFMYDDIAFDIENPRPGV  112

Query  407  IINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYS  586
            IIN P G DVY GVPKDYTGDDV VDN  A +LG+KSA+ GGSGKVVDSGPNDHIFVYY+
Sbjct  113  IINKPDGGDVYAGVPKDYTGDDVNVDNFYAALLGNKSALTGGSGKVVDSGPNDHIFVYYT  172

Query  587  DHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            DHGGPGVLGMP  PYLYA DLN  LKKKHA+G+
Sbjct  173  DHGGPGVLGMPVGPYLYASDLNEVLKKKHASGS  205



>ref|XP_008220440.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-processing enzyme-like 
[Prunus mume]
Length=520

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 170/235 (72%), Gaps = 32/235 (14%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R  +A +LL   S+   A G      D L+LPSEA RFF   ++   E D D +VGTR
Sbjct  1    MTRLASAVVLLFLVSLSGFAAGSRDLIGDVLRLPSEASRFFGRGDDGPDEQD-DGTVGTR  59

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVLIAGSNGYWNYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYNEENPR GVIIN+
Sbjct  60   WAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNEENPRPGVIINS  119

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHG+DVY GVPKDYTGDDVTV+N  A ILG+K+A+ GG+GKVVDSGPNDHIF+YYSDHGG
Sbjct  120  PHGDDVYKGVPKDYTGDDVTVNNFFAAILGNKTALTGGTGKVVDSGPNDHIFIYYSDHGG  179

Query  599  PGVLG---------------MPTS-----------PYLYADDLNAALKKKHAAGT  685
            PGVLG               +P S           PY+YA+DL   LKKKHAAGT
Sbjct  180  PGVLGXYQFCTXQYXYYFAHIPISYLLXXXXXXXXPYIYANDLIEVLKKKHAAGT  234



>gb|ACQ91103.1| vacuolar processing enzyme a [Populus tomentosa]
Length=493

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 168/208 (81%), Gaps = 5/208 (2%)
 Frame = +2

Query  74   MIRSVAASL-LLLTFSIVAVADGR---DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            M R +A  + LL+ F  +AV       D L+LPSEA RFFR  +  +  +D DDS GTRW
Sbjct  1    MTRLIAGVIFLLIAFCGIAVGVRDIVGDVLRLPSEASRFFRSGKFNDDNSD-DDSSGTRW  59

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            A+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVIINNP
Sbjct  60   AILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIADNPENPRPGVIINNP  119

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
             GEDVY GVPKDYTG DVTV N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGGP
Sbjct  120  QGEDVYEGVPKDYTGQDVTVGNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGGP  179

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT+PYLYADDL   LKKKHA+GT
Sbjct  180  GVLGMPTNPYLYADDLIDVLKKKHASGT  207



>ref|XP_011019532.1| PREDICTED: vacuolar-processing enzyme isoform X1 [Populus euphratica]
Length=493

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 168/209 (80%), Gaps = 7/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADG-----RDFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R +A  + LL  S   +A G      D L+LPSEA RFFRP +  +  +D DDS GTR
Sbjct  1    MTRLIAGVIFLL-ISFCGIAVGVRDIVGDVLRLPSEASRFFRPGKFNDDNSD-DDSSGTR  58

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WA+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVIINN
Sbjct  59   WAILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIADNPENPRPGVIINN  118

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            P GEDVY GVPKDYTG DVTV N  A ILG+K+A+ GGSGKVVDSGPNDHIF+YY+DHGG
Sbjct  119  PQGEDVYKGVPKDYTGQDVTVGNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTDHGG  178

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PGVLGMPT+PYLYADDL   LKKKHA+GT
Sbjct  179  PGVLGMPTNPYLYADDLIDVLKKKHASGT  207



>gb|KCW81643.1| hypothetical protein EUGRSUZ_C03004 [Eucalyptus grandis]
Length=433

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 159/185 (86%), Gaps = 4/185 (2%)
 Frame = +2

Query  131  ADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAY  310
            A GR+ ++LPS+A RFFR  ++   +     SVGTRWAVLIAGSNGYWNYRHQAD+CHAY
Sbjct  22   AAGRNVIRLPSDASRFFRAGDDGGDDD----SVGTRWAVLIAGSNGYWNYRHQADVCHAY  77

Query  311  QILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNL  490
            Q+LK GGLKDENI+VF+YDDIA NEENPR G++IN+P G+DVY GVPKDYTG+DV V+N 
Sbjct  78   QLLKKGGLKDENIIVFIYDDIADNEENPRPGIVINSPDGDDVYEGVPKDYTGEDVNVNNF  137

Query  491  LAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKK  670
             +VILG+K+A+ GGSGKV++SGP+D IF+YY+DHGGPGVLGMPTSP+LYADDL   LKKK
Sbjct  138  FSVILGNKTALTGGSGKVLESGPDDTIFIYYTDHGGPGVLGMPTSPFLYADDLIDVLKKK  197

Query  671  HAAGT  685
            HA+GT
Sbjct  198  HASGT  202



>ref|XP_002308580.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEE92103.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=493

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 168/209 (80%), Gaps = 7/209 (3%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADG-----RDFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M R +A  + LL  S   +A G      D L+LPSEA RFFRP +  +  +D DDS GTR
Sbjct  1    MTRLIAGVIFLL-ISFCGIAVGVRDIVGDVLRLPSEASRFFRPGKFNDDNSD-DDSSGTR  58

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WA+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVIINN
Sbjct  59   WAILLAGSNGYWNYRHQADVCHAYQLLRQGGLKEENIIVFMYDDIADNPENPRPGVIINN  118

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            P GEDVY GVPKDYTG DVTV N  A ILG+K+A+ GGSGKV+DSGPNDHIF+YY+DHGG
Sbjct  119  PQGEDVYKGVPKDYTGPDVTVGNFFAAILGNKTALTGGSGKVIDSGPNDHIFIYYTDHGG  178

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            PGVLGMPT+PYLYADDL   LKKKHA+GT
Sbjct  179  PGVLGMPTNPYLYADDLIDVLKKKHASGT  207



>ref|NP_001236564.1| vacuolar processing enzyme 2 precursor [Glycine max]
 gb|AAL58570.1| vacuolar processing enzyme 2 [Glycine max]
Length=482

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 148/182 (81%), Gaps = 15/182 (8%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSV-GTRWAVLIAGSNGYWNYRHQADICHAYQIL  319
            DFL+LPSE               D DD+  GTRWAVL+AGSNGYWNYRHQAD+CHAYQIL
Sbjct  29   DFLRLPSET--------------DNDDNFKGTRWAVLLAGSNGYWNYRHQADVCHAYQIL  74

Query  320  KAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAV  499
            + GGLK+ENI+VFMYDDIA+N ENPR GVIIN P G DVY GVPKDYTG+DVTVDN  A 
Sbjct  75   RKGGLKEENIIVFMYDDIAFNGENPRPGVIINKPDGGDVYKGVPKDYTGEDVTVDNFFAA  134

Query  500  ILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            +LG+KSA+ GGSGKVVDSGP+DHIFVYY+DHGGPGVLGMP  PYLYADDL   LKKKHA+
Sbjct  135  LLGNKSALTGGSGKVVDSGPDDHIFVYYTDHGGPGVLGMPAGPYLYADDLIEVLKKKHAS  194

Query  680  GT  685
            GT
Sbjct  195  GT  196



>ref|XP_006853917.1| hypothetical protein AMTR_s00036p00187360 [Amborella trichopoda]
 gb|ERN15384.1| hypothetical protein AMTR_s00036p00187360 [Amborella trichopoda]
Length=469

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 154/209 (74%), Gaps = 22/209 (11%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTR  238
            M  S  + L L  F   +   GR     DFL++P                   +DSVGTR
Sbjct  1    MAFSGKSVLFLAVFMAFSGVYGRYSTWSDFLRMPQT-----------------EDSVGTR  43

Query  239  WAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINN  418
            WAVL+AGS+GY NYRHQADICHAYQ +  GGLK++NIVVFMYDDIAYNEENPR GVIIN 
Sbjct  44   WAVLVAGSSGYGNYRHQADICHAYQTMIRGGLKEKNIVVFMYDDIAYNEENPRPGVIINR  103

Query  419  PHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGG  598
            PHGEDVY GVPKDY GDDV VDNL AVILG+KSA+ GGSGKVVDSGP+DHIF++YSDHGG
Sbjct  104  PHGEDVYAGVPKDYVGDDVNVDNLFAVILGNKSALTGGSGKVVDSGPDDHIFIFYSDHGG  163

Query  599  PGVLGMPTSPYLYADDLNAALKKKHAAGT  685
             GVLGMPT PYLYADDL   LKKKH +GT
Sbjct  164  AGVLGMPTYPYLYADDLVNVLKKKHVSGT  192



>gb|AET08896.1| vacuolar processing enzyme 4 [Aegilops tauschii]
 emb|CCC14982.1| VPE4D protein [Aegilops tauschii]
Length=493

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DDSVGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA+N ENPR
Sbjct  51   DDSVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHNPENPR  110

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V N  AV+LG+K+AV GGSGKVVDSGPNDHIFV
Sbjct  111  PGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLGNKTAVSGGSGKVVDSGPNDHIFV  170

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  171  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  206



>ref|XP_010432633.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=492

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D D + GTRWAVL+AGS+GY NYRHQAD+CHAYQ+L+ GGLKDENIVVFMYDDIAY+  N
Sbjct  48   DDDSNAGTRWAVLVAGSSGYDNYRHQADVCHAYQLLRKGGLKDENIVVFMYDDIAYHHAN  107

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR G IIN+PHG+DVY GVPKDYTGDDVTVDNL AVILGDK+AVKGGSGKVVDSGPNDHI
Sbjct  108  PRPGTIINSPHGKDVYQGVPKDYTGDDVTVDNLFAVILGDKTAVKGGSGKVVDSGPNDHI  167

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F++Y+DHGGPG+LGMPT PY+YA+DLN  LKKKHA GT
Sbjct  168  FIFYTDHGGPGILGMPTYPYIYANDLNDVLKKKHALGT  205



>ref|XP_003569218.1| PREDICTED: vacuolar-processing enzyme-like [Brachypodium distachyon]
Length=488

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DDSVGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA+N ENPR
Sbjct  46   DDSVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHNPENPR  105

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V N  AV+LG+K+AV GGSGKVVDSGPNDHIFV
Sbjct  106  PGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLGNKAAVSGGSGKVVDSGPNDHIFV  165

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  166  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  201



>ref|XP_010049168.1| PREDICTED: vacuolar-processing enzyme-like [Eucalyptus grandis]
 gb|KCW81642.1| hypothetical protein EUGRSUZ_C03004 [Eucalyptus grandis]
Length=488

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 159/185 (86%), Gaps = 4/185 (2%)
 Frame = +2

Query  131  ADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAY  310
            A GR+ ++LPS+A RFFR  ++   +     SVGTRWAVLIAGSNGYWNYRHQAD+CHAY
Sbjct  22   AAGRNVIRLPSDASRFFRAGDDGGDDD----SVGTRWAVLIAGSNGYWNYRHQADVCHAY  77

Query  311  QILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNL  490
            Q+LK GGLKDENI+VF+YDDIA NEENPR G++IN+P G+DVY GVPKDYTG+DV V+N 
Sbjct  78   QLLKKGGLKDENIIVFIYDDIADNEENPRPGIVINSPDGDDVYEGVPKDYTGEDVNVNNF  137

Query  491  LAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKK  670
             +VILG+K+A+ GGSGKV++SGP+D IF+YY+DHGGPGVLGMPTSP+LYADDL   LKKK
Sbjct  138  FSVILGNKTALTGGSGKVLESGPDDTIFIYYTDHGGPGVLGMPTSPFLYADDLIDVLKKK  197

Query  671  HAAGT  685
            HA+GT
Sbjct  198  HASGT  202



>ref|XP_010447316.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Camelina 
sativa]
Length=491

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 163/192 (85%), Gaps = 8/192 (4%)
 Frame = +2

Query  122  VAVADGR----DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQ  289
            +AV+  R    D +KLPS+A RFFRPA++     D D + GTRWAVL+AGS+GY NYRHQ
Sbjct  18   IAVSAARNRPDDIIKLPSQASRFFRPAQDN----DDDSNAGTRWAVLVAGSSGYDNYRHQ  73

Query  290  ADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGD  469
            AD+CHAYQ+L+ GGLKDENIVVFMYDDIAY+  NPR G +IN+PHG+DVY GVPKDYTGD
Sbjct  74   ADVCHAYQLLRKGGLKDENIVVFMYDDIAYHHANPRPGTLINSPHGKDVYQGVPKDYTGD  133

Query  470  DVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDL  649
            DV VDNL AVILGDK+AVKGGSGKVVDSGPNDHIF++Y+DHGGPG+LGMPT PYLYA+DL
Sbjct  134  DVNVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYTDHGGPGILGMPTYPYLYANDL  193

Query  650  NAALKKKHAAGT  685
            N  LKKKHA GT
Sbjct  194  NDVLKKKHALGT  205



>ref|XP_003550283.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=481

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 148/182 (81%), Gaps = 15/182 (8%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSV-GTRWAVLIAGSNGYWNYRHQADICHAYQIL  319
            DFL+LPSE               D DD+V GTRWAVL+AGSNGYWNYRHQAD+CHAYQIL
Sbjct  28   DFLRLPSET--------------DNDDNVQGTRWAVLLAGSNGYWNYRHQADVCHAYQIL  73

Query  320  KAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAV  499
            + GGLK+ENI+VFMYDDIA+N ENPR GVIIN P G DVY GVPKDYTG+DVTV N  A 
Sbjct  74   RKGGLKEENIIVFMYDDIAFNGENPRPGVIINKPDGGDVYEGVPKDYTGEDVTVGNFFAA  133

Query  500  ILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            +LG+KSA+ GGSGKVVDSGP+DHIFVYY+DHGGPGVLGMP  PYLYADDL   LKKKHA+
Sbjct  134  LLGNKSALTGGSGKVVDSGPDDHIFVYYTDHGGPGVLGMPAGPYLYADDLIEVLKKKHAS  193

Query  680  GT  685
            GT
Sbjct  194  GT  195



>emb|CAQ00099.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26641.1| vacuolar processing enzyme 3 [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DDSVGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA N ENPR
Sbjct  42   DDSVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIARNPENPR  101

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V N  AV+LG+K+AV GGSGKVVDSGPNDHIFV
Sbjct  102  PGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLGNKTAVNGGSGKVVDSGPNDHIFV  161

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  162  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  197



>gb|AET08893.1| vacuolar processing enzyme 4 [Aegilops speltoides]
 emb|CCC14971.1| VPE4B protein [Aegilops speltoides]
Length=493

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DDSVGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENI++FMYDDIA+N ENPR
Sbjct  51   DDSVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIIFMYDDIAHNPENPR  110

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V N  AV+LG+++AV GGSGKVVDSGPNDHIFV
Sbjct  111  PGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLGNRTAVSGGSGKVVDSGPNDHIFV  170

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  171  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  206



>ref|XP_009407316.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=488

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD+VGTRWAVLIAGSNG++NYRHQADICHAYQI+K GGLKDENI+VFMYDDIAY+E+NPR
Sbjct  45   DDAVGTRWAVLIAGSNGFFNYRHQADICHAYQIMKNGGLKDENIIVFMYDDIAYSEDNPR  104

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G IIN+P G DVY GVPKDY GDDV V+N  AV+LG+K+A+ GGSGKVVDSGPNDHIF+
Sbjct  105  LGTIINHPEGGDVYAGVPKDYVGDDVNVNNFFAVLLGNKTALTGGSGKVVDSGPNDHIFI  164

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT+PYLYADDL + LKKKHA+G+
Sbjct  165  FYSDHGGPGVLGMPTNPYLYADDLISVLKKKHASGS  200



>gb|ACF79136.1| unknown [Zea mays]
 gb|ACF85763.1| unknown [Zea mays]
 gb|ACF88139.1| unknown [Zea mays]
 tpg|DAA58991.1| TPA: legumain-like protease Precursor [Zea mays]
Length=481

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  215  GDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENP  394
             DD+VGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENIVVFMYDDIA++ ENP
Sbjct  38   ADDAVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIVVFMYDDIAHSPENP  97

Query  395  RKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIF  574
            R GVIIN+P G DVY GVPKDYTG +V VDN  AV+LG+K+A++GGSGKVVDSGPNDHIF
Sbjct  98   RPGVIINHPQGGDVYAGVPKDYTGREVNVDNFFAVLLGNKTALRGGSGKVVDSGPNDHIF  157

Query  575  VYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            V+YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  158  VFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  194



>gb|EPS60197.1| legumain/vacuolar processing enzyme, partial [Genlisea aurea]
Length=159

