BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF048A14

Length=696
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGK82825.1|  alcohol oxidase                                         229   3e-66   Solanum pennellii
gb|AGK82821.1|  alcohol oxidase                                         228   4e-66   Solanum pimpinellifolium [currant tomato]
gb|AGK82832.1|  alcohol oxidase                                         228   7e-66   Solanum habrochaites
gb|AGK82806.1|  alcohol oxidase                                         228   8e-66   Solanum lycopersicum
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    228   9e-66   
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    224   3e-64   
ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        220   6e-63   Nicotiana tomentosiformis
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        220   8e-63   Nicotiana sylvestris
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    213   8e-61   
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    213   3e-60   Solanum lycopersicum
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    209   4e-59   Solanum tuberosum [potatoes]
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         202   1e-56   Jatropha curcas
emb|CDP07225.1|  unnamed protein product                                200   1e-55   Coffea canephora [robusta coffee]
ref|XP_006385149.1|  alcohol oxidase-related family protein             196   4e-54   
ref|XP_002519938.1|  electron carrier, putative                         192   4e-53   Ricinus communis
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    191   1e-52   Sesamum indicum [beniseed]
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    186   1e-50   Glycine max [soybeans]
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             186   2e-50   
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        185   2e-50   Populus euphratica
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             184   5e-50   Phaseolus vulgaris [French bean]
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            184   7e-50   Medicago truncatula
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    184   7e-50   Nelumbo nucifera [Indian lotus]
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    183   5e-49   
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        179   2e-48   Prunus mume [ume]
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             179   2e-48   
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    179   4e-48   Glycine max [soybeans]
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        179   5e-48   Glycine soja [wild soybean]
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    179   5e-48   Glycine max [soybeans]
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    177   8e-48   Sesamum indicum [beniseed]
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                177   8e-48   Erythranthe guttata [common monkey flower]
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  178   9e-48   Medicago truncatula
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             177   1e-47   Phaseolus vulgaris [French bean]
emb|CDX98615.1|  BnaA03g44000D                                          176   2e-47   
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    177   2e-47   Arabis alpina [alpine rockcress]
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    177   2e-47   Cicer arietinum [garbanzo]
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    177   3e-47   Glycine max [soybeans]
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        175   7e-47   Brassica rapa
emb|CDY01593.1|  BnaC07g35830D                                          175   7e-47   
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     175   8e-47   Eucalyptus grandis [rose gum]
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        175   1e-46   Eucalyptus grandis [rose gum]
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        174   2e-46   Vitis vinifera
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    174   3e-46   Brassica rapa
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  173   3e-46   Citrus sinensis [apfelsine]
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    172   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    173   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    173   5e-46   Citrus sinensis [apfelsine]
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             171   2e-45   Capsella rubella
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                171   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  171   3e-45   
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    170   9e-45   Cucumis melo [Oriental melon]
emb|CBI29206.3|  unnamed protein product                                168   1e-44   Vitis vinifera
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             169   1e-44   Citrus clementina [clementine]
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     168   1e-44   Eucalyptus grandis [rose gum]
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      168   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    168   3e-44   Cicer arietinum [garbanzo]
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    168   3e-44   Eucalyptus grandis [rose gum]
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             167   5e-44   
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370          167   5e-44   Amborella trichopoda
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    167   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    166   3e-43   
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    164   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   164   9e-43   
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    163   2e-42   
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        162   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    162   4e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    149   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    148   6e-37   Phoenix dactylifera
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        147   7e-37   Elaeis guineensis
gb|EPS64229.1|  hypothetical protein M569_10552                         145   4e-36   Genlisea aurea
gb|EPS61567.1|  hypothetical protein M569_13229                         144   6e-36   Genlisea aurea
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        143   6e-36   Glycine soja [wild soybean]
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        142   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    142   6e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    141   1e-34   Phoenix dactylifera
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    137   4e-33   
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         135   8e-33   Jatropha curcas
gb|ABR17814.1|  unknown                                                 129   2e-30   Picea sitchensis
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              125   6e-29   
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              124   9e-29   
gb|EPS58840.1|  hypothetical protein M569_15969                         121   9e-28   Genlisea aurea
gb|AGC65582.1|  fatty alcohol oxidase                                   120   3e-27   Simmondsia chinensis [goatnut]
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    117   3e-26   
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                116   5e-26   Erythranthe guttata [common monkey flower]
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     116   7e-26   Eucalyptus grandis [rose gum]
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         116   8e-26   Eucalyptus grandis [rose gum]
ref|XP_001763007.1|  predicted protein                                  114   3e-25   
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    114   3e-25   Cicer arietinum [garbanzo]
emb|CAN71289.1|  hypothetical protein VITISV_019349                     113   8e-25   Vitis vinifera
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    112   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    112   1e-24   
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    112   2e-24   
ref|NP_001142399.1|  uncharacterized protein LOC100274574               111   3e-24   Zea mays [maize]
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    111   3e-24   Setaria italica
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         111   4e-24   Vitis vinifera
gb|KDP40361.1|  hypothetical protein JCGZ_02359                         111   4e-24   Jatropha curcas
ref|XP_003607656.1|  Annotation was added to scaffolds in Novembe...    110   5e-24   
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    110   5e-24   Zea mays [maize]
gb|KEH15695.1|  long-chain-alcohol oxidase FAO1                         110   7e-24   Medicago truncatula
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    110   8e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            110   9e-24   Medicago truncatula
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              110   1e-23   
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              110   1e-23   
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         110   1e-23   Sesamum indicum [beniseed]
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    109   1e-23   Lotus japonicus
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    109   2e-23   Cucumis sativus [cucumbers]
ref|XP_002529832.1|  electron carrier, putative                         109   2e-23   Ricinus communis
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         109   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         109   2e-23   Cucumis melo [Oriental melon]
gb|EMT02982.1|  Putative GMC-type oxidoreductase                        108   2e-23   
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       108   2e-23   
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    108   2e-23   Solanum tuberosum [potatoes]
ref|XP_004157399.1|  PREDICTED: LOW QUALITY PROTEIN: puromycin-se...    109   2e-23   
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                         107   2e-23   Triticum urartu
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    108   2e-23   Cucumis sativus [cucumbers]
ref|XP_010038987.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    106   3e-23   
ref|XP_002314488.2|  alcohol oxidase-related family protein             108   3e-23   
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             107   4e-23   
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    108   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             107   5e-23   Citrus clementina [clementine]
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            107   6e-23   Medicago truncatula
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         107   8e-23   Populus euphratica
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             107   8e-23   
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         107   1e-22   Camelina sativa [gold-of-pleasure]
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         107   1e-22   Gossypium arboreum [tree cotton]
gb|ACF22878.1|  alcohol oxidase                                         107   1e-22   Glycine max [soybeans]
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    107   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    107   1e-22   Glycine max [soybeans]
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         107   1e-22   Glycine soja [wild soybean]
gb|KJB10007.1|  hypothetical protein B456_001G179800                    106   1e-22   Gossypium raimondii
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         106   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             106   1e-22   Citrus clementina [clementine]
gb|KJB10006.1|  hypothetical protein B456_001G179800                    106   2e-22   Gossypium raimondii
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2         106   2e-22   Nicotiana tomentosiformis
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   106   2e-22   Citrus sinensis [apfelsine]
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    106   2e-22   Camelina sativa [gold-of-pleasure]
gb|KJB72416.1|  hypothetical protein B456_011G177100                    105   2e-22   Gossypium raimondii
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         106   2e-22   Prunus mume [ume]
gb|KHG08529.1|  Long-chain-alcohol oxidase FAO2                         105   2e-22   Gossypium arboreum [tree cotton]
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             106   2e-22   Capsella rubella
dbj|BAJ86655.1|  predicted protein                                      106   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010501308.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    105   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    105   3e-22   Citrus sinensis [apfelsine]
gb|KJB72414.1|  hypothetical protein B456_011G177100                    105   3e-22   Gossypium raimondii
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    105   3e-22   
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    105   3e-22   Elaeis guineensis
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        105   4e-22   Glycine soja [wild soybean]
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         104   7e-22   Jatropha curcas
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             104   8e-22   Phaseolus vulgaris [French bean]
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    104   8e-22   Glycine max [soybeans]
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            104   1e-21   Glycine soja [wild soybean]
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    104   1e-21   Glycine max [soybeans]
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    103   1e-21   Solanum lycopersicum
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    103   1e-21   Cicer arietinum [garbanzo]
emb|CAA18625.1|  putative protein                                       103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2         103   2e-21   Nicotiana sylvestris
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    103   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006857358.1|  hypothetical protein AMTR_s00067p00112750          103   2e-21   
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    102   2e-21   
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             103   2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_007050220.1|  Alcohol oxidase                                    103   2e-21   
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             102   3e-21   Prunus persica
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    102   3e-21   Eucalyptus grandis [rose gum]
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             102   5e-21   Citrus clementina [clementine]
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         102   5e-21   Solanum lycopersicum
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         101   8e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                101   8e-21   Erythranthe guttata [common monkey flower]
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         101   1e-20   Sesamum indicum [beniseed]
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    100   1e-20   Solanum tuberosum [potatoes]
ref|XP_001753124.1|  predicted protein                                  100   1e-20   
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    100   1e-20   Solanum tuberosum [potatoes]
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    100   1e-20   Setaria italica
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         100   1e-20   Nicotiana sylvestris
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    100   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          100   2e-20   
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                       99.8    2e-20   Triticum urartu
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    100   2e-20   
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             100   2e-20   Eutrema salsugineum [saltwater cress]
gb|KGN53994.1|  hypothetical protein Csa_4G246400                     97.8    3e-20   
gb|KJB10008.1|  hypothetical protein B456_001G179800                    100   3e-20   Gossypium raimondii
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                     99.8    3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg              99.8    3e-20   Erythranthe guttata [common monkey flower]
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470        99.8    3e-20   Sorghum bicolor [broomcorn]
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  99.8    4e-20   Sesamum indicum [beniseed]
ref|XP_002311685.2|  alcohol oxidase-related family protein           99.4    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1       99.4    5e-20   Brassica rapa
emb|CDX89850.1|  BnaA10g02320D                                        99.4    5e-20   
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376           99.4    5e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  99.0    6e-20   Pyrus x bretschneideri [bai li]
emb|CDP11641.1|  unnamed protein product                              99.0    6e-20   Coffea canephora [robusta coffee]
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  98.2    8e-20   Cucumis sativus [cucumbers]
gb|AAK64154.1|  unknown protein                                       98.6    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  98.6    8e-20   Fragaria vesca subsp. vesca
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  98.6    8e-20   Prunus mume [ume]
emb|CDY18199.1|  BnaC05g02220D                                        98.6    8e-20   Brassica napus [oilseed rape]
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                  98.6    9e-20   Arabis alpina [alpine rockcress]
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089           98.2    1e-19   
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg           98.2    1e-19   Capsella rubella
emb|CDX94858.1|  BnaC03g43300D                                        98.2    1e-19   
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  98.2    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  98.2    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like  97.8    2e-19   Vitis vinifera
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  97.4    2e-19   Nicotiana tomentosiformis
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg           97.4    2e-19   Capsella rubella
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg           97.4    2e-19   Eutrema salsugineum [saltwater cress]
emb|CAC87643.1|  alcohol oxidase                                      97.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                    97.1    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1       97.1    3e-19   Zea mays [maize]
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  97.1    3e-19   Phoenix dactylifera
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                     97.1    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63097.1|  unknown                                               96.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935           96.7    3e-19   
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855           96.7    4e-19   
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                  96.3    5e-19   Morus notabilis
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  96.3    5e-19   Populus euphratica
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                       96.3    6e-19   Gossypium arboreum [tree cotton]
emb|CDX92985.1|  BnaA03g37070D                                        95.5    8e-19   
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                  95.5    8e-19   Arabis alpina [alpine rockcress]
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  95.5    1e-18   Elaeis guineensis
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906           95.5    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  95.5    1e-18   Cucumis melo [Oriental melon]
emb|CDX77517.1|  BnaA07g06550D                                        94.4    1e-18   
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B      95.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g           94.4    3e-18   Phaseolus vulgaris [French bean]
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3       94.4    3e-18   Brassica rapa
gb|KJB38384.1|  hypothetical protein B456_006G252500                  94.0    3e-18   Gossypium raimondii
emb|CDY51703.1|  BnaA03g58930D                                        93.6    4e-18   Brassica napus [oilseed rape]
ref|XP_004167305.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  93.2    4e-18   
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  93.6    5e-18   Phoenix dactylifera
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  93.2    6e-18   Setaria italica
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  93.2    6e-18   Brachypodium distachyon [annual false brome]
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855           93.2    6e-18   
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...  92.8    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  92.8    8e-18   Tarenaya hassleriana [spider flower]
emb|CDX92884.1|  BnaC07g41420D                                        92.8    9e-18   
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...  92.4    1e-17   Camelina sativa [gold-of-pleasure]
gb|EEC73620.1|  hypothetical protein OsI_08118                        92.0    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370        91.7    2e-17   Sorghum bicolor [broomcorn]
emb|CDX85097.1|  BnaC07g08090D                                        91.7    2e-17   
ref|NP_001176205.1|  Os10g0474966                                     91.3    2e-17   
ref|NP_001047464.1|  Os02g0621800                                     91.3    3e-17   
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  90.9    3e-17   Brassica rapa
dbj|BAK02336.1|  predicted protein                                    90.9    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC67160.1|  hypothetical protein OsI_34014                        90.9    4e-17   Oryza sativa Indica Group [Indian rice]
gb|EEE57396.1|  hypothetical protein OsJ_07570                        91.3    4e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMT04470.1|  Putative GMC-type oxidoreductase                      90.9    4e-17   
gb|EPS66779.1|  hypothetical protein M569_07992                       90.5    4e-17   Genlisea aurea
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                90.5    4e-17   
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  90.1    6e-17   Glycine max [soybeans]
emb|CDP03771.1|  unnamed protein product                              90.1    6e-17   Coffea canephora [robusta coffee]
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                90.1    6e-17   
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B      90.1    6e-17   Brassica rapa
ref|XP_006662437.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  89.4    7e-17   
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                       89.7    8e-17   Medicago truncatula
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  88.6    2e-16   Eucalyptus grandis [rose gum]
ref|XP_010529119.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  88.2    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  87.8    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  87.8    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  87.4    5e-16   
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g           86.3    1e-15   Phaseolus vulgaris [French bean]
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  86.3    1e-15   Setaria italica
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  85.9    1e-15   Setaria italica
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed          85.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148058.1|  oxidoreductase                                   85.5    2e-15   
ref|XP_002528823.1|  disulfide oxidoreductase, putative               85.5    2e-15   Ricinus communis
gb|ACN27562.1|  unknown                                               85.5    2e-15   Zea mays [maize]
gb|EMS67203.1|  Long-chain-alcohol oxidase FAO2                       83.6    2e-15   Triticum urartu
emb|CDX99381.1|  BnaC01g11710D                                        79.3    9e-15   
emb|CDY66155.1|  BnaA01g34940D                                        79.0    1e-14   Brassica napus [oilseed rape]
ref|XP_011462285.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...  82.8    1e-14   Fragaria vesca subsp. vesca
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...  82.4    2e-14   Fragaria vesca subsp. vesca
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390        82.0    3e-14   Sorghum bicolor [broomcorn]
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  81.6    4e-14   Tarenaya hassleriana [spider flower]
emb|CDO99261.1|  unnamed protein product                              81.3    5e-14   Coffea canephora [robusta coffee]
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...  80.5    9e-14   Tarenaya hassleriana [spider flower]
ref|XP_010644266.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  77.0    9e-14   Vitis vinifera
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1       80.1    1e-13   Pyrus x bretschneideri [bai li]
emb|CBI23676.3|  unnamed protein product                              79.3    2e-13   Vitis vinifera
gb|KGN53995.1|  hypothetical protein Csa_4G246410                     75.9    3e-13   
ref|XP_003607655.1|  Annotation was added to scaffolds in Novembe...  75.1    3e-13   
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...  78.6    3e-13   
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  75.9    3e-12   
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  75.9    3e-12   
gb|EEE51131.1|  hypothetical protein OsJ_31875                        75.1    4e-12   
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  73.9    1e-11   
gb|AAD10696.1|  Unknown protein                                       73.6    1e-11   
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...  73.2    2e-11   
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                    72.8    3e-11   
emb|CBI37146.3|  unnamed protein product                              70.5    1e-10   
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  69.3    3e-10   
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...  67.8    9e-10   
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308            65.9    4e-09   
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  65.5    7e-09   
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                       65.1    7e-09   
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460        65.1    7e-09   
gb|EMT04636.1|  hypothetical protein F775_13386                       63.2    3e-08   
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4              62.8    5e-08   
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                    62.8    5e-08   
gb|AAL31049.1|AC078893_12  putative oxidase                           62.8    5e-08   
emb|CDY66156.1|  BnaA01g34950D                                        61.6    1e-07   
ref|WP_044018575.1|  hypothetical protein                             61.2    1e-07   
gb|AII52338.1|  hypothetical protein N008_10155                       60.8    2e-07   
emb|CDX99382.1|  BnaC01g11700D                                        60.5    2e-07   
gb|KJB72415.1|  hypothetical protein B456_011G177100                  60.5    2e-07   
ref|NP_001064839.2|  Os10g0474800                                     59.7    4e-07   
gb|EEE51128.1|  hypothetical protein OsJ_31871                        58.9    4e-07   
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg           59.3    7e-07   
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                   59.3    7e-07   
gb|EEE51130.1|  hypothetical protein OsJ_31873                        58.9    8e-07   
ref|XP_006662436.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  58.5    1e-06   
gb|EEC67159.1|  hypothetical protein OsI_34012                        58.5    1e-06   
ref|XP_011459707.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  57.8    2e-06   
ref|WP_033369528.1|  hypothetical protein                             57.4    3e-06   
ref|XP_006648845.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  56.6    5e-06   
ref|WP_044510213.1|  hypothetical protein                             55.5    1e-05   
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                  54.7    2e-05   
ref|XP_008356208.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  52.8    2e-05   
ref|WP_019946571.1|  hypothetical protein                             54.3    3e-05   
gb|EAY78906.1|  hypothetical protein OsI_34009                        52.8    4e-05   
tpg|DAA49650.1|  TPA: hypothetical protein ZEAMMB73_468308            50.4    6e-05   
ref|XP_004309279.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  52.4    6e-05   
gb|EMT04635.1|  hypothetical protein F775_13385                       50.1    2e-04   
emb|CDI52877.1|  related to long chain fatty alcohol oxidase          52.0    2e-04   
dbj|BAK00483.1|  predicted protein                                    51.6    2e-04   
emb|CCF53187.1|  related to long chain fatty alcohol oxidase          51.6    2e-04   
emb|CBQ72264.1|  related to long chain fatty alcohol oxidase          51.2    4e-04   
ref|XP_009369440.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  48.5    6e-04   