 Score =   225 bits (574),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            D+ GTRWAVL+AGS+GYWNYRHQAD+CHAYQILK GGL+DENIVVFMYDDIA + +NPR 
Sbjct  1    DTAGTRWAVLVAGSSGYWNYRHQADVCHAYQILKRGGLRDENIVVFMYDDIARSSDNPRP  60

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            GV+IN+P G DVY GVPKDY GD VT  N  +V+LGDK+ + GGSGKV+ SGPNDHIFVY
Sbjct  61   GVVINSPQGRDVYSGVPKDYVGDQVTAHNFYSVLLGDKATLTGGSGKVIQSGPNDHIFVY  120

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            Y+DHGGPGVLGMPT PY+YAD LN  LKKK+A+GT
Sbjct  121  YTDHGGPGVLGMPTGPYIYADGLNKVLKKKYASGT  155



>ref|XP_007160985.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
 gb|ESW32979.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
Length=484

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 148/181 (82%), Gaps = 13/181 (7%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            DFL+LPS++              +GD+  GTRWA+L AGS+GYWNYRHQADICHAYQ+L+
Sbjct  31   DFLRLPSDSG-------------NGDNVHGTRWAILFAGSSGYWNYRHQADICHAYQLLR  77

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLKDENI+VFMYDDIA+N ENPR+GVIIN+P+G+DVY GVPKDYTG+DVT  N  A +
Sbjct  78   KGGLKDENIIVFMYDDIAFNSENPRRGVIINSPNGDDVYKGVPKDYTGEDVTAHNFYAAL  137

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LGDKS + GGSGKVV+SGPNDHIF++YSDHGGPGVLG P  PY+YA DLN  LKKKHA+G
Sbjct  138  LGDKSKLTGGSGKVVNSGPNDHIFIFYSDHGGPGVLGSPAGPYIYASDLNEVLKKKHASG  197

Query  683  T  685
            T
Sbjct  198  T  198



>ref|XP_009410798.1| PREDICTED: vacuolar-processing enzyme [Musa acuminata subsp. 
malaccensis]
Length=488

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            D +GTRWAVLIAGSNGY+NYRHQAD+CHAYQ+LK GGL+DENI+VFMYDDIA NE+NPR 
Sbjct  47   DPLGTRWAVLIAGSNGYYNYRHQADVCHAYQVLKKGGLQDENIIVFMYDDIANNEDNPRP  106

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            GVIIN+P GEDVY GVPKDY GDDV V+N  AV+LG+K+A+ GGSGKVV+S PNDHIFV+
Sbjct  107  GVIINDPWGEDVYAGVPKDYVGDDVNVNNFFAVLLGNKTALSGGSGKVVNSAPNDHIFVF  166

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YSDHGGPGVLGMPT PYLYADDL A LKKKHA+G+
Sbjct  167  YSDHGGPGVLGMPTYPYLYADDLIAVLKKKHASGS  201



>gb|EMT10444.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=532

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DDSVGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENI+VFMY+DIA+N ENPR
Sbjct  51   DDSVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYNDIAHNPENPR  110

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V N  AV+LG+K+AV GGSGKVVDSGPNDHIFV
Sbjct  111  PGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLGNKTAVSGGSGKVVDSGPNDHIFV  170

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  171  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  206



>sp|P49044.1|VPE_VICSA RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Proteinase B; Flags: Precursor [Vicia sativa]
 emb|CAA84383.1| cysteine proteinase [Vicia sativa]
Length=493

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 161/211 (76%), Gaps = 13/211 (6%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIV---AVADGRD----FLKLPSearrffrpaeeenreaDGDDSVG  232
            M  S  ++LL  T  +     V+ GRD    +L+LPSE  RFFR  +      + DD  G
Sbjct  1    MGSSQLSTLLFFTIVVTFLTVVSSGRDLPGDYLRLPSETSRFFREPK------NDDDFEG  54

Query  233  TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVII  412
            TRWA+L+AGSNGYWNYRHQ+D+CHAYQ+L+ GG K+ENI+VFMYDDIA NEENPR GVII
Sbjct  55   TRWAILLAGSNGYWNYRHQSDVCHAYQLLRKGGSKEENIIVFMYDDIASNEENPRPGVII  114

Query  413  NNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDH  592
            N P G+DVY GVPKDYTG +V  DN  A +LG+KSA+ GGSGKVVDSGPNDHIFVYY+DH
Sbjct  115  NKPDGDDVYAGVPKDYTGAEVHADNFYAALLGNKSALTGGSGKVVDSGPNDHIFVYYTDH  174

Query  593  GGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GGPGVLGMP  PYLYA DLN  LKKKHA+GT
Sbjct  175  GGPGVLGMPVGPYLYASDLNEVLKKKHASGT  205



>ref|XP_004968980.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=487

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD+VGTRWAVLIAGSNGY+NYRHQADICHAYQILK GGLKDENI+VFMYDDIA++ ENPR
Sbjct  45   DDAVGTRWAVLIAGSNGYYNYRHQADICHAYQILKKGGLKDENIIVFMYDDIAHSPENPR  104

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V+N  AV+LG+K+AV GGSGKVVDSGPNDHIFV
Sbjct  105  PGVIINHPQGGDVYAGVPKDYTGREVNVNNFFAVLLGNKTAVSGGSGKVVDSGPNDHIFV  164

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  165  FYSDHGGPGVLGMPTYPYLYGDDLVNVLKKKHAAGT  200



>sp|O24325.1|VPE1_PHAVU RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Legumain-like proteinase; Short=LLP; Flags: Precursor 
[Phaseolus vulgaris]
 emb|CAB17078.1| asparagine-specific endopeptidase precursor [Phaseolus vulgaris]
Length=484

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 148/181 (82%), Gaps = 13/181 (7%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            DFL+LPS++              +GD+  GTRWA+L AGS+GYWNYRHQADICHAYQ+L+
Sbjct  31   DFLRLPSDSG-------------NGDNVHGTRWAILFAGSSGYWNYRHQADICHAYQLLR  77

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLKDENI+VFMYDDIA+N ENPR+GVIIN+P+G++VY GVPKDYTG+DVT  N  A +
Sbjct  78   KGGLKDENIIVFMYDDIAFNSENPRRGVIINSPNGDEVYKGVPKDYTGEDVTAHNFYAAL  137

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LGDKS + GGSGKVV+SGPNDHIF++YSDHGGPGVLG P  PY+YA DLN  LKKKHA+G
Sbjct  138  LGDKSKLTGGSGKVVNSGPNDHIFIFYSDHGGPGVLGSPAGPYIYASDLNEVLKKKHASG  197

Query  683  T  685
            T
Sbjct  198  T  198



>ref|XP_010669169.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 160/208 (77%), Gaps = 11/208 (5%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGR----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            MIR +A   L+L   + ++ + R    DFL+LPS+         +       DD +GTRW
Sbjct  1    MIRYIAGVPLILFLLLSSLVESRQIFDDFLRLPSDHDFPRSNDVD-------DDQIGTRW  53

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            AVLIAGSNGYWNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIAY+EENPR GVIIN+P
Sbjct  54   AVLIAGSNGYWNYRHQADVCHAYQVLKKGGLKDENIIVFMYDDIAYHEENPRPGVIINSP  113

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
            +G DVY GVPKDYTG++VTV N  A +LGD+ A+ GGSGKVVDSGPNDHIF+YYSDHGG 
Sbjct  114  YGGDVYAGVPKDYTGNNVTVHNFFAALLGDREAITGGSGKVVDSGPNDHIFIYYSDHGGA  173

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMPT P+LYAD L   LK+KHA+ T
Sbjct  174  GVLGMPTVPFLYADTLMNTLKRKHASRT  201



>ref|XP_006646004.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=516

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +2

Query  134  DGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQ  313
            D  D L LPSE             E   + +VGTRWAVLIAGSNGY+NYRHQAD+CHAYQ
Sbjct  46   DSSDNLLLPSEREWERERERSVEDEDAAEAAVGTRWAVLIAGSNGYYNYRHQADVCHAYQ  105

Query  314  ILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLL  493
            I+K GGLKDENI+VFMYDDIA+N ENPR GVIIN+P G DVY GVPKDYTG DV V NL 
Sbjct  106  IMKKGGLKDENIIVFMYDDIAHNSENPRPGVIINHPQGGDVYAGVPKDYTGKDVNVKNLF  165

Query  494  AVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKH  673
            AV+LGDK+AV GGSGKV+DSGPNDHIF++YSDHGGPGVLGMPT PYLY DDL   LKKKH
Sbjct  166  AVLLGDKTAVSGGSGKVLDSGPNDHIFIFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKH  225

Query  674  AAGT  685
            AAGT
Sbjct  226  AAGT  229



>gb|AET08891.1| vacuolar processing enzyme 4 [Triticum monococcum]
 emb|CCC14976.1| VPE4A protein [Triticum urartu]
Length=493

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DDSVGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA+N ENP 
Sbjct  51   DDSVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHNLENPG  110

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V NL AV+LG+K+AV GGSGKVVDSGPNDHIFV
Sbjct  111  PGVIINHPQGGDVYAGVPKDYTGKEVNVKNLFAVLLGNKTAVSGGSGKVVDSGPNDHIFV  170

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  171  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  206



>emb|CAB64545.1| legumain-like protease [Zea mays]
Length=481

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  215  GDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENP  394
             DD+VGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENIVVFMYDDIA++ ENP
Sbjct  38   ADDAVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIVVFMYDDIAHSPENP  97

Query  395  RKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIF  574
            R GVIIN+P G DVY GVPKDYTG DV VDN  AV+LG+K+A++GGSGKVVDSGPNDHI 
Sbjct  98   RPGVIINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNKTALRGGSGKVVDSGPNDHIS  157

Query  575  VYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            V+YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  158  VFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  194



>emb|CBM41515.1| legumain/vacuolar processing enzyme [Papaver rhoeas]
Length=490

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = +2

Query  218  DDSVG-TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENP  394
            DDSVG TRWAVLIAGS+GYWNYRHQAD+CHAYQ+LK GG+KDENIVVFMYDDIA NEENP
Sbjct  48   DDSVGGTRWAVLIAGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENP  107

Query  395  RKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIF  574
            R GVIIN+P GEDVY GVPKDYTG DVT  N  +V+LG+K+AVKGGSGKV+DSGPNDHIF
Sbjct  108  RPGVIINHPKGEDVYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIF  167

Query  575  VYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YYSDHGGPGVLGMPT PYLYADDL   LK+KHA G 
Sbjct  168  IYYSDHGGPGVLGMPTYPYLYADDLVNVLKQKHALGA  204



>ref|XP_002455802.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
 gb|EES00922.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
Length=481

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  215  GDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENP  394
             DD+VGTRWAVL+AGSNGY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA++ ENP
Sbjct  38   ADDAVGTRWAVLVAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHSPENP  97

Query  395  RKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIF  574
            R GV+IN+P G DVY GVPKDYTG +V+V+N  AV+LG+K+A+KGGSGKVVDSGPNDHIF
Sbjct  98   RPGVLINHPQGGDVYAGVPKDYTGREVSVNNFFAVLLGNKTALKGGSGKVVDSGPNDHIF  157

Query  575  VYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            V+YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  158  VFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  194



>emb|CDM87100.1| unnamed protein product [Triticum aestivum]
Length=478

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            D SVGTRWAVL+AGSNGY+NYRHQADICHAYQILK GGLKDENI+VFMYDDIA+N ENPR
Sbjct  36   DGSVGTRWAVLVAGSNGYYNYRHQADICHAYQILKKGGLKDENIIVFMYDDIAHNLENPR  95

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG +V V NL AV+LG+K+AV GGSGKVVDSGPNDHIFV
Sbjct  96   PGVIINHPQGGDVYAGVPKDYTGKEVNVKNLFAVLLGNKTAVSGGSGKVVDSGPNDHIFV  155

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGV+GMPT PY+Y DDL   LKKKHAAGT
Sbjct  156  FYSDHGGPGVIGMPTYPYVYGDDLVDVLKKKHAAGT  191



>gb|AFK44897.1| unknown [Medicago truncatula]
Length=334

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 159/211 (75%), Gaps = 11/211 (5%)
 Frame = +2

Query  74   MIRSVAASLLLLT--FSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVG  232
            M  S  +++L LT   +I A   G      D+++LPS+++      E E    + D+  G
Sbjct  1    MDFSQFSTILFLTVILTIFAAVSGSRDLPGDYIRLPSQSQASRFFHEPE----NDDNDQG  56

Query  233  TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVII  412
            TRWA+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVII
Sbjct  57   TRWAILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIASNVENPRPGVII  116

Query  413  NNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDH  592
            N P G DVY GVPKDYTG +V  DN  A +LG+KSA+ GGSGKVVDSGPNDHIFVYY+DH
Sbjct  117  NKPDGGDVYEGVPKDYTGAEVHADNFYAALLGNKSALTGGSGKVVDSGPNDHIFVYYTDH  176

Query  593  GGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GGPGVLGMP  PYLYA DLN  LKKKHA+G+
Sbjct  177  GGPGVLGMPVGPYLYASDLNEVLKKKHASGS  207



>ref|NP_001105613.1| LOC542609 precursor [Zea mays]
 gb|AAD04883.1| C13 endopeptidase NP1 precursor [Zea mays]
Length=485

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  227  VGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGV  406
            VGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENIVVFMYDDIA++ ENPR GV
Sbjct  46   VGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIVVFMYDDIAHSPENPRPGV  105

Query  407  IINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYS  586
            IIN+P G DVY GVPKDYTG DV VDN  AV+LG+K+A++GGSGKVVDSGPNDHIFV+YS
Sbjct  106  IINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNKTALRGGSGKVVDSGPNDHIFVFYS  165

Query  587  DHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            DHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  166  DHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  198



>gb|AEY68248.1| legumain [Saccharum hybrid cultivar SP80-3280]
Length=488

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + DD+VGTRWAVL+AGS+GY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA++ EN
Sbjct  44   ETDDAVGTRWAVLVAGSSGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHSAEN  103

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GV+IN+P G DVY GVPKDYTG  V+V+N  AV+LG+K+A+ GGSGKVVDSGPNDHI
Sbjct  104  PRPGVVINHPQGGDVYAGVPKDYTGRQVSVNNFFAVLLGNKTALTGGSGKVVDSGPNDHI  163

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            FV+YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  164  FVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  201



>ref|NP_001241716.1| uncharacterized protein LOC100856894 precursor [Zea mays]
 emb|CAC18099.1| putative legumain [Zea mays]
 gb|ACF88247.1| unknown [Zea mays]
 gb|AFW83035.1| putative uncharacterized protein Precursor [Zea mays]
Length=486

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            DGD  VGTRWAVLIAGS+GY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA++ EN
Sbjct  44   DGD--VGTRWAVLIAGSSGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHSPEN  101

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G DVY GVPKDYTG DV VDN  AV+LG+K+A++GGSGKVVDSGPNDHI
Sbjct  102  PRPGVIINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNKTALRGGSGKVVDSGPNDHI  161

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            FV+YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  162  FVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  199



>gb|KHN37015.1| Vacuolar-processing enzyme [Glycine soja]
Length=474

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +2

Query  212  DGDDSV-GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEE  388
            D DD+  GTRWAVL+AGSNGYWNYRHQAD+CHAYQIL+ GGLK+ENI+VFMYDDIA+N E
Sbjct  30   DNDDNFKGTRWAVLLAGSNGYWNYRHQADVCHAYQILRKGGLKEENIIVFMYDDIAFNGE  89

Query  389  NPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDH  568
            NPR GVIIN P G DVY GVPKDYTG+DVTV N  A +LG+KSA+ GGSGKVVDSGP+DH
Sbjct  90   NPRPGVIINKPDGGDVYEGVPKDYTGEDVTVGNFFAALLGNKSALTGGSGKVVDSGPDDH  149

Query  569  IFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            IFVYY+DHGGPGVLGMP  PYLYADDL   LKKKHA+GT
Sbjct  150  IFVYYTDHGGPGVLGMPAGPYLYADDLIEVLKKKHASGT  188



>gb|AEO79971.1| vacuolar processing enzyme [Arachis diogoi]
Length=487

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 156/202 (77%), Gaps = 15/202 (7%)
 Frame = +2

Query  95   SLLLLTFS-IVAVADGRD-----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIA  256
            +LL   F+  VA A GR       L+LPSEA   F             ++ GT+WAVL+A
Sbjct  8    TLLFFAFTTFVASASGRRDIVGGTLRLPSEAISRFFHE---------PENEGTKWAVLLA  58