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 176/236 (75%), Gaps = 8/236 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW++++R++HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE 
Sbjct  45   HLAWMLSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREE  104

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+ S+L+FI+  F A+K L LLVFFT V++KG NPSWKA+GYCG DP   ++++++
Sbjct  105  IVQSWSCSNLKFIKLLFVALKVLTLLVFFTQVNEKGQNPSWKALGYCGQDPDFKKQKQEK  164

Query  372  khhdheddie------eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSF  527
             +       E      E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF
Sbjct  165  MNSKQSKHEEFSDKRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSF  224

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFL
Sbjct  225  IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFL  280



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 175/236 (74%), Gaps = 8/236 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW++++R++HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F ++S  KRE 
Sbjct  45   HLAWMVSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSKVSPNKREE  104

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+ S+ + I+  F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++
Sbjct  105  IVQSWSCSNFKLIKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEK  164

Query  372  khhdheddie------eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSF  527
             +       E      E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF
Sbjct  165  MNSKQSKHEELSDKRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSF  224

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFL
Sbjct  225  IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFL  280



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 174/236 (74%), Gaps = 8/236 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW++++R++HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE 
Sbjct  45   HLAWMVSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREE  104

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+ S+ + I+  F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++
Sbjct  105  IVQSWSCSNFKLIKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEK  164

Query  372  khhdheddie------eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSF  527
             +       E      E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF
Sbjct  165  MNSKQSKHEEFSDKRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSF  224

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFL
Sbjct  225  IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFL  280



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 174/236 (74%), Gaps = 8/236 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW++++R++HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE 
Sbjct  45   HLAWMVSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREE  104

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+ S+ + I+  F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++
Sbjct  105  IVQSWSCSNFKLIKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEK  164

Query  372  khhdheddie------eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSF  527
             +       E      E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF
Sbjct  165  MNSKQSKHEELSDKRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSF  224

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFL
Sbjct  225  IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFL  280



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   228 bits (581),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 174/236 (74%), Gaps = 8/236 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW++++R++HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE 
Sbjct  73   HLAWMVSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREE  132

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+ S+ + I+  F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++
Sbjct  133  IVQSWSCSNFKLIKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEK  192

Query  372  khhdheddie------eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSF  527
             +       E      E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF
Sbjct  193  MNSKQSKHEELSDKRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSF  252

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFL
Sbjct  253  IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFL  308



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 172/236 (73%), Gaps = 8/236 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW++++R++HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE 
Sbjct  45   HLAWMVSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREE  104

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+ S+ + I+  F A+K L LLVFFT VD+K  NPSWKA+GYCG DP   + ++++
Sbjct  105  IVQSWSCSNFKLIKLLFVALKVLTLLVFFTQVDEKCQNPSWKALGYCGQDPDFKKPKQEK  164

Query  372  khhdheddie------eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSF  527
             +       E      E L+GPLYKGII L  P+  +FN+L KLG  V+KP      PSF
Sbjct  165  MNSKQSKHEEFSDKRDEHLYGPLYKGIITLKQPQNALFNKLQKLGFHVSKPNSSSNCPSF  224

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPS+D+MFL
Sbjct  225  IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSLDQMFL  280



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 171/236 (72%), Gaps = 12/236 (5%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW+I+ R++HPKLN   + LW LSTRIGTL+LCGK SLS+QFP+L  F  IS  KRE 
Sbjct  79   HIAWMISNRLQHPKLNLCKIALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNKREE  138

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+TS  + +R  F+A+K LVLLVFFT V++K  NPSWKA+GY GPDP   ++ +  
Sbjct  139  IVLSWSTSCFKLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKKQNQGP  198

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSF  527
            +  + E++    LFGPLY+GII L   ++  F RL K+G SV+KP            P F
Sbjct  199  QDQEEEEE----LFGPLYQGIISLKQSQKKTFERLQKIGFSVSKPHNFNNTRRSTECPDF  254

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             IECDAVVVGSG GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+M+L
Sbjct  255  TIECDAVVVGSGSGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYL  310



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 169/236 (72%), Gaps = 13/236 (6%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW+I+ R+ HPKLN   L LW LSTRIGTL+LCGK SLS+QFP+L  F  IS  +RE 
Sbjct  79   HIAWMISNRLHHPKLNLCKLALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNQREE  138

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SW+TS  + +R  F+A+K LVLLVFFT V++K  NPSWKA+GY GPDP   ++ +  
Sbjct  139  IVLSWSTSCFKLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKKQNQGV  198

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSF  527
            +  + E      LFGPLY+GII L   ++  F RL KLG SV+KP            P+F
Sbjct  199  QDQEEEQ-----LFGPLYQGIISLKQSQKKAFERLQKLGFSVSKPHNFNDTRRSTECPNF  253

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             IECDAVVVGSG GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+M+L
Sbjct  254  TIECDAVVVGSGSGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYL  309



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 171/236 (72%), Gaps = 11/236 (5%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW+IN R++HPK+N   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS KKRE 
Sbjct  7    HIAWMINNRLQHPKMNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPKKREE  66

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
             V SWATS  + +R  F A K LVLLVF+T V+D+  N SWKA+GY GPDP   +++++ 
Sbjct  67   SVKSWATSCFKLLRILFFAAKILVLLVFYTQVNDESQNSSWKALGYSGPDPDFKKQKQEN  126

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSF  527
             + + +DD     FGPLY+GII L   ++ +F+RL +LG SV+KP            P+F
Sbjct  127  MNSNEKDDQP---FGPLYEGIISLKNSQKIIFHRLQELGFSVSKPHNFKNARRSTECPAF  183

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEG SMD+M+L
Sbjct  184  IIECDAVVVGSGSGGGVIAGILANAGHKVLVLEKGSYLARTNLSLLEGTSMDQMYL  239



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 171/236 (72%), Gaps = 11/236 (5%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +AW+IN R++HPK+N   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS KKRE 
Sbjct  81   HIAWMINNRLQHPKMNLCRLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPKKREE  140

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
             V SWATS  + +R  F A K LVLLVF+T V+D+  N SWKA+GY GPDP   +++++ 
Sbjct  141  SVKSWATSCFKLLRILFFAAKILVLLVFYTQVNDENKNSSWKALGYSGPDPDFKKQKQEN  200

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSF  527
             +   +DD     FGPL++GII L   ++ +F+RL +LG SV+KP            P+F
Sbjct  201  MNSKKKDDQP---FGPLHEGIISLKNSQKIIFHRLQELGFSVSKPHNFNNARRSTECPAF  257

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            +IECDAVVVGSG GGGVI+G+LA AG+KV+VLEKG+Y AR+NLSLLEGPSMD+M+L
Sbjct  258  IIECDAVVVGSGSGGGVIAGILANAGHKVIVLEKGSYLARSNLSLLEGPSMDQMYL  313



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 169/236 (72%), Gaps = 11/236 (5%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            Q+AW+I+ R++HP+LN   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS KKRE 
Sbjct  12   QMAWMISNRLQHPRLNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQNFSNISPKKREE  71

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SWATS  + +R  + AMK LVLLVFFT V+++  NPSWKA+GY GPD    +++++ 
Sbjct  72   IVKSWATSCFKLLRILYFAMKVLVLLVFFTQVNEESQNPSWKALGYIGPDLDFKKQKQEN  131

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSF  527
             +   +DD     FGPLY+GII L   ++  F+RL KLG SV+KP            P+F
Sbjct  132  MNSKKKDDQP---FGPLYEGIISLKNSQKITFDRLKKLGFSVSKPHNFKNAKRSTECPAF  188

Query  528  VIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             IE D VVVGSG GGGVI+G+LA AG+KVLVLEKG+Y AR+NLSLLEG SMD+M+L
Sbjct  189  TIESDVVVVGSGSGGGVIAGILANAGHKVLVLEKGSYLARSNLSLLEGTSMDQMYL  244



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 169/231 (73%), Gaps = 3/231 (1%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  +I+QR+KHPK   + ++LW LSTR+GT +LCG  S+ST FPF L+F +I   KRE+
Sbjct  79   RIGGLISQRLKHPKKWLIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREK  138

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+HSW+ S    +R  F  +K L LLVFF+ VD+KG+N +WKA+ Y GPDP   ++Q+  
Sbjct  139  ILHSWSLSFFSLLRMLFKTVKLLCLLVFFSQVDEKGENLAWKAMDYPGPDPEFKKEQEAA  198

Query  372  -khhdheddieeLLFGPLYKGIIDLNLPEEHVFN--RLTKLGCSVAKPKPPGPSFVIECD  542
             K   + ++ +E LFGPLYKG+ID+NLP +   N  RL+       +PK   PS VI+CD
Sbjct  199  LKLVKNNEEEKEKLFGPLYKGLIDMNLPRDITANSLRLSGFPVFTYRPKINNPSLVIKCD  258

Query  543  AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            AVVVGSG GGGV++GVLA AGYKV+V+EKGNY+AR+NLSLLEGPSMD+M+L
Sbjct  259  AVVVGSGSGGGVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPSMDQMYL  309



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 169/242 (70%), Gaps = 18/242 (7%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I++R++HPKL    L LWFLST IGT  +CG  SLS  FP+L +F ++S +KRE+IV S
Sbjct  97   LISERLQHPKLFMARLALWFLSTSIGTFAMCGIASLSGNFPYLQKFSQVSPEKREQIVLS  156

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP----------SIS  353
            W+ S +  +R  FTA+K L+LLVFF+ VDDK +N SWKAIGYCGPDP          ++ 
Sbjct  157  WSRSIIFPLRLLFTALKVLILLVFFSQVDDKEENLSWKAIGYCGPDPDFKRQTQRIKTLK  216

Query  354  ekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--------AKPK  509
            +  +  +    ++   E LFGPLYKGI++L+ P++ VF +L   G SV        AK K
Sbjct  217  QMFESAEDQKQDEASAEELFGPLYKGIVNLDRPKQFVFEKLQNAGFSVSASSHLKNAKSK  276

Query  510  PPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKM  689
               PSF I+CDAVVVGSG GGGV++G+LA AGYK LVLEKGNY+ARTNLSLLEG +MD+M
Sbjct  277  YNRPSFRIKCDAVVVGSGSGGGVVAGILAKAGYKTLVLEKGNYFARTNLSLLEGSTMDQM  336

Query  690  FL  695
            +L
Sbjct  337  YL  338



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 165/239 (69%), Gaps = 11/239 (5%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +V  +   R++HPK   + L L+ LST IGT +LCG  S+S  FP+ LRF +ISQ KRE+
Sbjct  49   RVGELFCDRVQHPKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFLRFSQISQSKREQ  108

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SWATS    +R  F ++K ++ LVFF+ VD+K +N +WKAIGY GPDP+  ++Q + 
Sbjct  109  IVFSWATSFFYLLRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDPAALKRQTQT  168

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK---------PPG  518
                     +E LFGPLY+G++DLNLP + V + L ++G   S+ + K            
Sbjct  169  CGLPETLYAKEHLFGPLYRGLVDLNLPRDRVADSLRQIGFPVSIRRGKDIDSSRDFSTSN  228

Query  519  PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNY+AR NLSLLEGPSMD+M+L
Sbjct  229  PSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLSLLEGPSMDQMYL  287



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 124/255 (49%), Positives = 164/255 (64%), Gaps = 25/255 (10%)
 Frame = +3

Query  6    NLQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  185
            + Q+  +I++R+KHPK   + L LW LST IGT +LCG  S+ST FP+   F +++  KR
Sbjct  5    DWQLGGLISERLKHPKKWLIRLALWMLSTWIGTFILCGVASISTHFPYFQSFSQLTLHKR  64

Query  186  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  365
            E+I+HSW+ S L  +R  F AMK L+LLVFF+ VD+K +N +WKAIGY GPDP     + 
Sbjct  65   EKILHSWSLSFLYPLRMLFKAMKLLILLVFFSQVDEKNENLTWKAIGYPGPDPQFKVDKW  124

Query  366  kqkhhd-----------------------heddieeLLFGPLYKGIIDLNLPEEHVFNRL  476
            +                             E + E  LFGPL++GI+D+NLP + V N L
Sbjct  125  EALKLSPYARFTDKQLERKEEEEEEEEEEEEGEDELKLFGPLHRGIVDMNLPRDAVANSL  184

Query  477  TKLGCSV--AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYART  650
             +LG S+   +PK      VI CDAVVVGSG GG V++G LA AGYKVLVLEKGNY+AR+
Sbjct  185  QRLGFSILANRPKKYYSPLVIRCDAVVVGSGSGGSVVAGALAKAGYKVLVLEKGNYFARS  244

Query  651  NLSLLEGPSMDKMFL  695
            NLSLLEGP+MD+M+L
Sbjct  245  NLSLLEGPTMDQMYL  259



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 166/246 (67%), Gaps = 18/246 (7%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             V   +  +++HPK+    L +  LSTRIG+L+LCG+ SLS +FP+   F ++S ++RE 
Sbjct  59   HVGEFLGGKVEHPKMCLARLAIMLLSTRIGSLILCGRKSLSPKFPYFQTFSKVSCERREE  118

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+TSS   +R  FTA+K   LL+FFT V++KG+N SWKAIGYCGPDP  ++ ++  
Sbjct  119  ILLSWSTSSFLLLRILFTALKIFTLLLFFTQVNEKGENLSWKAIGYCGPDPGCTKTRRLN  178

Query  372  khhdhe-----------ddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP----  506
              +  +              +E LFG LYKGII+L+ P E   ++L  LG SV+ P    
Sbjct  179  AENTQQPPEECEEKLADGASKEELFGSLYKGIINLSQPREDPLSKLQNLGFSVSIPHSRN  238

Query  507  ---KPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  677
               K   PSF+++CDAVVVGSG GGGV++GVLA AG+KVLVLEKG+Y+AR NLSLLEG +
Sbjct  239  RRMKSLNPSFIVKCDAVVVGSGSGGGVMAGVLANAGHKVLVLEKGSYFARANLSLLEGEA  298

Query  678  MDKMFL  695
            MD+M+L
Sbjct  299  MDQMYL  304



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 166/237 (70%), Gaps = 13/237 (5%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I++++KHP    LLL LW LST  GT +LCG  SLST+FPF   +PE+S  KR++++ S
Sbjct  131  LISEKLKHPSTWLLLLTLWLLSTWFGTFILCGTLSLSTKFPFFHSYPELSLLKRQKVMQS  190

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek------qk  365
            W+ S L+ +R FF  +K L LLVFFT +D+  DNPSWKAIGYCGPDP    +       K
Sbjct  191  WSLSYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDPEFKSQLKNHFFTK  250

Query  366  kqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP------PGPS  524
            ++   + EDD  E + GPLYKG+I +N P + + + L ++G SV A PK         PS
Sbjct  251  QRGQEEKEDDGTEDVRGPLYKGLIRINNPRDIITDSLRRVGFSVSATPKKTKASTLSSPS  310

Query  525  FVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+L
Sbjct  311  LVIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMYL  367



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 165/247 (67%), Gaps = 19/247 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +V  +I++RMKHPKL  + L LWFLST IG+ +LCG+ SLS+QFP+   FP++SQ+KRE 
Sbjct  98   RVGGLISERMKHPKLWLMRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREE  157

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+ S    +R  F +MK L LLVFFT V++K +N SWKAI Y GPDP    K KK 
Sbjct  158  ILLSWSLSYFYLLRMLFKSMKLLTLLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKF  217

Query  372  khhdheddi------------eeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK  509
            K                    +E LFGPL +GII+L+ P++ V + L+  G   SV   +
Sbjct  218  KASTTIGSQRPNNEEQNACPHKEELFGPLNRGIINLDKPKDLVVDALSTFGIPASVLHSE  277

Query  510  -----PPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGP  674
                    PS  I CDAVV+GSG GGGV++GVLATAGYKV+V+EKGNY+AR NL+LLEGP
Sbjct  278  KTVNCSSNPSLTIRCDAVVIGSGSGGGVVAGVLATAGYKVVVIEKGNYHARKNLTLLEGP  337

Query  675  SMDKMFL  695
            +MD+M+L
Sbjct  338  AMDQMYL  344



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 167/252 (66%), Gaps = 24/252 (10%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +V  +  +R++HPK   + L L+ LST IGT +LCG  S+S  FP+  RF +ISQ KRE+
Sbjct  94   RVGELFCERVQHPKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFQRFSQISQSKREQ  153

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            IV SWATS    +R  F ++K ++ LVFF+ VD+K +N +WKAIGY GPDP+  ++Q + 
Sbjct  154  IVFSWATSFFYLLRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDPAALKRQTQT  213

Query  372  -------------khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKP  506
                            D  D  EE LFGPLY+G++DLNLP + V + L ++G   S+ + 
Sbjct  214  CGQPETLYASLKDDDDDEHDCKEEHLFGPLYRGLVDLNLPRDRVADSLRQIGFPVSILRG  273

Query  507  K---------PPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLS  659
            K            PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNY+AR NLS
Sbjct  274  KNIDSSRDFSTSNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLS  333

Query  660  LLEGPSMDKMFL  695
            LLEGPSMD+M+L
Sbjct  334  LLEGPSMDQMYL  345



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 164/242 (68%), Gaps = 18/242 (7%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I++++KHP    LLL LW LST  GTL+LCG  S+S++FPF   +PE+S  KR+R++ S
Sbjct  115  LISEKVKHPSTWLLLLTLWLLSTWFGTLILCGMASVSSRFPFFHSYPEMSLLKRQRVMQS  174

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI-----------  350
            W+ S L+ +R FF  +K L LL FFT VD+  +NPSWKAIGYCGPDP             
Sbjct  175  WSLSYLRPLRMFFRTIKLLTLLTFFTQVDEAEENPSWKAIGYCGPDPEFKAQLKNNFLHR  234

Query  351  SekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-------KPK  509
            + K+++ +  D +DD EE   GPL+KG++ LN P + + N L + G SV+          
Sbjct  235  TSKEEQHQKKDDDDDEEEEFRGPLHKGLVHLNYPRDMIKNSLRRFGFSVSTISKKHEASN  294

Query  510  PPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKM  689
               PS VI+CDAVVVGSG GGGV +GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M
Sbjct  295  LSSPSLVIQCDAVVVGSGSGGGVAAGVLANAGYKVLVLEKGSYCARNNLSLLEGPSMDQM  354

Query  690  FL  695
            +L
Sbjct  355  YL  356



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 165/244 (68%), Gaps = 17/244 (7%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  +I++R+ HP    L L+LWFLST +GT++LCG G LST+FPF+  FP++   KR++
Sbjct  123  RLGGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQ  182

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPS--------  347
            I+ SW+ S  + +R FF  +K L LL+FFT VD+  DN SWKAIGYCGPDP         
Sbjct  183  IMQSWSLSFFRHLRMFFRTIKLLTLLIFFTQVDESEDNCSWKAIGYCGPDPEFKAQLKNH  242

Query  348  -ISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAK-----  503
             +    K+++  +  D+  EL  GPLYKG++ LN P + + + L + G   SV++     
Sbjct  243  FLHGACKEKQDSEEGDNDAELAIGPLYKGLVHLNYPRDIIVDTLRRFGFPVSVSRRKQKT  302

Query  504  -PKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSM  680
             P    PS V++CDAVVVGSG GGGV++G+LA AGYKVLVLEKG Y AR NLSLLEGP+M
Sbjct  303  APSLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKVLVLEKGGYSARNNLSLLEGPTM  362

Query  681  DKMF  692
            D+M+
Sbjct  363  DQMY  366



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 151/234 (65%), Gaps = 8/234 (3%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            V   ++ +++HP L  LLL LW LST  GT +LCG  SLSTQFP+  RF ++SQKKRE+I
Sbjct  110  VGGFLSGKIEHPMLGVLLLALWLLSTWFGTFILCGIPSLSTQFPYFQRFSQVSQKKREKI  169

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            + SW++SS    R  F  +K LV  +FFT VD+  +NP+W+ I YCGPDP      + ++
Sbjct  170  LLSWSSSSFNIYRMLFKTLKYLVFFIFFTQVDENNENPTWRGIDYCGPDPDF-INNRTRE  228

Query  375  hhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-------KPKPPGPSFVI  533
                +    E LF PLY+GI+++  P E +   L + G  V         P P  PS  I
Sbjct  229  TKTPQGHEHEELFEPLYRGIVNMRQPREALAETLRQSGFHVRLHPHRRYNPSPSHPSLTI  288

Query  534  ECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             CDAVVVGSG GGGV +G+LA AGYKV VLEKGNY+ R NLSLLEGPSMD+M+L
Sbjct  289  RCDAVVVGSGSGGGVAAGILAKAGYKVAVLEKGNYFGRKNLSLLEGPSMDEMYL  342



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   183 bits (465),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 160/249 (64%), Gaps = 21/249 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +V  ++++RM+HPK   + L LW LST +GT +LCG  SLST FPF   F ++SQ+KRE 
Sbjct  432  RVGGLLSERMEHPKKWMIRLALWLLSTWLGTFVLCGPRSLSTNFPFFHTFSQLSQQKREE  491

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+ S    +R  F + K L LLVFF+ VD+K  N SWKAIGYCGPDP    +  + 
Sbjct  492  ILLSWSLSFFYHLRMLFKSTKLLTLLVFFSQVDEKNQNLSWKAIGYCGPDPEFQPQASRL  551

Query  372  khhdheddieeLL--------------FGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-KP  506
            K          +               +GPL +G+I+L  P + V + L + G  V+ +P
Sbjct  552  KTSKQNGYGNFICKEQECKEDGEKEERYGPLCRGLINLKHPRDVVADNLLRFGLPVSVRP  611

Query  507  K---PPG---PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLE  668
            K   PP    PS  I+CDAV+VGSG GGGV++GVLA AGYKVLVLEKGNY+AR+NLSLLE
Sbjct  612  KKINPPNLSHPSLTIKCDAVIVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARSNLSLLE  671