Query  257  GSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDV  436
            GSNGYWNYRHQADICHAYQ+L++GG+K+ENI+VFM+DDIAY+EENPR GVIIN P G DV
Sbjct  59   GSNGYWNYRHQADICHAYQLLRSGGVKEENIIVFMFDDIAYSEENPRPGVIINKPDGGDV  118

Query  437  YHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGM  616
            Y GVPKDYTG DV V+N  A +LG+KSA+ GGSGKVVDSGPNDHIFV+YSDHGGPG+LGM
Sbjct  119  YKGVPKDYTGKDVNVNNFFAALLGNKSALTGGSGKVVDSGPNDHIFVFYSDHGGPGILGM  178

Query  617  PTSPYLYADDLNAALKKKHAAG  682
            P  PYLYA+DLN  LKKKHA+G
Sbjct  179  PVGPYLYANDLNEVLKKKHASG  200



>emb|CAC18100.1| putative legumain [Zea mays]
Length=485

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  227  VGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGV  406
            VGTRWAVLIAGSNGY+NYRHQADICHAYQI+K GGLKDENIVVFMYDDIA++ ENPR GV
Sbjct  46   VGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIVVFMYDDIAHSPENPRPGV  105

Query  407  IINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYS  586
            IIN+P G DVY GVPKDYTG +V VDN  AV+LG+K+A++GGSGKVVDSGPNDHIFV+YS
Sbjct  106  IINHPQGGDVYAGVPKDYTGREVNVDNFFAVLLGNKTALRGGSGKVVDSGPNDHIFVFYS  165

Query  587  DHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            DHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  166  DHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  198



>gb|ABF00019.1| legumain precursor [Saccharum officinarum]
Length=488

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + DD+VGTRWAVL+AGS+GY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA++ EN
Sbjct  44   ETDDAVGTRWAVLVAGSSGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHSAEN  103

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GV+IN+P G DVY GVPKDYTG  V+V+N  AV+LG+K+A+ GGSGKVVDSGPNDHI
Sbjct  104  PRPGVVINHPQGGDVYAGVPKDYTGRQVSVNNFFAVLLGNKTALTGGSGKVVDSGPNDHI  163

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            FV+YSDHGGPGVLGMPT PYLY DDL   LKKKHAAG+
Sbjct  164  FVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGS  201



>ref|XP_004960991.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=473

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 149/189 (79%), Gaps = 15/189 (8%)
 Frame = +2

Query  116  SIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQAD  295
            S  A A  +DFL+LPSE                GD + GTRWAVLIAGSNGY+NYRHQAD
Sbjct  24   SAAAGARWQDFLRLPSEG---------------GDAAAGTRWAVLIAGSNGYYNYRHQAD  68

Query  296  ICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDV  475
            +CHAYQI+K GGLKDENI+VFMYDDIA + +NPR GVIIN+P G DVY GVPKDYTG+DV
Sbjct  69   VCHAYQIMKKGGLKDENIIVFMYDDIASSPDNPRPGVIINHPSGGDVYAGVPKDYTGEDV  128

Query  476  TVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNA  655
            TV+N LAV+LG++SAV GGSGKVV SGP DH+FVYYSDHGGPGVLGMP+  YLYA DL  
Sbjct  129  TVNNFLAVLLGNRSAVSGGSGKVVASGPGDHVFVYYSDHGGPGVLGMPSGDYLYAKDLVG  188

Query  656  ALKKKHAAG  682
            AL++KH AG
Sbjct  189  ALERKHDAG  197



>ref|XP_003589032.1| Vacuolar-processing enzyme, partial [Medicago truncatula]
Length=460

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 158/208 (76%), Gaps = 11/208 (5%)
 Frame = +2

Query  83   SVAASLLLLT--FSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            S  +++L LT   +I A   G      D+++LPS+++      E E    + D+  GTRW
Sbjct  4    SQFSTILFLTVILTIFAAVSGSRDLPGDYIRLPSQSQASRFFHEPE----NDDNDQGTRW  59

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            A+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVIIN P
Sbjct  60   AILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIASNVENPRPGVIINKP  119

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
             G DVY GVPKDYTG +V  DN  A +LG+KSA+ GGSGKVVDSGPNDHIFVYY+DHGGP
Sbjct  120  DGGDVYEGVPKDYTGAEVHADNFYAALLGNKSALTGGSGKVVDSGPNDHIFVYYTDHGGP  179

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMP  PYLYA DLN  LKKKHA+G+
Sbjct  180  GVLGMPVGPYLYASDLNEVLKKKHASGS  207



>gb|ACG34144.1| vacuolar processing enzyme precursor [Zea mays]
Length=486

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            D +VGTRWAVLIAGS+GY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA++ ENPR
Sbjct  44   DGAVGTRWAVLIAGSSGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHSPENPR  103

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG DV VDN  AV+LG+K+A++GGSGKVVDSGP+DHIFV
Sbjct  104  PGVIINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNKTALRGGSGKVVDSGPDDHIFV  163

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  164  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  199



>ref|NP_001105119.1| legumain-like protease precursor [Zea mays]
 emb|CAB64544.1| legumain-like protease [Zea mays]
Length=486

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            D +VGTRWAVLIAGS+GY+NYRHQADICHAYQI+K GGLKDENI+VFMYDDIA++ ENPR
Sbjct  44   DGAVGTRWAVLIAGSSGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHSPENPR  103

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG DV VDN  AV+LG+K+A++GGSGKVVDSGP+DHIFV
Sbjct  104  PGVIINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNKTALRGGSGKVVDSGPDDHIFV  163

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  164  FYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  199



>gb|KEH39941.1| vacuolar processing enzyme [Medicago truncatula]
Length=493

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 158/208 (76%), Gaps = 11/208 (5%)
 Frame = +2

Query  83   SVAASLLLLT--FSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            S  +++L LT   +I A   G      D+++LPS+++      E E    + D+  GTRW
Sbjct  4    SQFSTILFLTVILTIFAAVSGSRDLPGDYIRLPSQSQASRFFHEPE----NDDNDQGTRW  59

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            A+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVIIN P
Sbjct  60   AILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIASNVENPRPGVIINKP  119

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
             G DVY GVPKDYTG +V  DN  A +LG+KSA+ GGSGKVVDSGPNDHIFVYY+DHGGP
Sbjct  120  DGGDVYEGVPKDYTGAEVHADNFYAALLGNKSALTGGSGKVVDSGPNDHIFVYYTDHGGP  179

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMP  PYLYA DLN  LKKKHA+G+
Sbjct  180  GVLGMPVGPYLYASDLNEVLKKKHASGS  207



>gb|ACJ84443.1| unknown [Medicago truncatula]
Length=493

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 158/208 (76%), Gaps = 11/208 (5%)
 Frame = +2

Query  83   SVAASLLLLT--FSIVAVADGR-----DFLKLPSearrffrpaeeenreaDGDDSVGTRW  241
            S  +++L LT   +I A   G      D+++LPS+++      E E    + D+  GTRW
Sbjct  4    SQFSTILFLTVILTIFAAVSGSRDLPGDYIRLPSQSQASRFFHEPE----NDDNDQGTRW  59

Query  242  AVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNP  421
            A+L+AGSNGYWNYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA N ENPR GVIIN P
Sbjct  60   AILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIASNVENPRPGVIINKP  119

Query  422  HGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGP  601
             G DVY GVPKDYTG +V  DN  A +LG+KSA+ GGSGKVVDSGPNDHIFVYY+DHGGP
Sbjct  120  DGGDVYEGVPKDYTGAEVHADNFYAALLGNKSALTGGSGKVVDSGPNDHIFVYYTDHGGP  179

Query  602  GVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GVLGMP  PYLYA DLN  LKKKHA+G+
Sbjct  180  GVLGMPVGPYLYASDLNEVLKKKHASGS  207



>ref|NP_001043344.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAA84650.1| asparaginyl endopeptidase [Oryza sativa]
 dbj|BAB85400.1| putative C13 endopeptidase NP1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF05258.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAG90492.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70891.1| hypothetical protein OsI_02429 [Oryza sativa Indica Group]
Length=501

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  233  TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVII  412
            TRWAVLIAGSNGY+NYRHQAD+CHAYQI+K GGLKDENI+VFMYDDIA+N ENPR GVII
Sbjct  64   TRWAVLIAGSNGYYNYRHQADVCHAYQIMKRGGLKDENIIVFMYDDIAHNPENPRPGVII  123

Query  413  NNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDH  592
            N+P G DVY GVPKDYTG +V V NL AV+LG+K+AVKGGSGKV+DSGPNDHIF++YSDH
Sbjct  124  NHPQGGDVYAGVPKDYTGKEVNVKNLFAVLLGNKTAVKGGSGKVLDSGPNDHIFIFYSDH  183

Query  593  GGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  184  GGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  214



>dbj|BAJ95226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + D SVGT+WAVL+AGSNGY NYRHQAD+CHAYQI+K GGLKDENI+VFMYDDIA+N EN
Sbjct  45   ENDGSVGTKWAVLVAGSNGYQNYRHQADVCHAYQIIKKGGLKDENIIVFMYDDIAHNPEN  104

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G DVY GVPKDYTG +V   NL AV+LG+K+AV GGSGKVVDSGPNDHI
Sbjct  105  PRPGVIINHPQGGDVYAGVPKDYTGKEVNAKNLFAVLLGNKTAVSGGSGKVVDSGPNDHI  164

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            FV+YSDHGGPGV+GMPT PY+Y DDL   LKKKHAAGT
Sbjct  165  FVFYSDHGGPGVIGMPTYPYIYGDDLVDVLKKKHAAGT  202



>ref|XP_009795158.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like [Nicotiana 
sylvestris]
Length=174

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 7/180 (4%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            ++R V +++L++  SI+A  DGRD LKLPSEA +FF    +       DDS+GT+WAVL+
Sbjct  2    IVRYVVSAVLIIGLSILAAVDGRDVLKLPSEALKFFSGEYD-------DDSIGTKWAVLV  54

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGS G WNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA+N ENPR GVIIN+P+G D
Sbjct  55   AGSRGCWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAHNPENPRPGVIINSPNGHD  114

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG  VT +N+LAVILG+KSA+ GGSGKVV+SGPNDHIF++YSDHGGPGVLG
Sbjct  115  VYKGVPKDYTGHHVTANNVLAVILGNKSALSGGSGKVVESGPNDHIFIFYSDHGGPGVLG  174



>gb|EEE54813.1| hypothetical protein OsJ_02232 [Oryza sativa Japonica Group]
Length=503

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  233  TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVII  412
            TRWAVLIAGSNGY+NYRHQAD+CHAYQI+K GGLKDENI+VFMYDDIA+N ENPR GVII
Sbjct  66   TRWAVLIAGSNGYYNYRHQADVCHAYQIMKRGGLKDENIIVFMYDDIAHNPENPRPGVII  125

Query  413  NNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDH  592
            N+P G DVY GVPKDYTG +V V NL AV+LG+K+AVKGGSGKV+DSGPNDHIF++YSDH
Sbjct  126  NHPQGGDVYAGVPKDYTGKEVNVKNLFAVLLGNKTAVKGGSGKVLDSGPNDHIFIFYSDH  185

Query  593  GGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GGPGVLGMPT PYLY DDL   LKKKHAAGT
Sbjct  186  GGPGVLGMPTYPYLYGDDLVDVLKKKHAAGT  216



>ref|XP_009420869.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD+VG +WAVLIAGS G++NYRHQADICHAYQI+K GGLKDENI++FMYDDIA + ENPR
Sbjct  36   DDAVGAKWAVLIAGSRGFYNYRHQADICHAYQIMKNGGLKDENIIIFMYDDIAKHVENPR  95

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G+IIN+P G DVY GVPKDY GDDV V+N  AV+LG+++A+ GGSGKVVDSGPNDHIF+
Sbjct  96   PGIIINHPEGGDVYAGVPKDYVGDDVNVNNFFAVLLGNRTALTGGSGKVVDSGPNDHIFI  155

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YSDHGGPGVLGMPT PYLYADDL   LKKKHA+GT
Sbjct  156  FYSDHGGPGVLGMPTFPYLYADDLIDVLKKKHASGT  191



>gb|ABR18199.1| unknown [Picea sitchensis]
Length=493

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            D +GT WAVL+AGS+GYWNYRHQAD+CHAYQIL+ GGLK+ENIVVFMYDDIAY+EENP  
Sbjct  49   DRIGTEWAVLLAGSSGYWNYRHQADVCHAYQILRRGGLKEENIVVFMYDDIAYDEENPHP  108

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            G IIN+P G DVY GVPKDYTG+DVTV+N  A ILG+KS V GGSGKVV+SGPND IF+Y
Sbjct  109  GTIINHPQGSDVYAGVPKDYTGEDVTVNNFFAAILGNKSLVTGGSGKVVESGPNDRIFIY  168

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YSDHGGPGVLGMP  PYLYA+D    LKKKH AG+
Sbjct  169  YSDHGGPGVLGMPLPPYLYANDFVQVLKKKHDAGS  203



>ref|XP_001759301.1| predicted protein [Physcomitrella patens]
 gb|EDQ75985.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            G RWAVL+AGS+GY NYRHQAD+CHAYQILK GG+KDENIVVFM+DDIA+N  NPR GVI
Sbjct  47   GQRWAVLVAGSSGYGNYRHQADVCHAYQILKKGGMKDENIVVFMFDDIAHNRHNPRPGVI  106

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            +N+P+GEDVYHGVPKDYTG +VTV+NLLAV+LGDK  +KGGSGKVV+SGPNDHIF+YYSD
Sbjct  107  LNHPNGEDVYHGVPKDYTGKNVTVNNLLAVLLGDKKTLKGGSGKVVNSGPNDHIFIYYSD  166

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HGGPGVLGMPT+P LYADDL    KK H A T
Sbjct  167  HGGPGVLGMPTNPNLYADDLLKTFKKMHEAKT  198



>ref|XP_008654306.1| PREDICTED: uncharacterized protein LOC100192667 isoform X1 [Zea 
mays]
 gb|ACF84283.1| unknown [Zea mays]
Length=467

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 148/203 (73%), Gaps = 19/203 (9%)
 Frame = +2

Query  80   RSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAG  259
            R + A  LL+  + VA    +DFL+LPSE                  +SVGTRWAVLIAG
Sbjct  5    RLLFAVQLLVLIAAVAGTRWQDFLRLPSE-----------------SESVGTRWAVLIAG  47

Query  260  SNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVY  439
            SNGY+NYRHQAD+CHAYQ+LK GGLKDENIVVFMYDDIA + +NPR GVIIN+P G DVY
Sbjct  48   SNGYYNYRHQADVCHAYQVLKKGGLKDENIVVFMYDDIADSPDNPRPGVIINHPSGGDVY  107

Query  440  HGVPKDYTGDDVTVDNLLAVIL-gdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGM  616
             GVPKDYTG DV  +N LA +L    +   GGSGKVV SGP DH+FVYYSDHGGPGVLGM
Sbjct  108  AGVPKDYTGKDVNANNFLAALLGNRSAVTGGGSGKVVASGPADHVFVYYSDHGGPGVLGM  167

Query  617  PTS-PYLYADDLNAALKKKHAAG  682
            P+S  YLYA DL  AL+KKHAAG
Sbjct  168  PSSDDYLYAKDLVDALRKKHAAG  190



>gb|AAK15049.1|AF238384_1 asparaginyl endopeptidase [Vigna radiata]
Length=483

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 148/194 (76%), Gaps = 17/194 (9%)
 Frame = +2

Query  116  SIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYR  283
            ++  VA GRD    FL+LPS++              + D+  GTRWA+L AGSNGYWNYR
Sbjct  18   TVALVAAGRDLVGDFLRLPSDSG-------------NDDNVKGTRWAILFAGSNGYWNYR  64

Query  284  HQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYT  463
            HQADICHAYQIL+ GGLK+ENI+VFMYDDIA+N +NPR GVIIN P G+DVY GVPKDYT
Sbjct  65   HQADICHAYQILRKGGLKEENIIVFMYDDIAFNWDNPRPGVIINKPDGDDVYEGVPKDYT  124

Query  464  GDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYAD  643
            G+D T  N  + +LGDKSA+ GGSGKVV+SGP+D IF++YSDHGGPGVLG P  PY+YA 
Sbjct  125  GEDATAHNFYSALLGDKSALTGGSGKVVNSGPDDRIFIFYSDHGGPGVLGTPAGPYIYAS  184

Query  644  DLNAALKKKHAAGT  685
            DL   LKKKHA+GT
Sbjct  185  DLVEVLKKKHASGT  198



>gb|AIB06797.1| cte peptide ligase [Clitoria ternatea]
Length=482

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 150/201 (75%), Gaps = 14/201 (7%)
 Frame = +2