Query  669  GPSMDKMFL  695
            GPSMD+M++
Sbjct  672  GPSMDQMYM  680



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 163/247 (66%), Gaps = 19/247 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +V  +I++R+KHPKL  + L LWFLST IG+ +LCG+ SLS+QFP+   FP++SQ+KRE 
Sbjct  42   RVGGLISERLKHPKLWLMRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREE  101

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+ S    +R  F  MK L  LVFFT V++K +N SWKAI Y GPDP    K KK 
Sbjct  102  ILLSWSLSYFYLLRMLFKTMKLLTFLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKF  161

Query  372  khhdheddi------------eeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK  509
            K      +             EE LFGPL + II+L+ P++ V + L+  G   SV   +
Sbjct  162  KASTTIGNQRPNNEEQNACPHEEELFGPLNRCIINLDKPKDLVVDALSTFGIPASVLHSE  221

Query  510  -----PPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGP  674
                 P  PS  I CDAVV+GSG GGGV++GVLA AGYKV+V+EKGNY+AR NL+LLEGP
Sbjct  222  KTVNCPSNPSLTIRCDAVVIGSGSGGGVVAGVLAKAGYKVVVIEKGNYHARKNLTLLEGP  281

Query  675  SMDKMFL  695
            +MD+M+L
Sbjct  282  AMDQMYL  288



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 153/235 (65%), Gaps = 7/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +I++R+ HPK   L   +W LST IG+L+LCG+ S +++FP+  RF  + +K+RE 
Sbjct  43   RVARLISERLDHPKKWILRAAMWSLSTWIGSLVLCGRRSFTSEFPYFQRFCRLPEKQREE  102

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ +WA+S    +R  F ++K +  LVFFT VD+KG N +WKAIGY GP    S+  ++ 
Sbjct  103  ILLNWASSYFLLLRMLFRSIKLITSLVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHDEEL  162

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFV  530
                 +    E +FGPLY GIIDL  P E V  +LT  G  V   K          P   
Sbjct  163  NEKKTKKKKPEEIFGPLYNGIIDLKNPREAVVKKLTGHGFRVLTQKRNKNGSSISDPVMT  222

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I+CDAVVVGSG GGGV++GVLA AGYKVLV+EKGNYYAR  LSLLEG +MD+M+L
Sbjct  223  IQCDAVVVGSGSGGGVVAGVLAKAGYKVLVVEKGNYYARNKLSLLEGQAMDEMYL  277



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 158/243 (65%), Gaps = 19/243 (8%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I++R+KHP    L  +LW LST  GTL+ CG G LSTQFPF+  +P +S +KR++I+ S
Sbjct  106  MISERLKHPLTGLLKFVLWLLSTWYGTLIFCGIGCLSTQFPFIHAYPHLSLQKRQKIMRS  165

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq----  371
            W+ S L+  R  F  +K L LL+FFT +D+  DN +WKAIGYCGPDP    + K      
Sbjct  166  WSLSYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFKAQLKNHFLDG  225

Query  372  ------khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG---  518
                  +    ED+  E + GPLYKG++ LN P++   + L + G   SV + K      
Sbjct  226  TSKGGGQEDKEEDEDAEEMIGPLYKGLVHLNYPQDITADALRRFGFPVSVIRRKHKAAAA  285

Query  519  ----PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDK  686
                PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y A+ NLSLLEGP+MD+
Sbjct  286  NLSCPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSAKNNLSLLEGPTMDQ  345

Query  687  MFL  695
            M+L
Sbjct  346  MYL  348



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 157/240 (65%), Gaps = 16/240 (7%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I++++KHP    L  +LW LST  GTL+ CG G  STQFPF+  +P++  +KR++I+ S
Sbjct  111  MISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPLQKRQQIMRS  170

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek--------  359
            W+ S L+  R  F  +K L LL+FFT +D+  DN +WKAIGYCGPDP    +        
Sbjct  171  WSLSYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFKARLKSHFLDG  230

Query  360  qkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG-----  518
              K    D ED+  E + GPLYKG++ LN P +   + L +LG   SV + K        
Sbjct  231  TSKGGQEDKEDEDAEEVIGPLYKGLVHLNYPRDITADALKRLGFPVSVIRQKHKAAANLS  290

Query  519  -PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y AR NLSLLEGP+MD+M+L
Sbjct  291  SPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSARNNLSLLEGPTMDQMYL  350



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 157/240 (65%), Gaps = 16/240 (7%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I++++KHP    L  +LW LST  GTL+ CG G  STQFPF+  +P++  +KR++I+ S
Sbjct  111  MISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPLQKRQQIMRS  170

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek--------  359
            W+ S L+  R  F  +K L LL+FFT +D+  DN +WKAIGYCGPDP    +        
Sbjct  171  WSLSYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFKARLKSHFLDG  230

Query  360  qkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG-----  518
              K    D ED+  E + GPLYKG++ LN P +   + L +LG   SV + K        
Sbjct  231  TSKGGQEDKEDEDAEEVIGPLYKGLVHLNYPRDITADALKRLGFPVSVIRQKHKAAANLS  290

Query  519  -PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y AR NLSLLEGP+MD+M+L
Sbjct  291  SPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSARNNLSLLEGPTMDQMYL  350



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 164/241 (68%), Gaps = 13/241 (5%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             VA ++  +++HPK+    L +  LSTRIGT +LCG+ SL  +FP+   F E+  ++RE+
Sbjct  59   HVAELLGGKIEHPKIYLGRLAVGLLSTRIGTFVLCGRKSLCPKFPYFQTFSEVPYEEREQ  118

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+TS+   +R  FTA+K   LL+FFT V++KG+N SWKAIGYCGPDP  ++ +  +
Sbjct  119  ILRSWSTSNFLLLRILFTALKFFTLLLFFTQVNEKGENLSWKAIGYCGPDPGCAKTRILK  178

Query  372  kh------hdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPP------  515
                       +   ++ LFGPLYKGII+L+   E   ++L  LG  V+ P         
Sbjct  179  TSGPQECEEKEDGASQDELFGPLYKGIINLDQSREEALHKLQSLGFPVSTPHSRNRRLMS  238

Query  516  -GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
              PSF+++CDAVVVGSG GGGV++GVLA AG+KVLVLEKG+Y+ARTNLSLLEG +MD+M+
Sbjct  239  LNPSFIVKCDAVVVGSGSGGGVVAGVLANAGHKVLVLEKGSYFARTNLSLLEGEAMDQMY  298

Query  693  L  695
            L
Sbjct  299  L  299



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 157/245 (64%), Gaps = 18/245 (7%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            VA  I +++KHPK+    + +  LST IGT +LCG+ SLS  FP+L RF  +   KRE I
Sbjct  62   VAEFIAEKVKHPKILLAKVAVKMLSTWIGTFILCGRKSLSDDFPYLQRFSRVESLKREEI  121

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISe-----k  359
            + SW+ S    +R  F+A+K  +L  FFT VD+K DN SWKAIGYCGPDP         +
Sbjct  122  LLSWSNSCFSLLRILFSALKIFILFTFFTQVDEKEDNISWKAIGYCGPDPDFKTRKPQYQ  181

Query  360  qkkqkhhdheddieeLLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPP-------  515
            + +QK  +    IEE LFGPL+KGII+  + P E    +L   G + A    P       
Sbjct  182  ECEQKEENDHKSIEEDLFGPLHKGIINFSHQPIEKSLRKLRDSGFTTAVVSKPYSEKNTS  241

Query  516  -----GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSM  680
                  PSFV++CDAV+VGSG GGGV++GVLA AG+KV+VLEKG+Y AR+NLSLLEG ++
Sbjct  242  VGSLLNPSFVLKCDAVIVGSGSGGGVVAGVLAKAGHKVVVLEKGSYLARSNLSLLEGEAL  301

Query  681  DKMFL  695
            D+M+L
Sbjct  302  DQMYL  306



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 165/244 (68%), Gaps = 17/244 (7%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            VA ++++++KHP    L L LW LST  GTL+LCG  S+ST+FPF   +P++S +KR+++
Sbjct  109  VANLVSEKLKHPSTWLLKLTLWLLSTWFGTLILCGIASISTKFPFFHSYPKLSPEKRQKV  168

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            + SW+ S L+ +R  F  +K L LLVFFT VD++ +NPSWKAIGY GPD     ++K + 
Sbjct  169  MLSWSVSYLRPLRMLFRTIKLLTLLVFFTQVDEEKNNPSWKAIGYSGPDQEFKAQRKNKI  228

Query  375  hhdhedd----------ieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP----  512
             H    +           +E + GPLY+G+++LN P + + + L + G  V+   P    
Sbjct  229  LHKTSKEGRQEKEDCDHDDEEVIGPLYEGLVNLNYPRDIISDSLRRFGFPVSVTPPTNKA  288

Query  513  ---PGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMD  683
                 PS VI+CDAVVVGSG GGGV++GVLA +GYKVLVLEKG+Y+AR NLSLLEGP++D
Sbjct  289  STISSPSLVIQCDAVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYFARNNLSLLEGPTLD  348

Query  684  KMFL  695
            +M+L
Sbjct  349  QMYL  352



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 163/240 (68%), Gaps = 16/240 (7%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I +++KHP    L L+LW LST  GTL+LCG G +ST+FPF+  +P++S +KR++I+ S
Sbjct  110  MICEKLKHPMTGLLKLVLWALSTWFGTLILCGMGCVSTKFPFIHSYPDLSVEKRQQIMRS  169

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek--------  359
            W+ S ++ +R  F  +K L LL+FFT +D+  DN SWKAIGYCGPDP    +        
Sbjct  170  WSLSYIRHLRQLFRTIKLLTLLIFFTQLDESEDNLSWKAIGYCGPDPEFKAQLKNHFLEG  229

Query  360  qkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG-----  518
            + K+   D ED+  E + GPLYKG++ LN P +   + L ++G   SV + K        
Sbjct  230  KSKRGEEDKEDEDVEEVIGPLYKGLVHLNNPRDITADALRRIGFPVSVIRRKHKAAANLS  289

Query  519  -PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y+AR NLSLLEG +MD+M+L
Sbjct  290  SPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYFARNNLSLLEGQTMDQMYL  349



>emb|CDX98615.1| BnaA03g44000D [Brassica napus]
Length=663

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 154/235 (66%), Gaps = 7/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +++QR+ HPK   L + LW LST IG+L+LCG+ S    FPF  RF  + +K+RE 
Sbjct  86   RVARLMSQRLHHPKKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREE  145

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
             + +WA+S    +R FF ++K +  LVFFT VD+KG N +WKAIGY GP    S+ +++ 
Sbjct  146  TLLNWASSYFLLLRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEEL  205

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK-------PPGPSFV  530
                    + + +FGPLY GII+L  P E V  +LT  G +V+  K          P   
Sbjct  206  NETKTNKKMPKEIFGPLYNGIINLKKPREAVTKKLTDHGFTVSTQKSNNNRSSISNPVMT  265

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLS LEG +MD+M+L
Sbjct  266  IRCDAVVVGSGSGGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDEMYL  320



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 161/235 (69%), Gaps = 8/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++++R+ HPK   L + LWFLST IG+L+LCG+ S S +FP+  RF ++ +K+RE 
Sbjct  68   RVARLMSERLDHPKKWILRVGLWFLSTWIGSLILCGRKSFSGEFPYFRRFCKLPEKQREE  127

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ +W++S +  IR  F ++K +  LVFFT +D++G N +WKAIGY GP  S     +++
Sbjct  128  ILLNWSSSYIVLIRMLFRSLKLITALVFFTQLDEQGQNLAWKAIGYNGP-TSDDSDHEEE  186

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFV  530
             +   +    E +FGPLY GIIDL  P + V  +LT  G +V+ PK          P   
Sbjct  187  LNEKKKKKKPEEIFGPLYNGIIDLTNPRDAVAKKLTGRGFTVSTPKSNKNGSFISDPVMT  246

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++GVLA AGYKVLV+EKGNYYAR+NLSLLEG ++D+M+L
Sbjct  247  IRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVEKGNYYARSNLSLLEGQALDEMYL  301



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 159/245 (65%), Gaps = 19/245 (8%)
 Frame = +3

Query  15   VAWVINQRMK-HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            V  VI++R+  HP    L  +LW LST +GT++LCG    ST+FPF+  FP +   KR+R
Sbjct  107  VGGVISERLNYHPMTWLLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQR  166

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkk-  368
            I+ SW+ S  + +R FF  +K L LLVFFT +D+  DN SWKAIGYCGPDP    + +  
Sbjct  167  IMQSWSLSFFRHLRMFFKTIKLLTLLVFFTQIDESEDNCSWKAIGYCGPDPEFKAQLRNH  226

Query  369  ---------qkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPP  515
                     Q+  + ++D  E + GPLYKG++ LN P +   + L + G   SV + KP 
Sbjct  227  FLHRTCKGGQESEEGDEDDAEQVIGPLYKGLVHLNCPRDITADALRRFGFPVSVTRRKPK  286

Query  516  G------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  677
                   PS VI+CDAVVVGSG GGG+++G+LA AGYKVLVLEKG Y AR+NLSLLEGP+
Sbjct  287  AAANLSSPSLVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVLEKGGYSARSNLSLLEGPT  346

Query  678  MDKMF  692
            +D+M+
Sbjct  347  LDQMY  351



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 159/241 (66%), Gaps = 17/241 (7%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I+++++HP    LLL LW LST  GT +LCG  SLST+FPF   +PE+S  K+++++ S
Sbjct  130  LISEKLRHPSTWLLLLSLWLLSTWFGTFILCGMLSLSTKFPFFHSYPELSLLKQQKVMQS  189