Query  95   SLLLLTFSIVAVADG--RDFLKLPSearrffrpaeeenreaDGDDSV-GTRWAVLIAGSN  265
            ++L L  ++VAV  G   DFL+LPS+A +FF            DD+V GTRWAVL+AGS 
Sbjct  6    AILFLIATVVAVVSGIRDDFLRLPSQASKFF----------QADDNVEGTRWAVLVAGSK  55

Query  266  GYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHG  445
            GY NYRHQAD+CHAYQILK GGLKDENI+VFMYDDIAYNE NP  GVIIN+P+G DVY G
Sbjct  56   GYVNYRHQADVCHAYQILKKGGLKDENIIVFMYDDIAYNESNPHPGVIINHPYGSDVYKG  115

Query  446  VPKDYTGDDVTVDNLLAVILgdksavkggsgkvvd-sgPNDHIFVYYSDHGGPGVLGMPT  622
            VPKDY G+D+   N  AV+L +KSA+ G     V  SGPNDH+F+YY+DHGG GVLGMP+
Sbjct  116  VPKDYVGEDINPPNFYAVLLANKSALTGTGSGKVLDSGPNDHVFIYYTDHGGAGVLGMPS  175

Query  623  SPYLYADDLNAALKKKHAAGT  685
             PY+ A DLN  LKKKHA+GT
Sbjct  176  KPYIAASDLNDVLKKKHASGT  196



>ref|XP_002448237.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
 gb|EES12565.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
Length=493

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + DD VGTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GG+K+ENIVVFMYDDIA+N  N
Sbjct  51   EEDDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGVKEENIVVFMYDDIAHNILN  110

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GE+VY+GVPKDYTGD VT +N  AV+LG+KSA+ GGS KV+DS PNDHI
Sbjct  111  PRPGVIINHPKGENVYNGVPKDYTGDQVTTENFFAVLLGNKSAITGGSKKVIDSKPNDHI  170

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  PYLYA D    LKKKHA  +
Sbjct  171  FIYYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHACNS  208



>gb|KJB54730.1| hypothetical protein B456_009G046800 [Gossypium raimondii]
Length=465

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            G+RWAVLIAGS GY NYRHQAD+CHAYQ+L+  GLKDENIVVFMYDDIAYNE NPR G+I
Sbjct  51   GSRWAVLIAGSRGYENYRHQADVCHAYQLLRKCGLKDENIVVFMYDDIAYNENNPRPGII  110

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            IN+P+G DVYHGVPKDYTGDDVTV+N   VILG+K+A+ GGSGKVV+SGPNDHIF++YSD
Sbjct  111  INSPNGSDVYHGVPKDYTGDDVTVNNFFNVILGNKAAITGGSGKVVNSGPNDHIFIFYSD  170

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HG  GVLGMP   Y+YA+DLN  L+KKHA+GT
Sbjct  171  HGASGVLGMPDDSYIYANDLNWVLRKKHASGT  202



>ref|NP_001236678.1| vacuolar-processing enzyme precursor [Glycine max]
 sp|P49045.1|VPE_SOYBN RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Glycine max]
 dbj|BAA06030.1| cysteine proteinase [Glycine max]
Length=495

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
             D VGTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GGLK+ENIVVFMYDDIA NE NPR
Sbjct  54   SDEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEENIVVFMYDDIATNELNPR  113

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P GED+Y GVPKDYTGD+VT +NL AVILGDKS +KGGSGKV++S P D IF+
Sbjct  114  HGVIINHPEGEDLYAGVPKDYTGDNVTTENLFAVILGDKSKLKGGSGKVINSKPEDRIFI  173

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPG+LGMP  PYLYA D    LKKKHA+G+
Sbjct  174  YYSDHGGPGILGMPNMPYLYAMDFIDVLKKKHASGS  209



>gb|KHN09785.1| Vacuolar-processing enzyme [Glycine soja]
Length=495

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
             D VGTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GGLK+ENIVVFMYDDIA NE NPR
Sbjct  54   SDEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEENIVVFMYDDIATNELNPR  113

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P GED+Y GVPKDYTGD+VT +NL AVILGDKS +KGGSGKV++S P D IF+
Sbjct  114  HGVIINHPEGEDLYAGVPKDYTGDNVTTENLFAVILGDKSKLKGGSGKVINSKPEDRIFI  173

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPG+LGMP  PYLYA D    LKKKHA+G+
Sbjct  174  YYSDHGGPGILGMPNMPYLYAMDFIDVLKKKHASGS  209



>ref|XP_001755207.1| predicted protein [Physcomitrella patens]
 gb|EDQ80151.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + D   GTRWA+LIAGS+GYWNYRHQAD+CHAYQILK GGLK+ENIVVFMYDDIAY+ EN
Sbjct  4    EEDAEKGTRWAILIAGSSGYWNYRHQADVCHAYQILKRGGLKEENIVVFMYDDIAYSTEN  63

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            P  G IIN P G DVY GVPKDYTG DVTV N  A +LGDK A+KGGSGKVV+SGPNDHI
Sbjct  64   PHPGKIINKPDGPDVYQGVPKDYTGADVTVSNFYAALLGDKDAIKGGSGKVVNSGPNDHI  123

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YY+DHGG GVLGMPTSP LYADD    LKKK AAGT
Sbjct  124  FIYYTDHGGAGVLGMPTSPNLYADDFVDTLKKKAAAGT  161



>gb|AET08888.1| vacuolar processing enzyme 1 [Triticum monococcum]
 emb|CCC14975.1| VPE2A protein [Triticum urartu]
Length=491

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            +G+D VGTRWAVL+AGS+GY NYRHQADICHAYQIL+ GG+K+ENIVVFMYDDIA N  N
Sbjct  49   EGEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILRKGGVKEENIVVFMYDDIANNPLN  108

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG++VT  N  AV+LG+K+AV GGS KV+DS PNDHI
Sbjct  109  PRPGVIINHPEGEDVYAGVPKDYTGEEVTAKNFYAVLLGNKTAVTGGSKKVIDSKPNDHI  168

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  PYLYA D    L++KHA+ T
Sbjct  169  FIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKHASNT  206



>ref|NP_001291333.1| vacuolar-processing enzyme precursor [Sesamum indicum]
 gb|AAF89679.1| asparaginyl endopeptidase [Sesamum indicum]
Length=489

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
             TRWAVL+AGSNG+ NYRHQAD+CHAYQILK GGL+DENI+VFMYDDIA NE NPRKGVI
Sbjct  52   ATRWAVLVAGSNGFGNYRHQADVCHAYQILKKGGLRDENIIVFMYDDIAMNELNPRKGVI  111

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            IN+P G DVY GVPKDYTG+ VT +NL AVILGDKSA+KGGSGKVVDS PND IF+YYSD
Sbjct  112  INHPTGGDVYAGVPKDYTGEQVTAENLYAVILGDKSAIKGGSGKVVDSKPNDRIFIYYSD  171

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HGGPGVLGMP  PYLYA+D    LKKKHA+GT
Sbjct  172  HGGPGVLGMPNMPYLYANDFIEVLKKKHASGT  203



>gb|KCW53995.1| hypothetical protein EUGRSUZ_J03190 [Eucalyptus grandis]
Length=418

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 15/195 (8%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR-DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYW  274
            LLL  F++ AV++ R  F ++ S++                D S GT+WAVL+AGSNGY+
Sbjct  14   LLLTAFAMAAVSESRRSFQEIASQSG--------------ADASTGTQWAVLVAGSNGYY  59

Query  275  NYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPK  454
            NYRHQAD+CHAYQILKA GLKDENI+VFMYDDIA NE+NP KG+IIN P+G DVYHGVPK
Sbjct  60   NYRHQADVCHAYQILKANGLKDENIIVFMYDDIAENEQNPTKGIIINKPNGSDVYHGVPK  119

Query  455  DYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYL  634
            DYTGD+ T  NL AV+LG+K+A+ GGSGKV+ SGPNDH+F YY+DHG PG++ MP   Y+
Sbjct  120  DYTGDETTAANLYAVLLGNKTALSGGSGKVLSSGPNDHVFFYYTDHGSPGLVAMPVGDYI  179

Query  635  YADDLNAALKKKHAA  679
            YA+DL   LK+ + A
Sbjct  180  YANDLMNVLKQMYKA  194



>dbj|BAA76745.1| asparaginyl endopeptidase (VmPE-1A) [Vigna mungo]
Length=482

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 141/181 (78%), Gaps = 13/181 (7%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            DFL+LPS++              + D+  GTRWA+L AGSNGYWNYRHQADICHAYQIL+
Sbjct  30   DFLRLPSDSG-------------NDDNVQGTRWAILFAGSNGYWNYRHQADICHAYQILR  76

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLK+ENI+VFMYDDIA+N +NPR GVIIN P G+DVY GVPKDYTG+D T  N  + +
Sbjct  77   KGGLKEENIIVFMYDDIAFNWDNPRPGVIINKPDGDDVYEGVPKDYTGEDATAHNFYSAL  136

Query  503  LgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            LGDKSA+ GGSGKVV SGP+D IF++YSDHGGPGVLG P  PY+YA DL   LKKKHA+G
Sbjct  137  LGDKSALTGGSGKVVSSGPDDRIFIFYSDHGGPGVLGTPAGPYIYASDLVEVLKKKHASG  196

Query  683  T  685
            T
Sbjct  197  T  197



>gb|KCW53994.1| hypothetical protein EUGRSUZ_J03190 [Eucalyptus grandis]
Length=423

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 15/195 (8%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR-DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYW  274
            LLL  F++ AV++ R  F ++ S++                D S GT+WAVL+AGSNGY+
Sbjct  14   LLLTAFAMAAVSESRRSFQEIASQSG--------------ADASTGTQWAVLVAGSNGYY  59

Query  275  NYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPK  454
            NYRHQAD+CHAYQILKA GLKDENI+VFMYDDIA NE+NP KG+IIN P+G DVYHGVPK
Sbjct  60   NYRHQADVCHAYQILKANGLKDENIIVFMYDDIAENEQNPTKGIIINKPNGSDVYHGVPK  119

Query  455  DYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYL  634
            DYTGD+ T  NL AV+LG+K+A+ GGSGKV+ SGPNDH+F YY+DHG PG++ MP   Y+
Sbjct  120  DYTGDETTAANLYAVLLGNKTALSGGSGKVLSSGPNDHVFFYYTDHGSPGLVAMPVGDYI  179

Query  635  YADDLNAALKKKHAA  679
            YA+DL   LK+ + A
Sbjct  180  YANDLMNVLKQMYKA  194



>gb|KCW53993.1| hypothetical protein EUGRSUZ_J03190 [Eucalyptus grandis]
Length=460

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 15/195 (8%)
 Frame = +2

Query  98   LLLLTFSIVAVADGR-DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYW  274
            LLL  F++ AV++ R  F ++ S++                D S GT+WAVL+AGSNGY+
Sbjct  14   LLLTAFAMAAVSESRRSFQEIASQSG--------------ADASTGTQWAVLVAGSNGYY  59

Query  275  NYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPK  454
            NYRHQAD+CHAYQILKA GLKDENI+VFMYDDIA NE+NP KG+IIN P+G DVYHGVPK
Sbjct  60   NYRHQADVCHAYQILKANGLKDENIIVFMYDDIAENEQNPTKGIIINKPNGSDVYHGVPK  119

Query  455  DYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYL  634
            DYTGD+ T  NL AV+LG+K+A+ GGSGKV+ SGPNDH+F YY+DHG PG++ MP   Y+
Sbjct  120  DYTGDETTAANLYAVLLGNKTALSGGSGKVLSSGPNDHVFFYYTDHGSPGLVAMPVGDYI  179

Query  635  YADDLNAALKKKHAA  679
            YA+DL   LK+ + A
Sbjct  180  YANDLMNVLKQMYKA  194



>ref|XP_001769381.1| predicted protein [Physcomitrella patens]
 gb|EDQ65750.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            GTRWA+LIAGS GYWNYRHQAD+CHAYQILK GGLKDENI+VFM+DDIAY+ ENP  G I
Sbjct  12   GTRWAILIAGSAGYWNYRHQADVCHAYQILKRGGLKDENIIVFMHDDIAYHPENPYPGTI  71

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            IN P G DVY GVPKDYTG DVTV NL A ILGDKSA++GG+GKVVDSGPNDHIF+YYSD
Sbjct  72   INKPDGPDVYQGVPKDYTGSDVTVSNLYAAILGDKSAIEGGTGKVVDSGPNDHIFIYYSD  131

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HGGPGVLGMP  P LYADD    LKKK AAGT
Sbjct  132  HGGPGVLGMPNPPNLYADDFVGILKKKAAAGT  163



>ref|XP_002509577.1| Vacuolar-processing enzyme precursor [Ricinus communis]
 sp|P49042.1|VPE_RICCO RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Ricinus communis]
 dbj|BAA04225.1| precursor of vacuolar processing enzyme [Ricinus communis]
 gb|EEF50964.1| Vacuolar-processing enzyme precursor [Ricinus communis]
Length=497

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D DD +GTRWAVL+AGS G+ NYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA NE N
Sbjct  54   DDDDQLGTRWAVLVAGSMGFGNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAKNELN  113

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG+ VT  NL AV+LGDKSAV+GGSGKVVDS PND I
Sbjct  114  PRPGVIINHPQGEDVYAGVPKDYTGEHVTAKNLYAVLLGDKSAVQGGSGKVVDSKPNDRI  173

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            F+YYSDHGGPGVLGMP  PYLYA D    LKKKHAAG
Sbjct  174  FLYYSDHGGPGVLGMPNLPYLYAMDFIEVLKKKHAAG  210



>ref|XP_009783281.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
Length=467

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 148/204 (73%), Gaps = 22/204 (11%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            MIR V   + L+  SI A  +GR   +  +                  ++S GT+WAVL+
Sbjct  1    MIRYV---VFLVLLSIWASVEGRSINRFLT------------------EESTGTKWAVLV  39

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNG+WNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA N ENPR GV+INNPHG+D
Sbjct  40   AGSNGWWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIANNSENPRPGVLINNPHGQD  99

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY G+PKDY G+DV  DN   VIL +KS +  GSGK++DSGPND+IF+YY+DHGGPG++ 
Sbjct  100  VYQGIPKDYVGEDVNADNFFNVILANKSGITRGSGKILDSGPNDNIFIYYTDHGGPGIVS  159

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT   +YA+DL   L+KKHA+GT
Sbjct  160  MPTG-IVYANDLINVLEKKHASGT  182



>gb|AET08895.1| vacuolar processing enzyme 2 [Aegilops tauschii]
 emb|CCC14981.1| VPE2D protein [Aegilops tauschii]
Length=489

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            +G+D VGTRWAVL+AGS+GY NYRHQADICHAYQIL+ GG+K+ENIVVFMYDDIA N  N
Sbjct  47   EGEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILRKGGVKEENIVVFMYDDIANNPLN  106

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG+ VT  N  AV+LG+K+AV GGS KV+DS PNDHI
Sbjct  107  PRPGVIINHPEGEDVYAGVPKDYTGEAVTAKNFYAVLLGNKTAVTGGSKKVIDSKPNDHI  166

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  PYLYA D    L++KHA+ T
Sbjct  167  FIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKHASNT  204



>ref|XP_010034097.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like [Eucalyptus 
grandis]
Length=495

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 157/225 (70%), Gaps = 22/225 (10%)
 Frame = +2

Query  11   FNIIPSSLHSQIS*KISTVLTMIRSVAASLLLLT-FSIVAVADGR-DFLKLPSearrffr  184
             N+IP  L       I  + T  R      LLLT F++ AV++ R  F ++ S++     
Sbjct  25   LNLIPIQL------SIVMMTTSSRGSLVPFLLLTAFAMAAVSESRRSFQEIASQSG----  74

Query  185  paeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMY  364
                       D S GT+WAVL+AGSNGY+NYRHQAD+CHAYQILKA GLKDENI+VFMY
Sbjct  75   ----------ADASTGTQWAVLVAGSNGYYNYRHQADVCHAYQILKANGLKDENIIVFMY  124

Query  365  DDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkv  544
            DDIA NE+NP KG+IIN P+G DVYHGVPKDYTGD+ T  NL AV+LG+K+A+ GGSGKV
Sbjct  125  DDIAENEQNPTKGIIINKPNGSDVYHGVPKDYTGDETTAANLYAVLLGNKTALSGGSGKV  184

Query  545  vdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            + SGPNDH+F YY+DHG PG++ MP   Y+YA+DL   LK+ + A
Sbjct  185  LSSGPNDHVFFYYTDHGSPGLVAMPVGDYIYANDLMNVLKQMYKA  229



>ref|XP_006579475.1| PREDICTED: seed maturation protein PM40 isoform X1 [Glycine max]
 gb|KHN04332.1| Vacuolar-processing enzyme [Glycine soja]
Length=495