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  383
            W+ S L+ +R  F  +K L LLVFFT +D+  DNPSWKAI YCGPDP    + K      
Sbjct  190  WSLSYLRPLRMLFRTIKLLTLLVFFTQLDEAEDNPSWKAINYCGPDPEFKSQLKNHFFTK  249

Query  384  heddieeL----------LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP------  512
                 E+           + GPLYKG+I +N P + + + L ++G SV A PK       
Sbjct  250  ERGQEEKEDEDYDDGTEDVRGPLYKGLIYINYPRDIITDSLRRVGFSVSATPKKTKASSL  309

Query  513  PGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
              PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+
Sbjct  310  SSPSLVIQCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMY  369

Query  693  L  695
            L
Sbjct  370  L  370



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 158/235 (67%), Gaps = 7/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++++R+ HPK   L + LW LST IG+L++CG+ S + ++P+  RF  + + +RE 
Sbjct  86   RVARLMSERLHHPKKWILRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRFCWLPETQREE  145

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ +WA+S    +R FF ++K +   VFFT VD+KG+N +WKAIGY GP    S+ +++ 
Sbjct  146  ILLNWASSYFILLRMFFRSIKLITAFVFFTQVDEKGNNVAWKAIGYNGPSSDHSDHEEEI  205

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFV  530
                 + +  + +FGPLY GIIDL  P E V  +LT  G +V+  K          P   
Sbjct  206  NEKTTKKNKHDEIFGPLYNGIIDLKNPREAVTKKLTGHGFTVSTHKRTKNGSSISDPVMT  265

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I+CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLSL EG ++D+M+L
Sbjct  266  IQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQALDEMYL  320



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 155/235 (66%), Gaps = 7/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +++QR+ HPK   L + LW LST IG+L+LCG+ S    FP+  RF  + +K+RE 
Sbjct  86   RVARLMSQRLHHPKKWILRVGLWSLSTWIGSLVLCGQRSFIGGFPYFQRFCRLPKKQREE  145

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
             + +WA+S    +R FF ++K +  LVFFT VD+KG N +WKAIGY GP    S+ +++ 
Sbjct  146  TLLNWASSYFLLLRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEEL  205

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFV  530
                   ++ + +FGPLY GII+L  P E V  +LT  G +++  K          P   
Sbjct  206  NETKTNKNMPKEIFGPLYNGIINLKKPREAVTKKLTGHGFTISTQKSNKKRSSISNPVMT  265

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLS LEG +MD+M+L
Sbjct  266  IRCDAVVVGSGSGGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDEMYL  320



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 159/250 (64%), Gaps = 22/250 (9%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  +I++R+KHPKL  L L LWFLST IGT +LCG+   S+ FP++ RFPEI Q++RE 
Sbjct  105  KLGGLISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREE  164

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP---------  344
            IV  W+ S    +R F   +K L  LVFFT VD+K  N SWKAIGY GPDP         
Sbjct  165  IVRRWSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDPEFENSKKLK  224

Query  345  ------SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV---  497
                  S  E+Q K++        +E  FGPL++G+I +  P + V   L + G  V   
Sbjct  225  RTSCQISADEQQGKEQATAKNGYEDEAFFGPLHQGLIHMVHPRDIVTKSLRQFGFPVLIC  284

Query  498  ----AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  665
                   KP  PS  I+CDAVV+GSG GGGV++GVLA AGYKVLVLEKG+Y AR+NLSLL
Sbjct  285  PSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVLVLEKGSYCARSNLSLL  344

Query  666  EGPSMDKMFL  695
            EGP+MD+M+L
Sbjct  345  EGPTMDQMYL  354



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 159/250 (64%), Gaps = 22/250 (9%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  +I++R+KHPKL  L L LWFLST IGT +LCG+   S+ FP++ RFPEI Q++RE 
Sbjct  105  KLGGLISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREE  164

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP---------  344
            IV  W+ S    +R F   +K L  LVFFT VD+K  N SWKAIGY GPDP         
Sbjct  165  IVRRWSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDPEFENSKKLK  224

Query  345  ------SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV---  497
                  S  E+Q K++        +E  FGPL++G+I +  P + V   L + G  V   
Sbjct  225  RTSCQISADEQQGKEQATAKNGYEDEAFFGPLHQGLIHMVHPRDIVTKSLRQFGFPVLIC  284

Query  498  ----AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  665
                   KP  PS  I+CDAVV+GSG GGGV++GVLA AGYKVLVLEKG+Y AR+NLSLL
Sbjct  285  PSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVLVLEKGSYCARSNLSLL  344

Query  666  EGPSMDKMFL  695
            EGP+MD+M+L
Sbjct  345  EGPTMDQMYL  354



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 152/246 (62%), Gaps = 19/246 (8%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            V  +I++R++HPKL    ++LW LST  GT ++CG  S+S+ FP+   FP++S  KR  I
Sbjct  82   VGGLISERLEHPKLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEI  141

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            V SW+ S    IR  F ++K + LLVFFT VD+K +N +WKAIGYCGPDP      +  K
Sbjct  142  VLSWSLSYFSLIRMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRANK  201

Query  375  hhdheddieeLLF-------------GPLYKGIIDLNLPEEHVFNRLTKLGCSVA----K  503
                      +               GPLY+G+I++  P E V   L   G S++    K
Sbjct  202  TAQPNGYGRSIYQREQEEEDDREDFNGPLYRGLINVKRPREVVAEALRLSGFSISIHSRK  261

Query  504  PKPPGPS--FVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  677
             + P  S   +I CDAVV+GSG GGGV +GVLA AGYKVLVLEKGNY AR+NLSLLEGP+
Sbjct  262  HETPNSSSPLIIRCDAVVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEGPT  321

Query  678  MDKMFL  695
            +D+M+L
Sbjct  322  LDQMYL  327



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 155/235 (66%), Gaps = 7/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +++QR+ HP+   L + LW LST IG+L+LCG+ S    FPF  RF  + +K+RE 
Sbjct  86   RVARLMSQRLHHPRKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREE  145

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
             + +WA+S    +R FF ++K +  LVFFT VD+KG N +WKAIGY GP    S+ +++ 
Sbjct  146  TLLNWASSYFLLLRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEEL  205

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK-------PPGPSFV  530
                   ++ + +FGPLY GII+L  P E V  +LT  G +V+  K          P   
Sbjct  206  NETKTNKEMPKEIFGPLYNGIINLKKPREAVTKKLTDHGFTVSTQKSNNNRSSISNPVMT  265

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++G+LA AG+KVLV+EKGNYYAR+NLS LEG +MD+M+L
Sbjct  266  IRCDAVVVGSGSGGGVVAGLLAKAGFKVLVVEKGNYYARSNLSQLEGQAMDEMYL  320



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 163/247 (66%), Gaps = 23/247 (9%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            ++++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ QKKR+ ++ S
Sbjct  4    LMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVS  63

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  383
            W+ S    +R  + AMK L+LLVFFT V++K +N SWKAIGY GPDP    K  ++K   
Sbjct  64   WSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLR  123

Query  384  he---------------ddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-------  497
            +E                + E  L+GPLYKG+I++ LP   V + L ++G  V       
Sbjct  124  NEGLNDDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRN  183

Query  498  AKPKP-PGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGP  674
            A P     PS VI+CDAVVVGSG GGG+I+GVLA AGYKVLVLEKG+Y AR+NLSLLEG 
Sbjct  184  AAPSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGK  243

Query  675  SMDKMFL  695
            +MD+M+L
Sbjct  244  TMDQMYL  250



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 154/247 (62%), Gaps = 19/247 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA  I+  + HPK   L   LW LST IG+L+LCG+ S S +FP+  RF  + QK+RE 
Sbjct  80   RVARKISGTLDHPKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREE  139

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-----DPSISe  356
            I+ SWA+S    +R FF AMK +  LVFFT VD+KG N +W+AI Y GP     D    +
Sbjct  140  IMLSWASSFFSLLRMFFKAMKLITALVFFTQVDEKGKNLAWEAIRYTGPISDSEDSDQED  199

Query  357  kqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA---------KPK  509
            +   ++H +      E +FGP+Y GI+DL  P E V   L + G  V+         + +
Sbjct  200  QTIHREHQEKTKKEPEQIFGPIYNGIVDLMNPREVVIETLNRHGFQVSTRTGKNSHGRDR  259

Query  510  PPG-----PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGP  674
             PG     P   I CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNYYAR NLSLLEG 
Sbjct  260  RPGSSISDPVMKIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLLEGQ  319

Query  675  SMDKMFL  695
            +M++M+L
Sbjct  320  AMEQMYL  326



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 154/247 (62%), Gaps = 19/247 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA  I+  + HPK   L   LW LST IG+L+LCG+ S S +FP+  RF  + QK+RE 
Sbjct  80   RVARKISGTLDHPKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREE  139

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-----DPSISe  356
            I+ SWA+S    +R FF AMK +  LVFFT VD+KG N +W+AI Y GP     D    +
Sbjct  140  IMLSWASSFFSLLRMFFKAMKLITALVFFTQVDEKGKNLAWEAIRYTGPISDSEDSDQED  199

Query  357  kqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA---------KPK  509
            +   ++H +      E +FGP+Y GI+DL  P E V   L + G  V+         + +
Sbjct  200  QTIHREHQEKTKKEPEQIFGPIYNGIVDLMNPREVVIETLNRHGFQVSTRTGKNSHGRDR  259

Query  510  PPG-----PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGP  674
             PG     P   I CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNYYAR NLSLLEG 
Sbjct  260  RPGSSISDPVMKIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLLEGQ  319

Query  675  SMDKMFL  695
            +M++M+L
Sbjct  320  AMEQMYL  326



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 163/247 (66%), Gaps = 23/247 (9%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            ++++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ QKKR+ ++ S
Sbjct  85   LMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVS  144

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  383
            W+ S    +R  + AMK L+LLVFFT V++K +N SWKAIGY GPDP    K  ++K   
Sbjct  145  WSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLR  204

Query  384  he---------------ddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-------  497
            +E                + E  L+GPLYKG+I++ LP   V + L ++G  V       
Sbjct  205  NEGLNDDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRN  264

Query  498  AKPKP-PGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGP  674
            A P     PS VI+CDAVVVGSG GGG+I+GVLA AGYKVLVLEKG+Y AR+NLSLLEG 
Sbjct  265  AAPSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGK  324

Query  675  SMDKMFL  695
            +MD+M+L
Sbjct  325  TMDQMYL  331



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 154/235 (66%), Gaps = 8/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++++R+ HPK   L + LW LST IG+L+LCG+ S + +FP+  RF  +  K+RE 
Sbjct  76   RVARLMSERLDHPKKWILRVALWLLSTWIGSLVLCGRRSFTGEFPYFRRFCRLPTKQREA  135

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ +W+ S    +R FF  +K +   VFFT VD+KG N +WKAIGY GP    S     +
Sbjct  136  ILLNWSESYFSLLRMFFRCIKLITAFVFFTQVDEKGRNLAWKAIGYNGPSLDDS-DHDLE  194

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--KPKPPG-----PSFV  530
            +  + +    E +FGPLY GI+DLN P E V  +LT  G +V+  K K  G     P   
Sbjct  195  EELNEKKKKPEEIFGPLYNGIVDLNCPREAVTKKLTGRGFTVSSQKNKSKGSSLSNPVMT  254

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++GVLA AGYKVLV+E GNYYAR+NLSLLEG +M+ M+L
Sbjct  255  IRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSNLSLLEGQAMEDMYL  309



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 155/241 (64%), Gaps = 13/241 (5%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +A ++ +++KHPK+    L L+ LSTR+GT +LCG+ SLS +FP+L RF  +   KRE+
Sbjct  39   HLAELLGEKIKHPKIYLSRLALFSLSTRLGTFILCGRKSLSEKFPYLQRFSRVLPHKREQ  98

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPD-----PSISe  356
            I+ SW+ S    +R  +  +K   LLVFFT V+DK +N SWKAIGY  PD     P +  
Sbjct  99   ILLSWSESCFSLLRILYAGLKIFTLLVFFTLVNDKDENVSWKAIGYTRPDHKARKPVVHN  158

Query  357  k-qkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-----  518
               +K +    E   E+  FGPLY GI++LN   E    +L K G  V+ P   G     
Sbjct  159  TPHEKAREKGEECISEKERFGPLYNGIVNLNQSREIALCKLEKSGFPVSIPHSNGAKIKS  218

Query  519  --PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
              PSF+++CD VVVGSG GGGV++GVLA AGYKVLVLEKG Y AR+NLSLLEG ++D+M+
Sbjct  219  SDPSFIVKCDVVVVGSGSGGGVVAGVLAEAGYKVLVLEKGCYIARSNLSLLEGQTIDQMY  278

Query  693  L  695
            L
Sbjct  279  L  279



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 165/266 (62%), Gaps = 39/266 (15%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  +I++R+ HP    L L+LWFLST +GT++LCG G LST+FPF+  FP++   KR++
Sbjct  123  RLGGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQ  182

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFT----------------------SVDDKGDN  305
            I+ SW+ S  + +R FF  +K L LL+FFT                       VD+  DN
Sbjct  183  IMQSWSLSFFRHLRMFFRTIKLLTLLIFFTQYKILFLLGNDLLYSSLHYTYFQVDESEDN  242

Query  306  PSWKAIGYCGPDPS---------ISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEE  458
             SWKAIGYCGPDP          +    K+++  +  D+  EL  GPLYKG++ LN P +
Sbjct  243  CSWKAIGYCGPDPEFKAQLKNHFLHGACKEKQDSEEGDNDAELAIGPLYKGLVHLNYPRD  302