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D D  VGTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GGLK+ENIVVFMYDDIA +E N
Sbjct  52   DSDHEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEENIVVFMYDDIATDELN  111

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G+DVY GVPKDYTG++VT  NL AVILGDK+ VKGGSGKV++S P D I
Sbjct  112  PRPGVIINHPEGQDVYAGVPKDYTGENVTAQNLFAVILGDKNKVKGGSGKVINSKPEDRI  171

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            F+YYSDHGGPGVLGMP  PYLYA D    LKKKHA+G
Sbjct  172  FIYYSDHGGPGVLGMPNMPYLYAMDFIEVLKKKHASG  208



>gb|AET08892.1| vacuolar processing enzyme 2 [Aegilops speltoides]
 emb|CCC14970.1| VPE2B protein [Aegilops speltoides]
Length=491

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            +G+D VGTRWAVL+AGS+GY NYRHQADICHAYQIL+ GG+K+ENIVVFMYDDIA N  N
Sbjct  49   EGEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILRKGGVKEENIVVFMYDDIANNPLN  108

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG+ VT  N  AV+LG+ +AV GGS KV+DS PNDHI
Sbjct  109  PRPGVIINHPEGEDVYAGVPKDYTGEAVTAKNFYAVLLGNNTAVTGGSKKVIDSKPNDHI  168

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  PYLYA D    L++KHA+ T
Sbjct  169  FIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKHASNT  206



>emb|CAB42651.2| putative preprolegumain [Nicotiana tabacum]
Length=494

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + +D  G RWAVL+AGSNGY NYRHQAD+CHAYQILK GGLKDENIVVFMYDDIA +E N
Sbjct  52   ESEDKDGVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAKSELN  111

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P+G DVY GVPKDYTG+ VT  NL AV+LGDKSAVKGGSGK+VDS PND I
Sbjct  112  PRPGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAVKGGSGKIVDSKPNDRI  171

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  P+LYA D    LKKKHAAGT
Sbjct  172  FLYYSDHGGPGVLGMPNMPFLYAKDFIEVLKKKHAAGT  209



>ref|NP_001238297.1| seed maturation protein PM40 precursor [Glycine max]
 gb|AAF89646.1|AF169019_1 seed maturation protein PM40 [Glycine max]
Length=496

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D D  VGTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GGLK+ENIVVFMYDDIA +E N
Sbjct  52   DSDHEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEENIVVFMYDDIATDELN  111

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G+DVY GVPKDYTG++VT  NL AVILGDK+ VKGGSGKV++S P D I
Sbjct  112  PRPGVIINHPEGQDVYAGVPKDYTGENVTAQNLFAVILGDKNKVKGGSGKVINSKPEDRI  171

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            F+YYSDHGGPGVLGMP  PYLYA D    LKKKHA+G
Sbjct  172  FIYYSDHGGPGVLGMPNMPYLYAMDFIEVLKKKHASG  208



>ref|XP_006355318.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=461

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D + S+GT+WAVL+AGS+ ++NYRHQADICHAYQ+LK GGLKDE+I+VFMYDDIAYN EN
Sbjct  31   DHEHSIGTQWAVLVAGSSDWYNYRHQADICHAYQLLKKGGLKDEHIIVFMYDDIAYNSEN  90

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR+GVIINNPHG+DVY GVPKDYTG      N   VILG+KSA+ GGSGKVV+SGPNDHI
Sbjct  91   PRRGVIINNPHGQDVYKGVPKDYTGKYCNAQNFYGVILGNKSALTGGSGKVVNSGPNDHI  150

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YY+DHGGPGV+ MP  P +YA DLN  LKKKHA+ T
Sbjct  151  FIYYADHGGPGVIDMPIEPSIYAKDLNEVLKKKHASRT  188



>gb|EPS73966.1| asparaginyl endopeptidase [Genlisea aurea]
Length=471

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            GTRWAVL+AGSNG+ NYRHQAD+CHAYQILK GGLK+ENIVVFMYDDIA +E NPRKG I
Sbjct  44   GTRWAVLVAGSNGFGNYRHQADVCHAYQILKRGGLKEENIVVFMYDDIADSEMNPRKGTI  103

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            IN+P+G DVY GVPKDYTG++VT  N  AVI G+K+ VKGGSGKVVDS PNDH+F+YYSD
Sbjct  104  INHPNGRDVYEGVPKDYTGENVTAANFYAVIQGNKTGVKGGSGKVVDSKPNDHVFIYYSD  163

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HGGPGVLGMP  P++Y  DL  ALKKKHA+GT
Sbjct  164  HGGPGVLGMPVMPFVYGKDLIEALKKKHASGT  195



>ref|XP_009592399.1| PREDICTED: vacuolar-processing enzyme [Nicotiana tomentosiformis]
Length=494

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + +D  G RWAVL+AGSNGY NYRHQAD+CHAYQILK GGLKDENIVVFMYDDIA +E N
Sbjct  52   ESEDKDGVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAKSELN  111

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P+G DVY GVPKDYTG+ VT  NL AV+LGDKSAVKGGSGK+VDS PND I
Sbjct  112  PRPGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAVKGGSGKIVDSKPNDRI  171

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  P+LYA D    LKKKHAAGT
Sbjct  172  FLYYSDHGGPGVLGMPNMPFLYAKDFIEVLKKKHAAGT  209



>gb|KDP25622.1| hypothetical protein JCGZ_20778 [Jatropha curcas]
Length=495

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD +GTRWAVL+AGS GY NYRHQAD+CHAYQ+L+ GG+K+ENI+VFMYDDIA+++ NPR
Sbjct  54   DDQIGTRWAVLVAGSRGYGNYRHQADVCHAYQLLRKGGIKEENIIVFMYDDIAHHQLNPR  113

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
            KGVIIN+P GEDVY GVPKDYTG+ VT  NL AV+LGDKSA+ GGSGKVV+S  ND IFV
Sbjct  114  KGVIINHPQGEDVYAGVPKDYTGEHVTAKNLYAVLLGDKSALSGGSGKVVNSTANDRIFV  173

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  P+LYA D    LKKKHAAG+
Sbjct  174  YYSDHGGPGVLGMPNLPFLYAMDFIEVLKKKHAAGS  209



>ref|NP_001152500.1| LOC100286140 [Zea mays]
 gb|ACG47915.1| vacuolar processing enzyme, beta-isozyme precursor [Zea mays]
 tpg|DAA36670.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=457

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD VGTRWAVL+AGS GY NYRHQAD+CHAYQIL+ GG+K ENIVVFMYDDIA+N  NPR
Sbjct  17   DDEVGTRWAVLVAGSFGYGNYRHQADVCHAYQILQKGGVKKENIVVFMYDDIAHNILNPR  76

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G +VY GVPKDYTGD VT +N  AV+LG++SA  GGS KV+DS PNDHIF+
Sbjct  77   PGVIINHPKGANVYDGVPKDYTGDQVTTENFFAVLLGNRSATTGGSKKVIDSKPNDHIFI  136

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  PYLYA D    LKKKHA+ +
Sbjct  137  YYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHASNS  172



>gb|KHG24041.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=496

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +  VGTRWAVL+AGS+GY NYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIA NE NPR
Sbjct  55   EQQVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIAMNELNPR  114

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G+DVY GVPKDYTG+ VT  NL AV+LG+K A+ GGSGKV+DS PND IF+
Sbjct  115  PGVIINHPQGDDVYAGVPKDYTGEHVTAANLYAVLLGNKDALSGGSGKVIDSKPNDRIFI  174

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  P+LYA D    LKKKHAAGT
Sbjct  175  YYSDHGGPGVLGMPNMPFLYAMDFLDVLKKKHAAGT  210



>ref|XP_006355332.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=460

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +++VGT+WAVL+AGSNG++NYRHQAD+CHAYQILK GGLKDENI+VFMYDDIA N  NPR
Sbjct  32   EETVGTKWAVLVAGSNGWFNYRHQADVCHAYQILKKGGLKDENIIVFMYDDIANNTMNPR  91

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIINNPHG+DVY GVPKDY G+DV  +N   VIL +KS + GGSGKV++SGPNDHIF+
Sbjct  92   PGVIINNPHGQDVYKGVPKDYVGEDVNAENFFNVILANKSGITGGSGKVLNSGPNDHIFI  151

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPG++ MPT   +YA+DL   LKKKHA+GT
Sbjct  152  YYTDHGGPGIISMPTG-LVYANDLINVLKKKHASGT  186



>ref|XP_004976374.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=492

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +D VGTRWAVL+AGS+GY NYRHQAD+CHAYQIL  GG+K+ENIVVFMYDDIA+N  NPR
Sbjct  52   EDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQILLKGGVKEENIVVFMYDDIAHNILNPR  111

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P GE+VY GVPKDYTGD VT +N  AV+LG++SA+ GGS KV+DS PNDHIF+
Sbjct  112  PGVIINHPKGENVYPGVPKDYTGDQVTTENFFAVLLGNRSAITGGSKKVIDSKPNDHIFI  171

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  PYLYA D    LKKKHA+ +
Sbjct  172  YYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHASNS  207



>ref|NP_001105183.1| vacuolar processing enzyme1 precursor [Zea mays]
 gb|AAL58571.1| vacuolar processing enzyme 1 [Zea mays]
Length=494

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD+VGTRWAVL+AGS+GY NYRHQADICHAYQIL+ GG+K+ENIVVFMYDDIA +  NPR
Sbjct  54   DDAVGTRWAVLVAGSSGYGNYRHQADICHAYQILQKGGIKEENIVVFMYDDIANSALNPR  113

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
            +GVIIN+P GEDVY GVPKDYTGD VT  N  AV+LG+K+AV GGS KV++S P+DHIF+
Sbjct  114  QGVIINHPEGEDVYAGVPKDYTGDQVTTKNFYAVLLGNKTAVTGGSRKVINSKPDDHIFI  173

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  PYLYA D    L++KHA+ +
Sbjct  174  YYSDHGGPGVLGMPNLPYLYAGDFMKVLREKHASNS  209



>ref|XP_009771365.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Nicotiana 
sylvestris]
Length=493

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +DS   RWAVL+AGSNGY NYRHQAD+CHAYQILK GGLKDENIVVFMYDDIA +E NPR
Sbjct  53   EDSNSVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAKSELNPR  112

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P+G DVY GVPKDYTG+ VT  NL AV+LGDKSAVKGGSGKVVDS PND IF+
Sbjct  113  PGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAVKGGSGKVVDSKPNDRIFL  172

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  P+LYA D    LKKKHAAGT
Sbjct  173  YYSDHGGPGVLGMPNMPFLYAKDFIEVLKKKHAAGT  208



>gb|ABK25457.1| unknown [Picea sitchensis]
Length=453

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            D+++GT+WAVL+AGS GY NYRHQAD+CHAYQILK GGLKDENIVVFMYDDIA N  NPR
Sbjct  42   DENIGTQWAVLLAGSAGYSNYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNPVNPR  101

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G+IIN+P G DVY GVPKDYTG +VTVDN  AVILGDK +VKGGSGKVVDSGPNDHIF+
Sbjct  102  PGIIINHPEGSDVYAGVPKDYTGKEVTVDNFFAVILGDKDSVKGGSGKVVDSGPNDHIFI  161

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPGVLGMP+   LYA DL   LKKKHAA T
Sbjct  162  YYTDHGGPGVLGMPSGHMLYAKDLVDVLKKKHAADT  197



>dbj|BAC41386.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAC41387.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAD25787.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 gb|EAY86869.1| hypothetical protein OsI_08253 [Oryza sativa Indica Group]
 gb|EAZ23976.1| hypothetical protein OsJ_07703 [Oryza sativa Japonica Group]
Length=496

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            D VGTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVVFMYDDIA N  NPR 
Sbjct  57   DGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVFMYDDIANNILNPRP  116

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            GVI+N+P GEDVY GVPKDYTGD+VT  N  AV+LG+K+AV GGS KV+DS PNDHIF++
Sbjct  117  GVIVNHPQGEDVYAGVPKDYTGDEVTAKNFYAVLLGNKTAVTGGSRKVIDSKPNDHIFIF  176

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YSDHGGPGVLGMP  PYLYA D    L++KHA+ T
Sbjct  177  YSDHGGPGVLGMPNLPYLYAADFMKVLQEKHASNT  211



>ref|XP_004147613.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 ref|XP_004162670.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 gb|KGN50214.1| hypothetical protein Csa_5G160170 [Cucumis sativus]
Length=490

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  215  GDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENP  394
            GD  VGTRWAVLIAGS+G+ NYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA N  NP
Sbjct  47   GDRKVGTRWAVLIAGSSGFGNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIATNVLNP  106

Query  395  RKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIF  574
            R G+IIN+P GEDVY GVPKDYTG+ VT  NL AV+LG+++AV GGSGKVVDS PND IF
Sbjct  107  RPGIIINHPQGEDVYAGVPKDYTGEHVTAQNLYAVLLGNRTAVDGGSGKVVDSKPNDRIF  166

Query  575  VYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            VYYSDHGGPGVLGMP  P++YA D    LKKKHAA
Sbjct  167  VYYSDHGGPGVLGMPNLPFVYAMDFIEVLKKKHAA  201



>sp|P49046.1|LEGU_CANEN RecName: Full=Legumain; AltName: Full=Asparaginyl endopeptidase; 
Flags: Precursor [Canavalia ensiformis]
 dbj|BAA06596.1| asparaginyl endopeptidase [Canavalia ensiformis]
Length=475

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD VGTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GG+K+ENIVVFMYDDIAYN  NPR
Sbjct  34   DDEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGVKEENIVVFMYDDIAYNAMNPR  93

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G DVY GVPKDYTG+DVT +NL AVILGDKS VKGGSGKV++S P D IF+
Sbjct  94   PGVIINHPQGPDVYAGVPKDYTGEDVTPENLYAVILGDKSKVKGGSGKVINSNPEDRIFI  153

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            +YSDHGGPGVLGMP +P++YA D    LKKKHA+G
Sbjct  154  FYSDHGGPGVLGMPNAPFVYAMDFIDVLKKKHASG  188



>ref|XP_002304429.2| hypothetical protein POPTR_0003s11280g [Populus trichocarpa]
 gb|EEE79408.2| hypothetical protein POPTR_0003s11280g [Populus trichocarpa]
Length=495

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D    +GTRWAVL+AGSNGY NYRHQAD+CHAYQ+L+ GG+K+ENIVVFMYDDIA +E N
Sbjct  52   DDGKEIGTRWAVLVAGSNGYGNYRHQADVCHAYQLLRKGGIKEENIVVFMYDDIAKHEFN  111

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G+DVY GVPKDYTG  VT +NL AV+LG+KSAVKGGSGKVVDS PND I
Sbjct  112  PRPGVIINHPQGDDVYAGVPKDYTGVQVTTENLYAVLLGNKSAVKGGSGKVVDSMPNDRI  171

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMPT P+LYA D    LKKKHA+G+
Sbjct  172  FLYYSDHGGPGVLGMPTMPFLYAMDFIEVLKKKHASGS  209



>ref|XP_008668185.1| PREDICTED: LOC100286140 isoform X1 [Zea mays]
 tpg|DAA36669.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=493

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD VGTRWAVL+AGS GY NYRHQAD+CHAYQIL+ GG+K ENIVVFMYDDIA+N  NPR
Sbjct  53   DDEVGTRWAVLVAGSFGYGNYRHQADVCHAYQILQKGGVKKENIVVFMYDDIAHNILNPR  112

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G +VY GVPKDYTGD VT +N  AV+LG++SA  GGS KV+DS PNDHIF+
Sbjct  113  PGVIINHPKGANVYDGVPKDYTGDQVTTENFFAVLLGNRSATTGGSKKVIDSKPNDHIFI  172

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  PYLYA D    LKKKHA+ +
Sbjct  173  YYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHASNS  208



>ref|XP_006302155.1| hypothetical protein CARUB_v10020164mg, partial [Capsella rubella]
 gb|EOA35053.1| hypothetical protein CARUB_v10020164mg, partial [Capsella rubella]
Length=510

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + +D VGTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA ++ N
Sbjct  67   EDEDGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVMMYDDIANHQLN  126

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR G +IN+P+GEDVY GVPKDYTG +VT  N  AV+LGD+ AVKGGSGKV+ S PNDHI
Sbjct  127  PRPGTLINHPNGEDVYAGVPKDYTGSNVTAANFYAVLLGDQKAVKGGSGKVIASKPNDHI  186

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            FVYY+DHGGPGVLGMP +P++YA D    LKKKHA+GT
Sbjct  187  FVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGT  224



>ref|XP_009621616.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Nicotiana 
tomentosiformis]
 emb|CAB42650.2| putative preprolegumain [Nicotiana tabacum]
Length=455

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 147/205 (72%), Gaps = 17/205 (8%)
 Frame = +2

Query  74   MIRSVAA-SLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVL  250
            MIR       L+  F +V  A+GR+ L+                   + D+  GT+WAVL
Sbjct  1    MIRKNGVVPFLVALFVLVCTAEGRNLLE----------------SIVEDDNPTGTKWAVL  44

Query  251  IAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGE  430
            +AGSN + NYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIAYN+ NPR G+IIN+PHG 
Sbjct  45   VAGSNEWDNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAYNKNNPRPGIIINSPHGH  104

Query  431  DVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVL  610
            DVY GVPKDYTG D   DN  AVILG+KSA+ GGSGKVV++GPND+IF+YY+DHG PG++
Sbjct  105  DVYKGVPKDYTGKDCNADNFFAVILGNKSALTGGSGKVVENGPNDYIFIYYADHGAPGLI  164

Query  611  GMPTSPYLYADDLNAALKKKHAAGT  685
            GMP+   +YADDLN  L KKH  GT
Sbjct  165  GMPSGDVVYADDLNRVLIKKHTFGT  189



>ref|XP_002441635.1| hypothetical protein SORBIDRAFT_09g030710 [Sorghum bicolor]
 gb|EES20065.1| hypothetical protein SORBIDRAFT_09g030710 [Sorghum bicolor]
Length=472

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 126/152 (83%), Gaps = 3/152 (2%)
 Frame = +2

Query  227  VGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGV  406
            VGTRWAVLIAGSNGY+NYRHQAD+CHAYQI+K GGLKDENI+V MYDDIA + +NPR GV
Sbjct  46   VGTRWAVLIAGSNGYYNYRHQADVCHAYQIMKKGGLKDENIIVLMYDDIADSPDNPRPGV  105

Query  407  IINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYS  586
            IIN P G DVY GVPKDYTG+DV V+N LAV+L         +GKVV SGP+DH+FVYYS
Sbjct  106  IINRPDGGDVYAGVPKDYTGEDVNVNNFLAVLL---GNKSAATGKVVASGPDDHVFVYYS  162

Query  587  DHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            DHGGPGVLGMP+  YLYA DL  AL++KHAAG
Sbjct  163  DHGGPGVLGMPSDDYLYAKDLVDALERKHAAG  194



>ref|XP_004245377.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=463

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 144/204 (71%), Gaps = 19/204 (9%)
 Frame = +2

Query  74   MIRSVAASLLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            + + +    L++  SI    +GR   K  +                  +++VGT+WAVL+
Sbjct  2    IFKYIVCVALVVVLSICVNIEGRSVSKFLT------------------EETVGTKWAVLV  43

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNG+WNYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA N  NPR GVIINNPHG+D
Sbjct  44   AGSNGWWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIANNTMNPRPGVIINNPHGQD  103

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDY G+DV  +N   VIL +KS + GGSGKV++S PNDHIF+YY DHGGPG++ 
Sbjct  104  VYKGVPKDYVGEDVNAENFFNVILANKSGITGGSGKVLNSAPNDHIFIYYVDHGGPGIVS  163

Query  614  MPTSPYLYADDLNAALKKKHAAGT  685
            MPT   +YA+DL   LKKKH +GT
Sbjct  164  MPTG-VVYANDLIDVLKKKHGSGT  186



>ref|XP_003569976.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Brachypodium 
distachyon]
Length=490

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + +D VGTRWAVLIAGS+GY NYRHQADICHAYQ+L+ GGLK+ENIVVFMYDDIA +  N
Sbjct  48   EEEDGVGTRWAVLIAGSSGYGNYRHQADICHAYQVLRKGGLKEENIVVFMYDDIANSALN  107

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG+ VT  NL AV+LG+K+AV GGS KV+DS P DHI
Sbjct  108  PRPGVIINHPQGEDVYAGVPKDYTGEQVTAKNLYAVLLGNKTAVTGGSKKVIDSQPKDHI  167

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  PYLYA D    L++KHA+ T
Sbjct  168  FIYYSDHGGPGVLGMPNLPYLYAGDFIKILQQKHASNT  205



>gb|EYU24761.1| hypothetical protein MIMGU_mgv1a005235mg [Erythranthe guttata]
Length=492

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            ++  GTRWAVL+AGSNG+ NYRHQAD+CHAYQILK GG+KDENI+VFMYDDIA N+ NPR
Sbjct  51   EEEDGTRWAVLVAGSNGFGNYRHQADVCHAYQILKKGGVKDENIIVFMYDDIAMNDLNPR  110

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
            KGV+IN+P+GEDVY GVPKDYTG+ VT +N  AVILGDKSA+KGGSGKVVDS P D IF+
Sbjct  111  KGVLINHPNGEDVYAGVPKDYTGEQVTAENFYAVILGDKSALKGGSGKVVDSKPGDRIFI  170

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  PYLY  D    LKKKH++GT
Sbjct  171  YYSDHGGPGVLGMPNMPYLYGKDFIEVLKKKHSSGT  206



>gb|EYU34366.1| hypothetical protein MIMGU_mgv1a018579mg [Erythranthe guttata]
Length=491

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            GTRWAVL+AGSNG+ NYRHQAD+CHAYQILK GG+KDENIVVFMYDDIA N+ NPRKGV+
Sbjct  54   GTRWAVLVAGSNGFGNYRHQADVCHAYQILKKGGVKDENIVVFMYDDIAMNDLNPRKGVL  113

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            IN+P+GEDVY GVPKDYTG+ VT +N  AVILGDKSA+KGGSGKVVDS P D IF+YYSD
Sbjct  114  INHPNGEDVYAGVPKDYTGEQVTAENFYAVILGDKSALKGGSGKVVDSKPGDRIFIYYSD  173

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HGGPGVLGMP  PYLY  D    LKKKH +GT
Sbjct  174  HGGPGVLGMPNMPYLYGKDFIDVLKKKHTSGT  205



>ref|XP_006355333.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=463

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 141/195 (72%), Gaps = 19/195 (10%)
 Frame = +2

Query  101  LLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNY  280
            L +  SI A  +GR   K  +                  +++VGT+WAVL+AGSNG+WNY
Sbjct  11   LFVVLSIWASIEGRSVSKFLT------------------EETVGTKWAVLVAGSNGWWNY  52

Query  281  RHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDY  460
            RHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA N  NPR GVIINNPHG+DVY GV KDY
Sbjct  53   RHQADVCHAYQLLKKGGLKDENIIVFMYDDIANNTMNPRPGVIINNPHGQDVYKGVIKDY  112

Query  461  TGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYA  640
             G+DV  +N   VIL +KS + GGSGKV++S PNDHIF+YY DHGGPG++ MPT   +YA
Sbjct  113  VGEDVNAENFFNVILANKSGITGGSGKVLNSAPNDHIFIYYVDHGGPGIVSMPTG-VVYA  171

Query  641  DDLNAALKKKHAAGT  685
            +DL   LKKKHA+GT
Sbjct  172  NDLINVLKKKHASGT  186



>ref|XP_006391830.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
 gb|ESQ29116.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
Length=484

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            + ++GTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA +  NPR
Sbjct  45   EAAIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVLMYDDIANHPLNPR  104

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G +IN+P GEDVY GVPKDYTG DVT  N  AV+LGDK AVKGGSGKV+ S PNDHIFV
Sbjct  105  PGTLINHPDGEDVYAGVPKDYTGHDVTAANFYAVLLGDKKAVKGGSGKVIASKPNDHIFV  164

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP +P+LYA D    LKKKHAAGT
Sbjct  165  YYSDHGGPGVLGMPNTPHLYAADFIETLKKKHAAGT  200



>ref|XP_010933721.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
 ref|XP_010933722.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=490

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            DG+  +GTRWAVL+AGS GY NYRHQAD+CHAYQ+LK GGLK+ENIVV M+DDIA N  N
Sbjct  47   DGEQEIGTRWAVLVAGSFGYGNYRHQADVCHAYQLLKKGGLKEENIVVMMHDDIANNPLN  106

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG+ VT  NL AVILG+KSAV+GGSGKVVDS PND I
Sbjct  107  PRPGVIINHPQGEDVYAGVPKDYTGEHVTTTNLYAVILGNKSAVEGGSGKVVDSKPNDRI  166

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            F+YYSDHGGPGVLGMP  P+LYA D    LKKKHA+G
Sbjct  167  FIYYSDHGGPGVLGMPNMPFLYAADFIDVLKKKHASG  203



>ref|XP_006838618.1| hypothetical protein AMTR_s00002p00230380, partial [Amborella 
trichopoda]
 gb|ERN01187.1| hypothetical protein AMTR_s00002p00230380, partial [Amborella 
trichopoda]
Length=272

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            +G + VGTRWAVL+AGS+G+ NYRHQAD+CHAYQ+L  GGLK+ENIVVFM+DDIAYNE N
Sbjct  45   EGGEGVGTRWAVLVAGSSGFGNYRHQADVCHAYQLLLKGGLKEENIVVFMHDDIAYNEFN  104

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            P+KG+IIN+P GEDVY GVPKDYTG  V   NL AV+LG+ SAV GGSGKV++S   D I
Sbjct  105  PKKGIIINHPQGEDVYAGVPKDYTGKQVHTKNLYAVLLGNNSAVTGGSGKVINSKAEDRI  164

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            F+YYSDHGGPGVLGMP  P+LYA+DL   L KKH +
Sbjct  165  FIYYSDHGGPGVLGMPNMPFLYANDLMEVLMKKHKS  200



>gb|KHG28226.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=454

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            D  +GTRWAVL+AGS+GY NYRHQAD+CHAYQ+L+ GGLK+ENI+VFMYDDIA NE NPR
Sbjct  49   DQQLGTRWAVLVAGSSGYGNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAMNELNPR  108

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G+IIN+P G+DVY GVPKDYTG+ VT  NL AV+LG++SA+ GGSGKVVDS P+D IF+
Sbjct  109  PGIIINHPQGDDVYAGVPKDYTGEHVTAANLYAVLLGNRSALSGGSGKVVDSKPDDRIFL  168

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  P+LYA D    LKKKHAAG+
Sbjct  169  YYSDHGGPGVLGMPNLPFLYAMDFLDVLKKKHAAGS  204



>gb|KJB25635.1| hypothetical protein B456_004G201300 [Gossypium raimondii]
Length=496

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +  VGTRWAVL+AGS+GY NYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIA +E NPR
Sbjct  55   EQQVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIAMHELNPR  114

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIIN+P G+DVY GVPKDYTG+ VT  NL AV+LGDK A+ GGSGKV+DS PND IF+
Sbjct  115  PGVIINHPQGDDVYAGVPKDYTGEHVTAANLYAVLLGDKDALSGGSGKVIDSKPNDRIFM  174

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  P+LYA D    LKKKHAAGT
Sbjct  175  YYSDHGGPGVLGMPNMPFLYAMDFLDVLKKKHAAGT  210



>ref|XP_004953273.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Setaria 
italica]
Length=494

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + DD VGTRWAVL+AGS+GY NYRHQADICHAYQIL  GGLK+ENIVVFMYDD+A +  N
Sbjct  52   EEDDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILLKGGLKEENIVVFMYDDVANSVLN  111

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR+GVIIN+P GEDVY GVPKDYTG+ VT  N  AV+LG+K AV GGS KV++S PNDHI
Sbjct  112  PRQGVIINHPEGEDVYAGVPKDYTGEQVTAKNFYAVLLGNKDAVTGGSRKVINSKPNDHI  171

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  PY+YA D    L++KHA+ +
Sbjct  172  FIYYSDHGGPGVLGMPNLPYIYAGDFMKVLREKHASNS  209



>gb|AFW72544.1| vacuolar processing enzyme 1 [Zea mays]
Length=500

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            DD+VGTRWAVL+AGS+GY NYRHQADICHAYQIL+ GG+K+ENIVVFMYDDIA +  NPR
Sbjct  54   DDAVGTRWAVLVAGSSGYGNYRHQADICHAYQILQKGGIKEENIVVFMYDDIANSALNPR  113

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
            +GVIIN+P GEDVY GVPKDYTGD VT  N  AV+LG+K+AV GGS KV++S  +DHIF+
Sbjct  114  QGVIINHPEGEDVYAGVPKDYTGDQVTTKNFYAVLLGNKTAVTGGSRKVINSKADDHIFI  173

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  PYLYA D    L++KHA+ +
Sbjct  174  YYSDHGGPGVLGMPNLPYLYAGDFMKVLREKHASNS  209



>ref|XP_004245119.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=451

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D ++S+GT+WAVL+AGSN ++NYRHQADICHAYQ+LK GGLKDENIVVFMYDDIAYN EN
Sbjct  31   DHENSIGTKWAVLVAGSNEWYNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIAYNSEN  90

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            P+ GVIIN PHG DVY GVPKDYTG      N   V+LG+KSA+ GGSGKVV+SGPND+I
Sbjct  91   PKPGVIINKPHGPDVYKGVPKDYTGKHCNAQNFYGVVLGNKSALTGGSGKVVNSGPNDYI  150

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YY+DHGG GV+ MP  P +YA DLN  LKKKHA+ T
Sbjct  151  FIYYADHGGSGVIDMPIEPSIYAKDLNEVLKKKHASRT  188



>emb|CAQ00096.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26636.1| vacuolar processing enzyme 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + +D VGTRWAVL+AGS+GY NYRHQADICHAYQIL+ GG+K+ENIVVFMYDDIA N  N
Sbjct  50   EEEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILRKGGVKEENIVVFMYDDIAKNALN  109

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG+ VT  N  AV+LG+K+AV GGS KV+DS  NDHI
Sbjct  110  PRPGVIINHPEGEDVYAGVPKDYTGEAVTAKNFYAVLLGNKTAVTGGSKKVIDSKSNDHI  169

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  PYLYA D    L++KHA+ T
Sbjct  170  FIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKHASNT  207



>ref|XP_004298668.1| PREDICTED: legumain [Fragaria vesca subsp. vesca]
Length=493

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D  +  GT WAVL+AGSNGY NYRHQAD+CHAYQILK GGLK+ENIVVFMYDDIA +E N
Sbjct  50   DAVEQSGTTWAVLVAGSNGYGNYRHQADVCHAYQILKKGGLKEENIVVFMYDDIAMHEMN  109

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PRKG+IIN+P G+DVY GVPKDYTG+ V   NL AV+LGDK AVKGG+GKVV S PND I
Sbjct  110  PRKGIIINHPQGQDVYAGVPKDYTGEHVNAANLYAVLLGDKKAVKGGTGKVVASKPNDRI  169

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F++YSDHGGPGVLGMP  P+LYA D    LKKKHA+G+
Sbjct  170  FLFYSDHGGPGVLGMPNMPFLYAMDFINVLKKKHASGS  207



>ref|XP_002452849.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
 gb|EES05825.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
Length=495

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + D +VGTRWAVL+AGS+GY NYRHQADICHAYQIL+ GG+K+ENIVVFMYDD+A +  N
Sbjct  53   EEDVAVGTRWAVLVAGSSGYGNYRHQADICHAYQILRKGGIKEENIVVFMYDDVATSALN  112

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR+GVIIN+P GEDVY GVPKDYTGD VT  N  AV+LG+K+AV GGS KV++S P+DHI
Sbjct  113  PRQGVIINHPQGEDVYAGVPKDYTGDQVTAKNFFAVLLGNKTAVTGGSRKVINSKPDDHI  172

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+ YSDHGGPGVLGMP  PYLYA D    L++KHA+ +
Sbjct  173  FICYSDHGGPGVLGMPNLPYLYAGDFMKVLREKHASNS  210



>ref|XP_010418271.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +D +GTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA N  NPR
Sbjct  46   EDGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVMMYDDIANNPLNPR  105

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G +IN+P+G+DVY GVPKDYTG +VT  N  AV+LGD+ A+KGGSGKV+ S PNDHIFV
Sbjct  106  PGTLINHPNGDDVYAGVPKDYTGSNVTAANFYAVLLGDQKALKGGSGKVIASKPNDHIFV  165

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPGVLGMP +P++YA D    LKKKHA+GT
Sbjct  166  YYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGT  201



>ref|XP_008796848.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=491

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            DGD+ +GTRWAVL+AGS GY NYRHQAD+CHAYQ+LK GGLK+ENIVV M+DDIA N  N
Sbjct  47   DGDEEIGTRWAVLVAGSFGYGNYRHQADVCHAYQLLKKGGLKEENIVVMMHDDIANNPLN  106

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P GEDVY GVPKDYTG+ VT  NL AVILG+KSAV+GGSGKVVDS P D I
Sbjct  107  PRPGVIINHPDGEDVYAGVPKDYTGEQVTTKNLYAVILGNKSAVEGGSGKVVDSKPVDRI  166