Query  459  HVFNRLTKLG--CSVAK------PKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
             + + L + G   SV++      P    PS V++CDAVVVGSG GGGV++G+LA AGYKV
Sbjct  303  IIVDTLRRFGFPVSVSRRKQKTAPSLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKV  362

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            LVLEKG Y AR NLSLLEGP+MD+M+
Sbjct  363  LVLEKGGYSARNNLSLLEGPTMDQMY  388



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 158/243 (65%), Gaps = 16/243 (7%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +V  +I +R++HPK   + + LW LST  GT +LCG  SLS  FP+  RF ++SQKKRE+
Sbjct  118  RVGEMIMERVRHPKKWLVRVSLWMLSTWYGTYILCGNESLSNHFPYFKRFSKVSQKKREQ  177

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI-------  350
            I  SW+ S    +R FF  +K L LL FFT VD++ +N SWKAI Y G DP         
Sbjct  178  IALSWSLSYFFLLRMFFRTIKILCLLAFFTQVDEEMNNISWKAIDYPGSDPQFKPPSNLK  237

Query  351  ---SekqkkqkhhdheddieeLLFGPLYKGIIDLNLPE--EHVFNRLTKLGCSVA----K  503
               S+ ++  +  D E++  E L+GPL+KGI++L   +  +     L K G  V      
Sbjct  238  EKDSKSREVDEEGDEEEEEAEELYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPT  297

Query  504  PKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMD  683
             KPP PS +I+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M+
Sbjct  298  TKPPNPSMIIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAME  357

Query  684  KMF  692
            +M+
Sbjct  358  EMY  360



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 149/233 (64%), Gaps = 15/233 (6%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            V  +I++R++HPKL    ++LW LST  GT ++CG  S+S+ FP+   FP++S  KR  I
Sbjct  82   VGGLISERLEHPKLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEI  141

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            V SW+ S    IR  F ++K + LLVFFT VD+K +N +WKAIGYCGPDP      +  K
Sbjct  142  VLSWSLSYFSLIRMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRANK  201

Query  375  hhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA----KPKPPGPS--FVIE  536
                        +G   +G+I++  P E V   L   G S++    K + P  S   +I 
Sbjct  202  TAQPNG------YG---RGLINVKRPREVVAEALRLSGFSISIHSRKHETPNSSSPLIIR  252

Query  537  CDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            CDAVV+GSG GGGV +GVLA AGYKVLVLEKGNY AR+NLSLLEGP++D+M+L
Sbjct  253  CDAVVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEGPTLDQMYL  305



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 162/246 (66%), Gaps = 22/246 (9%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            ++++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ Q KRE ++ S
Sbjct  78   LMSERLKHPKKWLVRLCLWLLSTCIGSLILCGRYCFSSKFPYMHSFTQLPQNKREAVLVS  137

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  383
            W+ S    +R  + AMK L+ LVFFT V++K +N SWKAIGY GPDP    K  ++K   
Sbjct  138  WSLSYFYHLRMLYKAMKLLIFLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLR  197

Query  384  he--------------ddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA----KPK  509
            +E               + E  L+GPLYKG+I++ LP   V + L ++G  V+    +  
Sbjct  198  NEGLNDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNA  257

Query  510  PP----GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  677
             P     PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG+Y AR+NLSLLEG +
Sbjct  258  APISIASPSLVIKCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKT  317

Query  678  MDKMFL  695
            MD+M+L
Sbjct  318  MDQMYL  323



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 156/250 (62%), Gaps = 22/250 (9%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  ++++RMKHPKL  L L LW LST IGT +LCG+   S+ FP++ RF EI Q++RE 
Sbjct  95   KIGGLVSERMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREE  154

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP---------  344
            I   W  S    +R F   +K L  LVFFT +D+K  N SWKAIGY GPDP         
Sbjct  155  IARRWFRSVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFENSKKLK  214

Query  345  ------SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV---  497
                  S  E+Q +++        +E + GPL++G+I +  P++ V   L + G  V   
Sbjct  215  RMSCQVSADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVHPQDIVTKSLRQFGFPVLIC  274

Query  498  ----AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  665
                   KP  PS  I+CDAVV+GSG GGGV++GVLA AG+KVLVLEKG+Y AR+NLSLL
Sbjct  275  PSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLL  334

Query  666  EGPSMDKMFL  695
            EGP+MD+M+L
Sbjct  335  EGPTMDQMYL  344



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 151/235 (64%), Gaps = 8/235 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++++R+ HPK   L   LW LST IG+L+LCG  S + +FP+  RF  + +K+RE 
Sbjct  43   RVARLMSERLHHPKKWILRAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREE  102

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ +W++S    +R  F  +K +  LVFFT VD+KG N +WKAIGY GP P  S   + +
Sbjct  103  ILLNWSSSYFSLLRMLFRTIKLISALVFFTQVDEKGRNLAWKAIGYNGPSPDHS-DHEVE  161

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFV  530
             + + +    E +FGPLY GI+DL  P E V  +L   G +V+  K          P   
Sbjct  162  LNEEKKKKKPEEIFGPLYNGIVDLKSPREAVEKKLAGRGFAVSNQKRNTNGSSISDPVMK  221

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I+CDAVVVGSG GGGV +GVLA AGYKVLV+E GNYYAR+ LSLLEG +MD M+L
Sbjct  222  IQCDAVVVGSGSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYL  276



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 154/247 (62%), Gaps = 23/247 (9%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            ++ +++KHP    L++ LW LST  GTL+LCGK SLST FPF   FP++S + R+ ++  
Sbjct  120  ILIEKLKHPSTRLLMVTLWLLSTWFGTLILCGKASLSTNFPFFRSFPDLSSETRQNVMKC  179

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  383
            W+ S    +R FF  +K L LLVFFT +D++ +NPSWKAIGY GP      +QK      
Sbjct  180  WSQSYFHHLRMFFRTIKLLTLLVFFTQLDEEENNPSWKAIGYSGPHEEFKRQQKNHILQK  239

Query  384  hedd----------------ieeLLFGPLYKGIIDLNLPEEHVFNRLT--KLGCSVAKP-  506
               +                  E + GPLY+G++ LN P + + + L   K   SV  P 
Sbjct  240  SSKEGLQKEKQEDNNDDDNDNNEEILGPLYRGLVHLNHPCDIIADSLRRFKFHVSVTPPN  299

Query  507  -KP---PGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGP  674
             KP     PS VI+CD VVVGSG GGGV++GVLA +GYKVLVLEKG+Y+AR N+SLLEGP
Sbjct  300  NKPSTISSPSLVIQCDVVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYFARNNVSLLEGP  359

Query  675  SMDKMFL  695
            +MD+M+L
Sbjct  360  TMDQMYL  366



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 156/250 (62%), Gaps = 22/250 (9%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  ++++RMKHPKL  L L LW LST IGT +LCG+   S+ FP++ RF EI Q++RE 
Sbjct  95   KIGGLVSERMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREE  154

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP---------  344
            I   W  S    +R F   +K L  LVFFT +D+K  N SWKAIGY GPDP         
Sbjct  155  IARRWFRSVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFENSKKLK  214

Query  345  ------SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV---  497
                  S  E+Q +++        +E + GPL++G+I +  P++ V   L + G  V   
Sbjct  215  RMSCQVSADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVHPQDIVTKSLRQFGFPVLIC  274

Query  498  ----AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  665
                   KP  PS  I+CDAVV+GSG GGGV++GVLA AG+KVLVLEKG+Y AR+NLSLL
Sbjct  275  PSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLL  334

Query  666  EGPSMDKMFL  695
            EGP+MD+M+L
Sbjct  335  EGPTMDQMYL  344



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 150/235 (64%), Gaps = 9/235 (4%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            + A ++++R+ HPK   L   LW LST IGTL+LCG+ S + QFP+  RF  + +K+RE 
Sbjct  43   RAARLMSERLHHPKKWILRAGLWLLSTWIGTLILCGRRSFTGQFPYFRRFCRLPEKQREE  102

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ +W++S    +R FF ++K +   VFFT VD+ G N +WKAIGY GP    S+ + + 
Sbjct  103  ILLNWSSSYFSLLRMFFRSIKLITAFVFFTQVDENGRNLAWKAIGYDGPSSDHSDHEVEL  162

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPS-----FV  530
                 +   E  +FGPLY GIIDL  P E V  +LT  G +V+  K    G S       
Sbjct  163  NEKMQKKPEE--IFGPLYNGIIDLQSPREAVAKKLTGHGFTVSTQKRNTNGSSISDLVMT  220

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++GVLA AGYKVLV+E G YYAR+ LSLLEG +MD M+L
Sbjct  221  IRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGTYYARSKLSLLEGQAMDDMYL  275



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 147/228 (64%), Gaps = 10/228 (4%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             VA +++ ++KH     L L LW LST  GT ++CG  SLS+ FP+   FP+I Q KRE 
Sbjct  134  HVAGLVSGKVKHALSGVLRLCLWLLSTWYGTFIICGTLSLSSHFPYFQSFPQIIQPKREE  193

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+TSS+  +R  F  +K  V L+F++ VD+   N +W+AIGYCGPDP         
Sbjct  194  IMLSWSTSSIYLLRALFQCIKFFVHLIFYSKVDENNHNSTWQAIGYCGPDPQKESGCPHG  253

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKL-GCSVAKPKPPGPSFVIECDAv  548
            +             GPL  G+IDL+  + H F  + +  G +V++PK    +F I+CDAV
Sbjct  254  QQESK---------GPLQHGVIDLDSMDHHTFAHVLRASGFTVSQPKEKFSNFTIKCDAV  304

Query  549  vvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            VVGSG GGGV +GVLA AG+KV+VLEKG+Y+AR+ LSLLEGP+MD+M+
Sbjct  305  VVGSGSGGGVAAGVLAVAGHKVVVLEKGHYFARSQLSLLEGPTMDQMY  352



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 155/235 (66%), Gaps = 10/235 (4%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++++R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE 
Sbjct  90   RVAKLMSERLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQRED  149

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            ++ +W+ S    +R FF ++K +  LVFFT VD KG N SWKAIGY GP    S+ Q++ 
Sbjct  150  VLLNWSASYFSLLRMFFKSIKLITALVFFTQVDGKGRNLSWKAIGYNGPSLDDSDLQEEL  209

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----V  530
                 + +    +FGPLY GI+DL  P E V  +LT  G +V+ PK  P G S       
Sbjct  210  NEKKKKPEE---IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKNPKGSSLSNRVMT  266

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++GVLA AGYKVLV+E GNYYAR+ LSLLEG +M++M+L
Sbjct  267  IRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYL  321



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 159/263 (60%), Gaps = 37/263 (14%)
 Frame = +3

Query  15   VAWVINQRMK-HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            V  VI++R+  HP    L  +LW LST +GT++LCG    ST+FPF+  FP +   KR+R
Sbjct  107  VGGVISERLNYHPMTWLLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQR  166

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFT------------------SVDDKGDNPSWK  317
            I+ SW+ S  + +R FF  +K L LLVFFT                   +D+  DN SWK
Sbjct  167  IMQSWSLSFFRHLRMFFKTIKLLTLLVFFTQIFLLFGTLYSSWHGTYFQIDESEDNCSWK  226

Query  318  AIGYCGPDPSISekqkk----------qkhhdheddieeLLFGPLYKGIIDLNLPEEHVF  467
            AIGYCGPDP    + +           Q+  + ++D  E + GPLYKG++ LN P +   
Sbjct  227  AIGYCGPDPEFKAQLRNHFLHRTCKGGQESEEGDEDDAEQVIGPLYKGLVHLNCPRDITA  286

Query  468  NRLTKLG--CSVAKPKPPG------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
            + L + G   SV + KP        PS VI+CDAVVVGSG GGG+++G+LA AGYKVLVL
Sbjct  287  DALRRFGFPVSVTRRKPKAAANLSSPSLVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVL  346

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKG Y AR+NLSLLEGP++D+M+
Sbjct  347  EKGGYSARSNLSLLEGPTLDQMY  369



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 155/235 (66%), Gaps = 10/235 (4%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++++R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE 
Sbjct  90   RVAKLMSERLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQRED  149

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            ++ +W+ S    +R FF  +K +  LVFFT VD KG N SWKAIGY GP+   S+ Q++ 
Sbjct  150  VLLNWSASYFSLLRMFFRCIKLISALVFFTQVDGKGRNLSWKAIGYNGPNLDNSDLQEEL  209

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----V  530
                 + +    +FGPLY GI+DL  P E V  +LT  G +V+ PK  P G S       
Sbjct  210  NEKKKKPEE---IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKNPKGSSLSNRVMT  266

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++GVLA AG+KVLV+E GNYYAR+ LSLLEG +M++M+L
Sbjct  267  IRCDAVVVGSGSGGGVVAGVLANAGHKVLVVESGNYYARSTLSLLEGQAMEEMYL  321



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 152/250 (61%), Gaps = 26/250 (10%)
 Frame = +3

Query  24   VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  203
            +I++R+KHPK   L + LW LST  GT ++CG  S+ST FP+   FP +S ++R+ I++S
Sbjct  128  MISERLKHPKKWLLKVALWALSTWFGTFVMCGIASVSTTFPYFHSFPNLSHQRRQEILNS  187

Query  204  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI----Sekqkkq  371
            W+ S    +R  + ++K L  LVFFT VD K  N SWKAIGY GPDP      +      
Sbjct  188  WSQSYFFLLRLLYWSLKLLTFLVFFTQVDSKDHNVSWKAIGYTGPDPDFKVQNTTTAATT  247

Query  372  khhdheddieeLLFGPLYKGIIDL-NLPEE-HVFNRLTKLGCSVAKPKPP----------  515
            K  + +   +E+LFGPL  GI+D   LP +  + N L + G  V + +P           
Sbjct  248  KLDEQQQQQQEILFGPLSSGIVDFKTLPHDLTLINTLKRHGFPVKRRRPCTSILPQERST  307