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  P+LYA D    LKKKHA+G+
Sbjct  167  FIYYSDHGGPGVLGMPNMPFLYAADFIDVLKKKHASGS  204



>ref|XP_010669185.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Beta 
vulgaris subsp. vulgaris]
Length=470

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            GT+WAVL+AGS G+ NYRHQADICHAYQILK GGLKDENI+VFMYDDIAYNEENPR+G+I
Sbjct  45   GTKWAVLVAGSKGFGNYRHQADICHAYQILKRGGLKDENIIVFMYDDIAYNEENPREGII  104

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            INNP G DVY+GVPKDYTGD +T  NLLA ILG++ A++GGSGKVVDSGPND IF+YYSD
Sbjct  105  INNPEGGDVYNGVPKDYTGDSLTTLNLLAAILGNRDAIEGGSGKVVDSGPNDRIFIYYSD  164

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HG PGVL MP    LYA+DL   L+KKH  GT
Sbjct  165  HGSPGVLTMPNHDDLYANDLINTLEKKHLMGT  196



>ref|XP_007155624.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
 gb|ESW27618.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
Length=493

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
             D VGTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GG+K+ENIVVFMYDDIA +E NPR
Sbjct  52   SDEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGVKEENIVVFMYDDIATHELNPR  111

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIINNP G DVY GVPKDYTG+ VT  N  AV+LGDKS VKGGSGKV++S P D IFV
Sbjct  112  PGVIINNPQGPDVYAGVPKDYTGESVTSRNFFAVLLGDKSKVKGGSGKVINSKPEDRIFV  171

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            YYSDHGGPGVLGMP  PYLYA D    LKKKHA+G
Sbjct  172  YYSDHGGPGVLGMPNMPYLYAMDFIDVLKKKHASG  206



>ref|XP_006355496.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Solanum 
tuberosum]
Length=494

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  233  TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVII  412
             RWAVL+AGSNGY NYRHQAD+CHAYQILK GGLKDENIVVFMYDDIA +E NPR GVII
Sbjct  60   VRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAKSELNPRPGVII  119

Query  413  NNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDH  592
            N+P+G DVY GVPKDYTG+ VT  NL AV+LGDKSAVKGGSGKVV+SGPND IF+YYSDH
Sbjct  120  NHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAVKGGSGKVVNSGPNDRIFLYYSDH  179

Query  593  GGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GGPGVLGMP  PYLY  DL   LKKK+AAGT
Sbjct  180  GGPGVLGMPNMPYLYGKDLIEVLKKKYAAGT  210



>ref|XP_008437131.1| PREDICTED: legumain [Cucumis melo]
Length=495

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  VGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGV  406
            VGTRWAVL+AGS+G+ NYRHQADICHAYQ+LK GGLKDENIVVFMYDDIA N  NPR G+
Sbjct  55   VGTRWAVLVAGSSGFGNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIATNVLNPRPGI  114

Query  407  IINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYS  586
            IIN+P GEDVY GVPKDYTG+ VT  NL AV+LG+++AV GGSGKVVDS PND IFVYYS
Sbjct  115  IINHPQGEDVYAGVPKDYTGEHVTAQNLYAVLLGNRTAVNGGSGKVVDSKPNDRIFVYYS  174

Query  587  DHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            DHGGPGVLGMP  P++YA D    LKKKHAA
Sbjct  175  DHGGPGVLGMPNLPFVYAMDFIEVLKKKHAA  205



>ref|XP_011018251.1| PREDICTED: vacuolar-processing enzyme [Populus euphratica]
Length=494

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D  + +G+RWAVL+AGS+GY NYRHQAD+CHAYQ+L+ GG+K+ENIVVFMYDDIA +E N
Sbjct  51   DDGEEIGSRWAVLVAGSSGYGNYRHQADVCHAYQLLRKGGIKEENIVVFMYDDIAMHEFN  110

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G+DVY GVPKDYTG+ V  +NL AV+LG+KSAVKGGSGKVVDS PND I
Sbjct  111  PRPGVIINHPQGDDVYAGVPKDYTGEQVNTENLYAVLLGNKSAVKGGSGKVVDSKPNDRI  170

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGGPGVLGMP  P+LYA D    LKKKHA+G+
Sbjct  171  FLYYSDHGGPGVLGMPNMPFLYAMDFIEVLKKKHASGS  208



>sp|O24326.1|VPE2_PHAVU RecName: Full=Vacuolar-processing enzyme; AltName: Full=Pv-VPE; 
Flags: Precursor [Phaseolus vulgaris]
 emb|CAB17079.1| legumain-like proteinase precursor [Phaseolus vulgaris]
Length=493

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
             D VGTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GG+K+ENIVVFMYDDIA +E NPR
Sbjct  52   SDEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGVKEENIVVFMYDDIATHELNPR  111

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIINNP G DVY GVPKDYTG+ VT  N  AV+LGDKS VKGGSGKV++S P D IFV
Sbjct  112  PGVIINNPQGPDVYAGVPKDYTGESVTSHNFFAVLLGDKSKVKGGSGKVINSKPEDRIFV  171

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            YYSDHGGPGVLGMP  PYLYA D    LKKKHA+G
Sbjct  172  YYSDHGGPGVLGMPNMPYLYAMDFIDVLKKKHASG  206



>emb|CAQ00100.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26642.1| vacuolar processing enzyme 4 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99424.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 134/183 (73%), Gaps = 19/183 (10%)
 Frame = +2

Query  143  DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILK  322
            +FL+LPSE                  D VGTRWAVLIAGSNGY+NYRHQAD+CHAYQI+K
Sbjct  26   EFLRLPSE-----------------KDVVGTRWAVLIAGSNGYYNYRHQADVCHAYQIMK  68

Query  323  AGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVI  502
             GGLKDENI+VFMYDDIA N +NPR GVIIN+P G DVY GVPKDYTG DV  +N LA +
Sbjct  69   KGGLKDENIIVFMYDDIANNRDNPRPGVIINHPKGGDVYAGVPKDYTGADVNTNNFLAAL  128

Query  503  Lg-dksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPT-SPYLYADDLNAALKKKHA  676
            LG        GSGKVV SGP+DHIFVYY+DHGGPG+LGMP    YLYA+DL   L+KKHA
Sbjct  129  LGDKSKLTGSGSGKVVSSGPDDHIFVYYADHGGPGILGMPEDEEYLYANDLVRTLEKKHA  188

Query  677  AGT  685
             G 
Sbjct  189  GGA  191



>emb|CBI28507.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 164/231 (71%), Gaps = 4/231 (2%)
 Frame = +2

Query  2    VNPFNIIPSSLHSQIS*KISTVLTMIRSVAASLLLLTFSIVAVADGR---DFLKLPSear  172
            + P +    +LH+  S   S  + + RSV      L   ++ +A+G      L+L    +
Sbjct  51   LQPSHFKSHALHATPSKHFSLSMALHRSVCLLNSALLLLLLLLAEGTGGARALRLNRWDQ  110

Query  173  rffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIV  352
            + + P ++   E DG++  GTRWAVL+AGS GY NYRHQAD+CHAYQ+LK GGLKDENIV
Sbjct  111  KIWMPTDKVEAEEDGEER-GTRWAVLVAGSYGYGNYRHQADVCHAYQLLKRGGLKDENIV  169

Query  353  VFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkgg  532
            VFMYDDIA ++ NPR GVIIN+P G+DVY GVPKDYTG+DVT  NL AV+LGDKS +KGG
Sbjct  170  VFMYDDIATHDFNPRPGVIINHPQGDDVYAGVPKDYTGEDVTAQNLFAVLLGDKSLLKGG  229

Query  533  sgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            SGKVV+S PND IF+YYSDHGG GVLGMP  P+LYA D    LK KHA+G+
Sbjct  230  SGKVVESKPNDRIFLYYSDHGGQGVLGMPNMPFLYAKDFIDVLKMKHASGS  280



>ref|XP_010473493.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +D +GTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA N  NPR
Sbjct  46   EDGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVMMYDDIANNPLNPR  105

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G IIN+P+G DVY GVPKDYTG +VT  N  AV+LGD+ AVKGGSGKV+ S PNDHIFV
Sbjct  106  PGTIINHPNGYDVYAGVPKDYTGSNVTAANFYAVLLGDQKAVKGGSGKVIASKPNDHIFV  165

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPGVLGMP +P++YA D    LKKKHA+GT
Sbjct  166  YYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGT  201



>ref|XP_006355317.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=462

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D + S+GT+WAVL+AGS+G++NYRHQA+ICHAYQ+LK GGLKDE+I+VFMYDDIAYN EN
Sbjct  31   DHEHSIGTKWAVLVAGSSGWYNYRHQANICHAYQLLKKGGLKDEHIIVFMYDDIAYNPEN  90

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIINNPHG DVY GVPKDYTG D    N   VILG+KSA+ GGSGKVV+SGPND+I
Sbjct  91   PRPGVIINNPHGHDVYKGVPKDYTGKDCNAQNFYGVILGNKSALTGGSGKVVNSGPNDYI  150

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHG PGV+ MP  P +YA +LN  LK KHA+ T
Sbjct  151  FIYYSDHGAPGVVAMPVEPPVYATELNEVLKIKHASRT  188



>ref|XP_006355331.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=470

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
             +S GT+WAVL+AGSNG+ NYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA+N ENPR
Sbjct  33   QESQGTKWAVLVAGSNGWDNYRHQADVCHAYQLLKNGGLKDENIIVFMYDDIAHNRENPR  92

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIINNPHG DVY GVPKDY G+DV   N   VIL +KS + GGSGKV++SGPNDHIF+
Sbjct  93   PGVIINNPHGNDVYKGVPKDYLGEDVNAKNFYNVILANKSGIVGGSGKVLNSGPNDHIFI  152

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPG++ MP+   +YA+DL   LK KHA+GT
Sbjct  153  YYTDHGGPGIVAMPSGELVYANDLVNVLKMKHASGT  188



>ref|XP_010676183.1| PREDICTED: vacuolar-processing enzyme [Beta vulgaris subsp. vulgaris]
Length=483

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  215  GDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENP  394
            G D  GTRWA+L+AGS G+ NYRHQAD+CHAYQILK GGLKDENIVVFMYDDIA N  NP
Sbjct  41   GLDDGGTRWALLVAGSQGFGNYRHQADVCHAYQILKKGGLKDENIVVFMYDDIADNPLNP  100

Query  395  RKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIF  574
            RKGVIIN+P GEDVY GVPKDYTG+ VT +N+ AV+LG+KSAV GGSGKV+DS PND IF
Sbjct  101  RKGVIINHPKGEDVYAGVPKDYTGEHVTAENMYAVLLGNKSAVNGGSGKVIDSKPNDRIF  160

Query  575  VYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            +YYSDHGGPGVLGMP  P+LY  D    LKKKHA+ +
Sbjct  161  LYYSDHGGPGVLGMPNMPFLYGKDFIEVLKKKHASKS  197



>ref|XP_007209951.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
 gb|EMJ11150.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
Length=491

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  224  SVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKG  403
              GTRWAVL+AGS+GY NYRHQAD+CHAYQ+LK GGLK+ENIVVFMYDDIA +E NPR G
Sbjct  52   EAGTRWAVLVAGSSGYGNYRHQADVCHAYQLLKKGGLKEENIVVFMYDDIANHEINPRPG  111

Query  404  VIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYY  583
            VIIN+P G+DVY GVPKDYTG  VT  NL AV+LGDK AVKGGSGKVVDS PND IF+YY
Sbjct  112  VIINHPQGQDVYAGVPKDYTGKQVTAANLYAVLLGDKKAVKGGSGKVVDSKPNDRIFLYY  171

Query  584  SDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            SDHGGPGVLGMP  P+LYA D    LKKKHA+G+
Sbjct  172  SDHGGPGVLGMPNMPFLYAMDFIQVLKKKHASGS  205



>gb|ACJ85695.1| unknown [Medicago truncatula]
Length=280

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            D VGTRWAVL+AGS+GY NYRHQAD+CHAYQ+L  GG+K+ENIVVFMYDDIA NE NPR 
Sbjct  54   DEVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLIKGGVKEENIVVFMYDDIANNELNPRP  113

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            GVIIN+P G +VY GVPKDYTGD+VT +NL AVILGDKS VKGGSGKV++S   D IF+Y
Sbjct  114  GVIINHPQGPNVYVGVPKDYTGDNVTAENLYAVILGDKSKVKGGSGKVINSKSEDRIFIY  173

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            YSDHGGPGVLGMP  PY+YA D    LKKKHA+G
Sbjct  174  YSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASG  207



>ref|XP_010430341.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Camelina 
sativa]
Length=487

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +D +GTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGL++ENIVV MYDDIA N  NPR
Sbjct  46   EDGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLQEENIVVMMYDDIANNPLNPR  105

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G +IN+P+G+DVY GVPKDYTG +VT  N  AV+LGD+ AVKGGSGKV+ S PNDHIFV
Sbjct  106  PGTLINHPNGDDVYAGVPKDYTGSNVTAANFYAVLLGDQKAVKGGSGKVIASKPNDHIFV  165

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPGVLGMP +P++YA D    LKKKHA+GT
Sbjct  166  YYADHGGPGVLGMPNTPHIYAADFIGTLKKKHASGT  201



>ref|XP_010264202.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=498

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  VGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGV  406
            +GTRWAVL+AGS+G+ NYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIAY+E NPR G+
Sbjct  62   IGTRWAVLVAGSSGFGNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIAYSEFNPRPGI  121

Query  407  IINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYS  586
            IIN+P G+DVY GVPKDYTG++VT  NL AV+LGDK AV+GGSGKV+DS PND IF YYS
Sbjct  122  IINHPQGQDVYAGVPKDYTGENVTAKNLYAVLLGDKRAVRGGSGKVIDSKPNDRIFFYYS  181

Query  587  DHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            DHGGPGVLGMP  P++YA +    LKKKHAA
Sbjct  182  DHGGPGVLGMPNLPFIYAVNFIEVLKKKHAA  212



>ref|XP_004245378.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=657

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
             +S GT+WAVL+AGSNG+ NYRHQAD+CHAYQ+LK GGLKDENI+VFMYDDIA+N ENPR
Sbjct  220  QESQGTKWAVLVAGSNGWDNYRHQADVCHAYQLLKNGGLKDENIIVFMYDDIAHNRENPR  279

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             GVIINNPHG DVY GVPKDY G+DV   N   VIL +KS + GG+GKV++SGPNDHIF+
Sbjct  280  PGVIINNPHGNDVYKGVPKDYVGEDVNALNFYNVILANKSGIVGGTGKVLNSGPNDHIFI  339

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPG++ MP+   +YA+DL   LKKKHA+GT
Sbjct  340  YYTDHGGPGIVAMPSGELVYANDLVNVLKKKHASGT  375



>ref|XP_011033921.1| PREDICTED: vacuolar-processing enzyme-like [Populus euphratica]
Length=494

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D    +GTRWAVL+AGSNGY NYRHQAD+CHAYQ+L+ GG+K+ENIVVFMYDDIA +E N
Sbjct  51   DDGKEIGTRWAVLVAGSNGYGNYRHQADVCHAYQLLRKGGIKEENIVVFMYDDIANHEFN  110

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G+DVY GVPKDYTG  VT  NL AV+LG+KSAVKGGSGKVVDS PND I
Sbjct  111  PRPGVIINHPQGDDVYAGVPKDYTGVQVTTANLYAVLLGNKSAVKGGSGKVVDSMPNDRI  170

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            F+YYSDHGGPGVLGMP  P+LYA D    LKKKHA+G
Sbjct  171  FLYYSDHGGPGVLGMPNMPFLYAMDFIEVLKKKHASG  207



>ref|XP_010053427.1| PREDICTED: vacuolar-processing enzyme isoform X1 [Eucalyptus 
grandis]
 gb|KCW77726.1| hypothetical protein EUGRSUZ_D02025 [Eucalyptus grandis]
Length=496

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  VGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGV  406
            VGTRWAVL+AGS+GY NYRHQAD+CHAYQILK GGLK+ENIVVFMYDDIA ++ NPR GV
Sbjct  60   VGTRWAVLVAGSSGYGNYRHQADVCHAYQILKKGGLKEENIVVFMYDDIATHQLNPRPGV  119

Query  407  IINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYS  586
            IIN+P G+DVY GVPKDYTG +VT  NL AV+LGDKSAVKGGSGKVV S PND IF+YYS
Sbjct  120  IINHPKGDDVYAGVPKDYTGKNVTAANLYAVLLGDKSAVKGGSGKVVSSKPNDRIFLYYS  179