Query  516  ----------GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  665
                       P   I CDAVVVGSG GGGV++G+LA AGYKVLVLEKGNYYAR NL+LL
Sbjct  308  HNNKVPSSIFDPFLKIRCDAVVVGSGSGGGVVAGLLARAGYKVLVLEKGNYYARNNLTLL  367

Query  666  EGPSMDKMFL  695
            EGP++D+M+L
Sbjct  368  EGPTLDQMYL  377



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 151/240 (63%), Gaps = 13/240 (5%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            VA +I +++  PK   L L LW LST  GT +L GK SLST+FP+  +F ++SQKKRE I
Sbjct  68   VAGIITEKLPLPKAGILRLTLWLLSTWFGTFILTGKSSLSTKFPYFQKFSQVSQKKREEI  127

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            + SW+TSS   +R  F   K L+L VFFT VD+K +NPSWKA+GYCGPDP    + +  K
Sbjct  128  LLSWSTSSFSLLRMLFKIFKLLLLFVFFTQVDEKNENPSWKALGYCGPDPDFKHQTQASK  187

Query  375  hhdheddi-----eeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--------KPKPP  515
                +        +E LFGPLY+ +I+   P + +   L + G  V          P   
Sbjct  188  TDQDDLTSEEEEKKEELFGPLYRRLINPRHPRQSIAEYLEQSGFPVTINHFHGNKTPSIS  247

Query  516  GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             PS  I CDAVVVGSG GG V + VLA AGYKVLVLEKG Y+AR NLSLLEGPS+++M+L
Sbjct  248  SPSLTIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLEKGKYFARNNLSLLEGPSLEQMYL  307



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 153/235 (65%), Gaps = 10/235 (4%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +I++R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE 
Sbjct  87   RVAKLISERLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQRED  146

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            ++ +W+ S    +R FF  +K +  LVFFT VD KG N +WKAIGY GP    S+ Q++ 
Sbjct  147  VLLNWSASYFSLLRMFFKCIKLITGLVFFTQVDGKGRNLAWKAIGYNGPSLDDSDLQEEL  206

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----V  530
                 + D    +FGPLY GI+DL  P E V  +LT  G +V+ PK    G S       
Sbjct  207  NEKKKKPDE---IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKIQKGSSLSNRVMT  263

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I CDAVVVGSG GGGV++GVLA AGYKVLV+E GNYYAR+ LSLLEG +M++M+L
Sbjct  264  IRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYL  318



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 135/226 (60%), Gaps = 24/226 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVL  266
            STR+GT +  G  SLS  FPF L+F E+S +KR+ I+ S +TS     R  F  +K LVL
Sbjct  120  STRLGTFVFGGIHSLSICFPFFLKFSELSLEKRQHILLSLSTSCFILFRMAFVGIKLLVL  179

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDP--------------------SISekqkkqkhhdh  386
            L FFT VD+  +NPSW+AIGYCGPDP                    S       +     
Sbjct  180  LAFFTQVDESEENPSWEAIGYCGPDPDFVSKKRNESSQSLGYITPKSYHSSPTTEVQAQA  239

Query  387  eddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA----KPKPPGPSFVIECDAvvv  554
            +   +  L+GPLYKGII +  P+E +   L + G  V+    K     P   I+CD VVV
Sbjct  240  QAQSKYDLYGPLYKGIISVKYPQEILTESLKRCGIHVSVNRKKKNSEKPKITIQCDVVVV  299

Query  555  gsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            GSG GGGV++GVLA+AGYKV+V+EKG+YYARTNLSLLEG ++D M+
Sbjct  300  GSGSGGGVVAGVLASAGYKVVVIEKGDYYARTNLSLLEGHTLDHMY  345



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 148/232 (64%), Gaps = 13/232 (6%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            V   +++R++HP+L  L L LW LST  GT +LCG  SLS +FPF   FPE+    RE I
Sbjct  93   VGGYLSERIQHPRLWQLRLALWLLSTWFGTFILCGTNSLSCRFPFFRSFPEVEAAGREDI  152

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            + SW+ S +  +R  +   KALV+L +FT +++K +NP+W+AIGY GPDP  + K   ++
Sbjct  153  IRSWSMSCIFLLRVLYKGFKALVVLFYFTQLNEKNENPAWEAIGYVGPDPRRAIKSSSEE  212

Query  375  hhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--AKPKPPG----PSFVIE  536
                 D       GPLYK ++ +  P + +   L++ G S+  ++ +P G    P   I 
Sbjct  213  EEGARD-------GPLYKALVHMAGPMDVLCTSLSRAGLSLVTSQSQPDGLKSKPLPTIY  265

Query  537  CDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            CDAVVVGSG GGGV++GVLA AG+KV+VLEKG Y+AR NL+LLE  ++D M+
Sbjct  266  CDAVVVGSGSGGGVVAGVLAKAGFKVVVLEKGGYHARNNLTLLERHTLDHMY  317



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 147/231 (64%), Gaps = 13/231 (6%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            V   +++R++H  L  L L LW LST  GT + CG   +S +FPF  +F +I   +RE I
Sbjct  97   VGGYVSRRLRHALLGLLRLSLWLLSTWYGTFIFCGTRCVSCRFPFFHKFSDIDPTRREEI  156

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            + SW++S +   R  F AMK L+   +FT V+DK +NP+W+A+ YCGPDP+ +++ K   
Sbjct  157  LSSWSSSPIYLYRKLFRAMKFLIPFFYFTQVNDKYENPTWRALEYCGPDPAFADQVKASV  216

Query  375  hhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-KPKPPG----PSFVIEC  539
                EDD     FGPL++ ++ +  P       L++ G S+A +P P G    P   I C
Sbjct  217  DQCSEDDR----FGPLHRALVHMGSPGA----ALSRAGLSLATRPFPGGRRKKPLRTILC  268

Query  540  DAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            DAVVVGSG GGGV++G LA AGYKV+VLEKG Y+AR+NLSL EGP++D M+
Sbjct  269  DAVVVGSGSGGGVVAGFLARAGYKVVVLEKGGYHARSNLSLCEGPTLDLMY  319



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 147/231 (64%), Gaps = 9/231 (4%)
 Frame = +3

Query  15   VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  194
            V   ++ R++H  L  L L LW LST  GT + CG   +S +FPF  +F +I  K+RE+I
Sbjct  97   VGGYMSGRLRHASLWLLRLSLWLLSTWYGTFIFCGTRCMSCRFPFFHKFSDIDPKRREQI  156

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  374
            + SW++S +   R  F A+K L++L +FT V++K +NP+W A+ YCGP+P ++++ K   
Sbjct  157  LSSWSSSPIYLYRQLFRALKFLIMLFYFTQVNEKNENPAWTALDYCGPEPELADQVKASV  216

Query  375  hhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-----PSFVIEC  539
                EDD     FGPL+  ++ +  P + +   L++ G  +A     G     P   I C
Sbjct  217  DQSSEDDR----FGPLHCAMVHMESPGDDLAAALSRAGLYLATRPFSGDRRKKPLRTIHC  272

Query  540  DAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            DAVVVGSG GGGV++GVLA AGYKV+VLEKG Y+AR+NLSL EGP+MD M+
Sbjct  273  DAVVVGSGSGGGVVAGVLAQAGYKVVVLEKGGYHARSNLSLHEGPAMDLMY  323



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 145/221 (66%), Gaps = 16/221 (7%)
 Frame = +3

Query  36   RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  215
            + +HPK++  +  LWFLSTRIG+++LCG+  +      + RF E+  ++RE I+  W+  
Sbjct  58   KARHPKISLAVPALWFLSTRIGSVVLCGRRCVGGG-KLVKRFSELPVEEREEILAYWSRH  116

Query  216  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd  395
             L  +R F+ ++K   LL FFT VD+ G+N SWKAIGYCGPDP+               +
Sbjct  117  FLPHLRIFYHSLKFFTLLRFFTHVDENGENVSWKAIGYCGPDPT--------------RN  162

Query  396  ieeLLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  572
                  GPL++GII+L+   E   +R L+  G  V+K    G SF IECDAVVVGSG GG
Sbjct  163  GGPFEVGPLHRGIINLDREREPPPSRALSLYGFPVSKGGEGGVSFTIECDAVVVGSGSGG  222

Query  573  gvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            GV++GVLA +G+KVLV+EKG+Y AR++L+LLEG SM++M+L
Sbjct  223  GVVAGVLAKSGHKVLVIEKGSYSARSDLTLLEGQSMERMYL  263



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 143/233 (61%), Gaps = 6/233 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            QVA ++  +++H +L    L LW LST IGT +LCG+ SLS +FP+L +F  +S + R+ 
Sbjct  60   QVAILMGHKIRHRRLFLAPLALWVLSTAIGTWVLCGRKSLSRRFPYLQKFSRVSTENRKE  119

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+HSWA S    +R  F A+K  + L+FF+ VD+KGDN SW+AI Y       +   ++ 
Sbjct  120  IMHSWANSHFFVLRLLFNALKIFITLIFFSQVDEKGDNVSWQAIRYRSKTGGAAMNVQQL  179

Query  372  khhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-KP----KPPGPSFVIE  536
             +     +      GPL +GIIDL   EE    +L+ LG  V+  P    +  G S+ +E
Sbjct  180  GNMITAQENSNPELGPLREGIIDLKSKEES-LQKLSDLGFPVSLNPNRIRRRGGASYAVE  238

Query  537  CDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             D VV+GSGCGGGV++GVLA  GYK +VLEKG Y+    L LLEG +MD+M+L
Sbjct  239  SDVVVIGSGCGGGVVAGVLAQQGYKTIVLEKGKYFPTARLPLLEGQAMDQMYL  291



>gb|KHN27504.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=638

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 125/180 (69%), Gaps = 13/180 (7%)
 Frame = +3

Query  195  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek-----  359
            + SW+ S L+ +R FF  +K L LLVFFT +D+  DNPSWKAIGYCGPDP    +     
Sbjct  1    MQSWSLSYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDPEFKSQLKNHF  60

Query  360  -qkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP------P  515
              K++   + EDD  E + GPLYKG+I +N P + + + L ++G SV A PK        
Sbjct  61   FTKQRGQEEKEDDGTEDVRGPLYKGLIRINNPRDIITDSLRRVGFSVSATPKKTKASTLS  120

Query  516  GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+L
Sbjct  121  SPSLVIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMYL  180



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 138/231 (60%), Gaps = 5/231 (2%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
             +  +++  +KHP    L L LW LST  GT  +CG  SLS QFP+  RF ++ + KRE+
Sbjct  67   HIGGLLSGGLKHPAAGLLYLALWLLSTWYGTFAMCGTRSLSKQFPYFHRFAKVERTKREQ  126

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+  S       F  +K L + ++FT ++D   NP+WKA+GYCGPDP + ++ +  
Sbjct  127  ILLSWSLGSFPLYAMLFRCLKYLTMRLYFTQLNDDRTNPAWKAMGYCGPDPDLVDQSQHL  186

Query  372  khhdhedd----ieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIEC  539
                H++      E+ +FGPL+  ++ +  P + +   L K G       P  P   + C
Sbjct  187  GTPQHQEKDPVDQEDDVFGPLHSALLHMEKPRDVITRMLHKAGFPAPATFPSSP-LTLSC  245

Query  540  DAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            DA V+GSG GG V++GVLA AGYKV+V+EKG+YY  + LSLLEGP++  M+
Sbjct  246  DAAVIGSGSGGSVVAGVLAKAGYKVIVIEKGDYYPSSRLSLLEGPALGAMY  296



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 140/219 (64%), Gaps = 17/219 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKG----SLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMK  254
            +TR+GT +L   G    +LS ++PFLL+  E+S +KR+++V SW TS    +R  F  MK
Sbjct  115  ATRLGTFVLGLLGGGLPNLSPRYPFLLKCSEMSLEKRQQLVLSWRTSWFYLVRMIFFGMK  174

Query  255  ALVLLVFFTSVDDKGD-NPSWKAIGYCGPDPS-ISekqkkqkhhdheddieeL-------  407
             L+ +V+FT VDD  D NP W+AIGYCGPDP  IS+K  +          + L       
Sbjct  175  RLISVVYFTQVDDNEDYNPIWEAIGYCGPDPYFISKKASESNKQSAYLTPKSLHNQPKED  234

Query  408  LFGPLYKGIIDLNLPEEHVFNRL--TKLGCSVAKPKPPGPSFVI--ECDAvvvgsgcggg  575
            L GPLYKGII++   +E +   L  +    S+ + K      VI  +CD VVVGSG GGG
Sbjct  235  LCGPLYKGIINVKCTQEILIESLKHSNFQVSINRKKKDCQMQVITIKCDVVVVGSGSGGG  294

Query  576  visgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V +GVLA+ GYKVLV++KG+YYARTNLSLLEGP++D+M+
Sbjct  295  VAAGVLASLGYKVLVIDKGDYYARTNLSLLEGPTLDQMY  333



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 146/233 (63%), Gaps = 6/233 (3%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            ++  +++  M+HP +  L L LW LST  GT +LCG+ SLS QFP+L +FP++ ++K+E 
Sbjct  87   RIGGLLSGGMQHPAIGLLRLALWLLSTWYGTFILCGRASLSNQFPYLQKFPQVRREKQEE  146

Query  192  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  371
            I+ SW+ SSL  ++  +  +K L +  +F+ ++DK  NPSW A+GYCGPDP ++++ +  
Sbjct  147  ILLSWSRSSLCPLKMLYKCLKYLTMKEYFSQINDKETNPSWDALGYCGPDPELADQSQHF  206