Query  587  DHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            DHGGPGVLGMP  P+LYA D    LKKKHAA
Sbjct  180  DHGGPGVLGMPNMPFLYAMDFINVLKKKHAA  210



>emb|CDY39808.1| BnaA09g10600D [Brassica napus]
Length=484

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + + ++GTRWAVLIAGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA +  N
Sbjct  43   EQESTIGTRWAVLIAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVMMYDDIANHPLN  102

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR G +IN+P GEDVY GVPKDYTG +VT  N  AV+LGDK AV GGSGKV+ S  NDHI
Sbjct  103  PRPGTLINHPDGEDVYAGVPKDYTGHNVTAANFYAVLLGDKEAVTGGSGKVIASKANDHI  162

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            FVYYSDHGGPGVLGMP  PYLYA D    LKKKHAA T
Sbjct  163  FVYYSDHGGPGVLGMPNKPYLYATDFIETLKKKHAAET  200



>emb|CDY03258.1| BnaC09g10900D [Brassica napus]
Length=490

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            + ++++GTRWAVLIAGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA +  N
Sbjct  38   EEENTIGTRWAVLIAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVMMYDDIANHPLN  97

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR G +IN+P GEDVY GVPKDYTG +VT  N  AV+LGDK AV GGSGKV+ S  NDHI
Sbjct  98   PRPGTLINHPDGEDVYTGVPKDYTGHNVTAANFYAVLLGDKEAVTGGSGKVIASKVNDHI  157

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            FVYYSDHGGPGVLGMP  PYLYA D    LKKKHAA T
Sbjct  158  FVYYSDHGGPGVLGMPNKPYLYATDFIETLKKKHAAET  195



>ref|XP_008369533.1| PREDICTED: legumain [Malus domestica]
Length=501

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            GTRWAVL+AGSNGY NYRHQADICHAYQ+LK GGLK+ENIVVFMYDDIA +  NPR GVI
Sbjct  64   GTRWAVLVAGSNGYGNYRHQADICHAYQLLKKGGLKEENIVVFMYDDIAKHLMNPRPGVI  123

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            IN+P G DVY GVPKDYTG+ VT  NL AV+LGDK AVKGGSGKVVDS PND IF+YYSD
Sbjct  124  INHPQGGDVYAGVPKDYTGEQVTAANLYAVLLGDKKAVKGGSGKVVDSKPNDRIFLYYSD  183

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            HGGPGVLGMP  P+LYA D    LKKKHA+G+
Sbjct  184  HGGPGVLGMPNMPFLYAMDFIEVLKKKHASGS  215



>gb|KJB51882.1| hypothetical protein B456_008G236100 [Gossypium raimondii]
Length=491

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            D  +GTRWAVL+AGS+GY NYRHQAD+CHAYQ+L+ GGLK+ENI+VF+YDDIA NE NPR
Sbjct  49   DQQLGTRWAVLVAGSSGYGNYRHQADVCHAYQLLRKGGLKEENIIVFLYDDIAMNELNPR  108

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G+IIN+P G+DVY GVPKDYTG+ VT  NL AV+LG++SA+ GGSGKVVDS  ND IF+
Sbjct  109  PGIIINHPQGDDVYAGVPKDYTGEHVTAANLYAVLLGNRSALSGGSGKVVDSKTNDRIFL  168

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YYSDHGGPGVLGMP  P+LYA D    LKKKHAAG+
Sbjct  169  YYSDHGGPGVLGMPNLPFLYAMDFLDVLKKKHAAGS  204



>ref|XP_010325045.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=470

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 137/196 (70%), Gaps = 18/196 (9%)
 Frame = +2

Query  98   LLLLTFSIVAVADGRDFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIAGSNGYWN  277
              L+  SIV   +GR   +  +                    + GT+W VL+AGSNG+ N
Sbjct  11   FFLVLVSIVVTIEGRSITQFLT------------------QKTKGTKWVVLVAGSNGWTN  52

Query  278  YRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDVYHGVPKD  457
            YRHQA++CHAYQI+KAGGLKDENI+VFMYDDIA N ENPR GVIINNPHG DVY GVPKD
Sbjct  53   YRHQANVCHAYQIMKAGGLKDENIIVFMYDDIANNTENPRPGVIINNPHGHDVYKGVPKD  112

Query  458  YTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGMPTSPYLY  637
            Y GDDV  +N   VIL +KS V GGSGKV+ SGPNDHIF+Y++DHG PGV+ MP +  +Y
Sbjct  113  YVGDDVNANNFFNVILANKSGVVGGSGKVLKSGPNDHIFIYFTDHGAPGVISMPYNEVIY  172

Query  638  ADDLNAALKKKHAAGT  685
            A +L   LKKKHA+GT
Sbjct  173  AHELVNMLKKKHASGT  188



>ref|XP_010093667.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB54447.1| Vacuolar-processing enzyme [Morus notabilis]
Length=501

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 150/203 (74%), Gaps = 6/203 (3%)
 Frame = +2

Query  83   SVAASLLLLTFSIVAVADGR--DFLKLPSearrffrpaeeenreaDGDDSVGTRWAVLIA  256
            S+ A L+++   +++V + R   F +  S  R      E      D D  + TRWAVL+A
Sbjct  17   SICAMLVIMILVVLSVENCRAARFERWESAIRMPTDKDEYS----DQDKELSTRWAVLVA  72

Query  257  GSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGEDV  436
            GS+GY NYRHQAD+CHAYQ+L+ GG+K+ENIVVFMYDDIA +  NPR G+IIN+P G+DV
Sbjct  73   GSSGYGNYRHQADVCHAYQLLRKGGVKEENIVVFMYDDIAMHGLNPRPGIIINHPQGDDV  132

Query  437  YHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLGM  616
            Y GVPKDYTG  VT +NL AV+LGDK AVKGGSGKVVDS PND IF+YYSDHGGPGVLGM
Sbjct  133  YAGVPKDYTGQYVTTENLYAVLLGDKKAVKGGSGKVVDSKPNDRIFLYYSDHGGPGVLGM  192

Query  617  PTSPYLYADDLNAALKKKHAAGT  685
            P  P+LYA D    LKKKHA+GT
Sbjct  193  PNMPFLYAMDFVEVLKKKHASGT  215



>ref|XP_003608768.1| Vacuolar-processing enzyme [Medicago truncatula]
Length=366

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            D VGTRWAVL+AGS+GY NYRHQAD+CHAYQ+L  GG+K+ENIVVFMYDDIA NE NPR 
Sbjct  47   DEVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLIKGGVKEENIVVFMYDDIANNELNPRP  106

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            GVIIN+P G +VY GVPKDYTGD+VT +NL AVILGDKS VKGGSGKV++S   D IF+Y
Sbjct  107  GVIINHPQGPNVYVGVPKDYTGDNVTAENLYAVILGDKSKVKGGSGKVINSKSEDRIFIY  166

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            YSDHGGPGVLGMP  PY+YA D    LKKKHA+G
Sbjct  167  YSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASG  200



>gb|KJB70141.1| hypothetical protein B456_011G060200 [Gossypium raimondii]
Length=475

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 143/183 (78%), Gaps = 12/183 (7%)
 Frame = +2

Query  86   VAASLLLLTFSIVAVADGRD----FLKLPSearrffrpaeeenreaDGDDSVGTRWAVLI  253
            V A LLLL+ + + V+ GRD     L+LPSEA + F          D D   GTRWAVLI
Sbjct  6    VGAILLLLSLTRI-VSAGRDVTGDILRLPSEANKVFHGG-------DDDKVEGTRWAVLI  57

Query  254  AGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVIINNPHGED  433
            AGSNGYWNYR+QADICHAYQ+L+ GGLK+ENI+ FMYDDIAYNEENPR G+IINNPHG D
Sbjct  58   AGSNGYWNYRYQADICHAYQLLRNGGLKEENIIAFMYDDIAYNEENPRPGIIINNPHGND  117

Query  434  VYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDHGGPGVLG  613
            VY GVPKDYTG++VTV N  A ILG+KSA+ GGSGKVV+SGPNDHIF+YYSDHGGPGVL 
Sbjct  118  VYKGVPKDYTGENVTVHNFFAAILGNKSALTGGSGKVVNSGPNDHIFIYYSDHGGPGVLA  177

Query  614  MPT  622
              +
Sbjct  178  CES  180



>ref|XP_010646818.1| PREDICTED: vacuolar-processing enzyme [Vitis vinifera]
Length=494

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            DG++  GTRWAVL+AGS GY NYRHQAD+CHAYQ+LK GGLKDENIVVFMYDDIA ++ N
Sbjct  52   DGEER-GTRWAVLVAGSYGYGNYRHQADVCHAYQLLKRGGLKDENIVVFMYDDIATHDFN  110

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G+DVY GVPKDYTG+DVT  NL AV+LGDKS +KGGSGKVV+S PND I
Sbjct  111  PRPGVIINHPQGDDVYAGVPKDYTGEDVTAQNLFAVLLGDKSLLKGGSGKVVESKPNDRI  170

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YYSDHGG GVLGMP  P+LYA D    LK KHA+G+
Sbjct  171  FLYYSDHGGQGVLGMPNMPFLYAKDFIDVLKMKHASGS  208



>dbj|BAA09615.1| vacuolar processing enzyme [Arabidopsis thaliana]
Length=484

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +D VGTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA +  NPR
Sbjct  45   EDGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVLMYDDIANHPLNPR  104

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G +IN+P G+DVY GVPKDYTG  VT  N  AV+LGD+ AVKGGSGKV+ S PNDHIFV
Sbjct  105  PGTLINHPDGDDVYAGVPKDYTGSSVTAANFYAVLLGDQKAVKGGSGKVIASKPNDHIFV  164

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPGVLGMP +P++YA D    LKKKHA+GT
Sbjct  165  YYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGT  200



>ref|NP_176458.1| vacuolar-processing enzyme beta [Arabidopsis thaliana]
 sp|Q39044.3|VPEB_ARATH RecName: Full=Vacuolar-processing enzyme beta-isozyme; AltName: 
Full=Asparaginyl endopeptidase beta-VPE; AltName: Full=Beta-VPE; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56243.1|AF367254_1 At1g62710/F23N19_8 [Arabidopsis thaliana]
 gb|AAL15381.1| At1g62710/F23N19_8 [Arabidopsis thaliana]
 gb|AEE33996.1| vacuolar-processing enzyme beta [Arabidopsis thaliana]
Length=486

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  218  DDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPR  397
            +D VGTRWAVL+AGS+GY NYRHQAD+CHAYQIL+ GGLK+ENIVV MYDDIA +  NPR
Sbjct  45   EDGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVLMYDDIANHPLNPR  104

Query  398  KGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFV  577
             G +IN+P G+DVY GVPKDYTG  VT  N  AV+LGD+ AVKGGSGKV+ S PNDHIFV
Sbjct  105  PGTLINHPDGDDVYAGVPKDYTGSSVTAANFYAVLLGDQKAVKGGSGKVIASKPNDHIFV  164

Query  578  YYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            YY+DHGGPGVLGMP +P++YA D    LKKKHA+GT
Sbjct  165  YYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGT  200



>gb|AES90965.2| vacuolar processing enzyme [Medicago truncatula]
Length=373

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  221  DSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRK  400
            D VGTRWAVL+AGS+GY NYRHQAD+CHAYQ+L  GG+K+ENIVVFMYDDIA NE NPR 
Sbjct  54   DEVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLIKGGVKEENIVVFMYDDIANNELNPRP  113

Query  401  GVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVY  580
            GVIIN+P G +VY GVPKDYTGD+VT +NL AVILGDKS VKGGSGKV++S   D IF+Y
Sbjct  114  GVIINHPQGPNVYVGVPKDYTGDNVTAENLYAVILGDKSKVKGGSGKVINSKSEDRIFIY  173

Query  581  YSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAG  682
            YSDHGGPGVLGMP  PY+YA D    LKKKHA+G
Sbjct  174  YSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASG  207



>ref|XP_010259032.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=495

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  233  TRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVII  412
            T WAVL+AGS+G+ NYRHQAD+CHAYQ+L+ GGLK+ENIVVFMYDDIAY+E NP+ GVII
Sbjct  62   TTWAVLVAGSSGFGNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIAYSEFNPKPGVII  121

Query  413  NNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSDH  592
            N+P G DVY GVPKDYTG  VT +NL AV+LGDK+AV+GGSGKV+DS PND IF+YYSDH
Sbjct  122  NHPQGPDVYAGVPKDYTGKHVTANNLYAVLLGDKNAVQGGSGKVIDSKPNDRIFLYYSDH  181

Query  593  GGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            GGPGVLGMP  P+LYA D    LKKKHAAGT
Sbjct  182  GGPGVLGMPNMPFLYAVDFIEVLKKKHAAGT  212



>emb|CAA07639.1| cysteine proteinase precursor [Vicia sativa]
Length=503

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D +D +GTRWAVL+AGSNGY NYRHQAD+CHAYQ+L  GG+K+ENIVVFMYDDIAY+E N
Sbjct  59   DVEDEIGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGVKEENIVVFMYDDIAYSEFN  118

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIIN+P G +VY GVPKDYTGD VT DNL AVILGDKS V+GGSGKV++S   D I
Sbjct  119  PRPGVIINHPQGPNVYDGVPKDYTGDFVTADNLYAVILGDKSKVRGGSGKVINSKAEDRI  178

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAA  679
            F+YYSDHGGPGVLGMP  PY+YA D    LKKKHA+
Sbjct  179  FIYYSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHAS  214



>ref|XP_004245120.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Solanum 
lycopersicum]
Length=460

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D +DS+GT+WAVL+AGS  ++NYRHQA++CHAYQ+LK GGLKDE+I+VFMYDDIA N EN
Sbjct  31   DYEDSIGTKWAVLVAGSKEWYNYRHQANLCHAYQLLKKGGLKDEHIIVFMYDDIANNPEN  90

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIINNPHG DVY GVPKDYTG D    N  +VILG+KSA+ GGSGKVV+SGPND+I
Sbjct  91   PRPGVIINNPHGHDVYKGVPKDYTGKDCNAQNFYSVILGNKSALTGGSGKVVNSGPNDYI  150

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YY+DHG PG++GMP  P +YA DLN  LKKKHA+ T
Sbjct  151  FIYYTDHGAPGLVGMPEDPPVYAIDLNEVLKKKHASRT  188



>emb|CAB51545.1| vacuolar processing enzyme [Solanum lycopersicum var. cerasiforme]
Length=460

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  212  DGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEEN  391
            D +DS+GT+WAVL+AGS  ++NYRHQA++CHAYQ+LK GGLKDE+I+VFMYDDIA N EN
Sbjct  31   DYEDSIGTKWAVLVAGSKEWYNYRHQANLCHAYQLLKKGGLKDEHIIVFMYDDIANNPEN  90

Query  392  PRKGVIINNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHI  571
            PR GVIINNPHG DVY GVPKDYTG D    N  +VILG+KSA+ GGSGKVV+SGPND+I
Sbjct  91   PRPGVIINNPHGHDVYKGVPKDYTGKDCNAQNFYSVILGNKSALTGGSGKVVNSGPNDYI  150

Query  572  FVYYSDHGGPGVLGMPTSPYLYADDLNAALKKKHAAGT  685
            F+YY+DHG PG++GMP  P +YA DLN  LKKKHA+ T
Sbjct  151  FIYYTDHGAPGLVGMPEDPPVYAIDLNEVLKKKHASRT  188



>ref|XP_002983346.1| hypothetical protein SELMODRAFT_445464 [Selaginella moellendorffii]
 gb|EFJ15688.1| hypothetical protein SELMODRAFT_445464 [Selaginella moellendorffii]
Length=498

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  230  GTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFMYDDIAYNEENPRKGVI  409
            GTRWAVLIAGS GYWNYRHQAD+CHAYQ+L+ GG+++ENIVVFMYDDIA N  NPR GV+
Sbjct  45   GTRWAVLIAGSAGYWNYRHQADVCHAYQLLRRGGMREENIVVFMYDDIANNFANPRPGVM  104

Query  410  INNPHGEDVYHGVPKDYTGDDVTVDNLLAVILgdksavkggsgkvvdsgPNDHIFVYYSD  589
            IN+P+G++VY GVP DYTGD VTV+N LAV+ GDK A++GGSGKVV+SGPNDHIFV+YSD
Sbjct  105  INHPNGDNVYEGVPNDYTGDQVTVNNFLAVLRGDKEALQGGSGKVVESGPNDHIFVFYSD  164

Query  590  HGGPGVLGMPTSPYLYADDLNAALKKKH  673
            HGGPGVLGMP +PYLYA DL   LK  H
Sbjct  165  HGGPGVLGMPVTPYLYAVDLVTTLKDMH  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700