Query  372  kh----hdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPGPSFVI  533
            +      D      +   GPL   ++ ++ P + +  +L   G     +    P     +
Sbjct  207  RTPPLEEDSVSQEADSCPGPLDSALLYMDSPRDVITRKLQIAGFPTPTSGTNSPSSPLTL  266

Query  534  ECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             CD VVVGSG GG V++GVLA AG++V+V+EKG+YY R+ LSLLEGP++ +M+
Sbjct  267  HCDVVVVGSGSGGSVVAGVLAKAGHRVIVVEKGHYYHRSELSLLEGPTIAEMY  319



>ref|XP_010274420.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Nelumbo 
nucifera]
Length=728

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 125/203 (62%), Gaps = 13/203 (6%)
 Frame = +3

Query  126  SLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDN  305
            S ST     L+F ++SQKKRE I+ SW+TSS   +R  F   K L+L VFFT VD+K +N
Sbjct  58   SASTTATPQLKFSQVSQKKREEILLSWSTSSFSLLRMLFKIFKLLLLFVFFTQVDEKNEN  117

Query  306  PSWKAIGYCGPDPSISekqkkqkhhdheddi-----eeLLFGPLYKGIIDLNLPEEHVFN  470
            PSWKA+GYCGPDP    + +  K    +        +E LFGPLY+ +I+   P + +  
Sbjct  118  PSWKALGYCGPDPDFKHQTQASKTDQDDLTSEEEEKKEELFGPLYRRLINPRHPRQSIAE  177

Query  471  RLTKLGCSVA--------KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLE  626
             L + G  V          P    PS  I CDAVVVGSG GG V + VLA AGYKVLVLE
Sbjct  178  YLEQSGFPVTINHFHGNKTPSISSPSLTIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLE  237

Query  627  KGNYYARTNLSLLEGPSMDKMFL  695
            KG Y+AR NLSLLEGPS+++M+L
Sbjct  238  KGKYFARNNLSLLEGPSLEQMYL  260



>gb|KDP37817.1| hypothetical protein JCGZ_06719 [Jatropha curcas]
Length=608

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = +3

Query  237  FFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh-hdheddieeLLF  413
             F  +K L LLVFF+ VD+KG+N +WKA+ Y GPDP   ++Q+       + ++ +E LF
Sbjct  2    LFKTVKLLCLLVFFSQVDEKGENLAWKAMDYPGPDPEFKKEQEAALKLVKNNEEEKEKLF  61

Query  414  GPLYKGIIDLNLPEEHVFN--RLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  587
            GPLYKG+ID+NLP +   N  RL+       +PK   PS VI+CDAVVVGSG GG V++G
Sbjct  62   GPLYKGLIDMNLPRDITANSLRLSGFPVFTYRPKINNPSLVIKCDAVVVGSGSGGSVVAG  121

Query  588  vLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            VLA AGYKV+V+EKGNY+AR+NLSLLEGPSMD+M+L
Sbjct  122  VLAKAGYKVVVIEKGNYFARSNLSLLEGPSMDQMYL  157



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 132/232 (57%), Gaps = 20/232 (9%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            QVA +I +R+K         LLW LSTR+GT LLCG  SL  +FP+L  F ++ Q  RE+
Sbjct  71   QVAELIARRVKPIAFLMARWLLWLLSTRLGTWLLCGSASLKKEFPYLQPFSDVQQVSREQ  130

Query  192  IVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkk  368
            I+  W+    + F++  F   K   L  F+T  D+  +NP+WK IGY  P P        
Sbjct  131  ILLDWSRGRRITFLKFAFKLFKICCLFTFYTVADENAENPAWKGIGYSPPKPETDRVASG  190

Query  369  qkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRL-TKLGCSVAKPK---PPGPSFVIE  536
            +               PL KG+IDL+   E    +L    G +V + +       ++ +E
Sbjct  191  R---------------PLEKGVIDLSSASEQDLPKLFQDRGFTVTEEENLSGKEKAWKVE  235

Query  537  CDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            CDAVVVGSG GGGV +GVLA AGY+V+VLEKG YYAR +L+LLEGPS D+M+
Sbjct  236  CDAVVVGSGSGGGVAAGVLAKAGYRVIVLEKGKYYARDDLTLLEGPSFDQMY  287



>ref|XP_002960521.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
 gb|EFJ38060.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
Length=724

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 119/213 (56%), Gaps = 27/213 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVL  266
            STR+GTLLL G   ++T+FPF+  FP +   KRE+I+ +W+ S    ++  F  +K   L
Sbjct  68   STRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLTWSRSIFHKLQMLFKVVKCYTL  127

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLN  446
              F++  D KG NP+WKAIGY  P+P +  ++               L  PL + ++D  
Sbjct  128  FKFYSRADKKGRNPAWKAIGYEVPEPVLEHQEP--------------LPSPLERRLVDAK  173

Query  447  LPEEHVFNRLTKLGCSVAK-----------PKPPGPSFVIECDAvvvgsgcgggvisgvL  593
             P+    +RL +LGC++                 G  F I+CD VVVGSG GG VI+  L
Sbjct  174  APDFQ--SRLAELGCAMLDNVDHLEERNDPSTASGKDFGIKCDVVVVGSGSGGSVIAARL  231

Query  594  ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            A  G+KV+VLEKG Y+ R  LSLLEGPSM  M+
Sbjct  232  AQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMY  264



>ref|XP_002967201.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
 gb|EFJ31800.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
Length=724

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 119/213 (56%), Gaps = 27/213 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVL  266
            STR+GTLLL G   ++T+FPF+  FP +   KRE+I+ +W+ S    ++  F  +K   L
Sbjct  68   STRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLNWSRSIFHKLQMLFKVVKCYTL  127

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLN  446
              F++  D KG NP+WKAIGY  P+P +  ++               L  PL + ++D  
Sbjct  128  FKFYSRADKKGRNPAWKAIGYEVPEPVLEHEEP--------------LPSPLERRLVDAK  173

Query  447  LPEEHVFNRLTKLGCSVAK-----------PKPPGPSFVIECDAvvvgsgcgggvisgvL  593
             P+    +RL +LGC++                 G  F I+CD VVVGSG GG VI+  L
Sbjct  174  APDFQ--SRLAELGCAMLDKVDHLEERNDPSTASGKDFGIKCDVVVVGSGSGGSVIAARL  231

Query  594  ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            A  G+KV+VLEKG Y+ R  LSLLEGPSM  M+
Sbjct  232  AQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMY  264



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 124/204 (61%), Gaps = 16/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW-ATSSLQFIRNFFTAMKALV  263
            STR+G+LL+CG+  L  ++P++ RF EI  + RE IV  W     L  IR  F  +K L+
Sbjct  24   STRLGSLLICGRLCLVGKWPYVRRFSEIGVEDREEIVRRWFGNWFLTPIRVAFVFLKLLI  83

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            LLVFF+ VD+   NP+WKAIGY   DP    K+   +              PL +GI++ 
Sbjct  84   LLVFFSRVDENSQNPAWKAIGYEVDDPGRRCKKSDGRR-------------PLERGIVEG  130

Query  444  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             L  E  F + L + G + A P     ++ +ECDAVVVGSGCGGGV + VLA AG+KV+V
Sbjct  131  RLETESSFVDSLAEKGLT-ATPSERENAYRVECDAVVVGSGCGGGVAAAVLARAGHKVVV  189

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+A  + S LEGPS+ +++
Sbjct  190  LEKGDYFAADDYSGLEGPSLRQLY  213



>gb|AGC65582.1| fatty alcohol oxidase [Simmondsia chinensis]
Length=721

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 117/210 (56%), Gaps = 27/210 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STRIGTLLLCG  SL+ ++PFLL+F +I   KRE+I+ SW+  S    +R  F  +K + 
Sbjct  74   STRIGTLLLCGFRSLTWKWPFLLKFSQIQLHKREKILQSWSKQSFWTSLRVVFLLIKVVC  133

Query  264  LLVFFTSVDDKGDNPSWKAIGY------CGPDPSISekqkkqkhhdheddieeLLFGPLY  425
              VFF+  D+   NP+W+AIGY      C   P                        PL 
Sbjct  134  CFVFFSQTDENSKNPAWEAIGYNLDSRECSTKPQEER--------------------PLQ  173

Query  426  KGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAG  605
            KGI++    +     R  K  C           F ++CD V+VGSGCGGGV +GVLA++G
Sbjct  174  KGIVECTNTDNDNLLRSLKEKCVEVTEDHEKNMFKVKCDVVIVGSGCGGGVAAGVLASSG  233

Query  606  YKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
             KVLV+EKGNY+A  + S LEGPS+D++++
Sbjct  234  LKVLVIEKGNYFAPGDYSSLEGPSLDELYV  263



>ref|XP_011072475.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Sesamum 
indicum]
Length=671

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (65%), Gaps = 20/173 (12%)
 Frame = +3

Query  231  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhe-------  389
            R F+    ++  +     V++KG+N SWKAIGYCGPDP  ++ ++    +  +       
Sbjct  44   RQFYQTSASMAGIPHH--VNEKGENLSWKAIGYCGPDPGCTKTRRLNAENTQQPPEECEE  101

Query  390  ----ddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP-------KPPGPSFVIE  536
                   +E LFG LYKGII+L+ P E   ++L  LG SV+ P       K   PSF+++
Sbjct  102  KLADGASKEELFGSLYKGIINLSQPREDPLSKLQNLGFSVSIPHSRNRRMKSLNPSFIVK  161

Query  537  CDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            CDAVVVGSG GGGV++GVLA AG+KVLVLEKG+Y+AR NLSLLEG +MD+M+L
Sbjct  162  CDAVVVGSGSGGGVMAGVLANAGHKVLVLEKGSYFARANLSLLEGEAMDQMYL  214



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 116/204 (57%), Gaps = 16/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STRIGTLLLCG   L  ++PF+ +F E+S  KRE I+  W+  +L   +R  F  +K   
Sbjct  99   STRIGTLLLCGSNCLDWKWPFIHKFSELSINKRESILQKWSRGTLVLPLRTVFFMLKVTC  158

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
               FF+  D+K  NP+W+AIGY      IS + +K++              PL KG+I+ 
Sbjct  159  FYTFFSLTDEKSQNPAWEAIGYHIEKVEISGQPEKER--------------PLEKGVIET  204

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
                +      L + G  VA+      +  IECD V+VGS CGGGV + VLA AG KV+V
Sbjct  205  EKENKLTLRESLVQKGLKVAENPKDHNTLNIECDVVIVGSDCGGGVAAAVLAKAGLKVVV  264

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGPSM++M+
Sbjct  265  LEKGHYFTAEDYSELEGPSMNEMY  288



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 119/205 (58%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STR+GTLLLCG   +  ++P++  F  +   +RE+++  W     L  IR+ F  +K + 
Sbjct  111  STRLGTLLLCGSLCVGGRWPYVNTFSSMGSDQREKVLRGWLKHRFLTPIRSAFVYLKVMC  170

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L V F+ VD+KG+NP WKAIGY    +  +S+  + +               PL KGII+
Sbjct  171  LYVLFSRVDEKGENPLWKAIGYQVDEEQEMSKPDQGR---------------PLEKGIIE  215

Query  441  LNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             N   +  +   L + G  V +       + I+CDAV+VGSGCGGGV + VLA  GYKV+
Sbjct  216  TNYSTDLGLLQSLKQKGLEVTQ-DSKNKIYRIKCDAVIVGSGCGGGVAAAVLAGCGYKVV  274

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNYY   + S LEGPSMD+++
Sbjct  275  VLEKGNYYTHKDYSSLEGPSMDQLY  299



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 119/205 (58%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STR+GTLLLCG   +  ++P++  F  +   +RE+++  W     L  IR+ F  +K + 
Sbjct  111  STRLGTLLLCGSLCVGGRWPYVNTFSSMGSDQREKVLRGWLKHRFLTPIRSAFVYLKVMC  170

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L V F+ VD+KG+NP WKAIGY    +  +S+  + +               PL KGII+
Sbjct  171  LYVLFSRVDEKGENPLWKAIGYQVDEEQEMSKPDQGR---------------PLEKGIIE  215

Query  441  LNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             N   +  +   L + G  V +       + I+CDAV+VGSGCGGGV + VLA  GYKV+
Sbjct  216  TNYSTDLGLLQSLKQKGLEVTQ-DSKNKIYRIKCDAVIVGSGCGGGVAAAVLAGCGYKVV  274

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNYY   + S LEGPSMD+++
Sbjct  275  VLEKGNYYTHKDYSSLEGPSMDQLY  299



>ref|XP_001763007.1| predicted protein [Physcomitrella patens]
 gb|EDQ72212.1| predicted protein [Physcomitrella patens]
Length=775

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 113/218 (52%), Gaps = 23/218 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVL  266
            STRIGTL+L G+ SL+TQFPF   F  +S  K+E I+  W+ S+L   R  +   K + +
Sbjct  104  STRIGTLILGGRASLTTQFPFFQSFAYLSTDKQEDILRGWSLSTLGAFRAVYKLFKMITM  163

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLN  446
               +T +++ G N +WKAIGYCG DP +                + +   PL   +I   
Sbjct  164  WAVYTKIENGGFNRNWKAIGYCGADPQV-------IRSRKCSSNDGVRSNPLQDMVIATQ  216

Query  447  LPEEHVFNRLTKLGCSVAKPKPP----------------GPSFVIECDAvvvgsgcgggv  578
               + +   L++ G  V     P                G    I CD VVVGSGCGGGV
Sbjct  217  AAGDKLEKVLSRAGVKVLNDDIPLKKLASGNRNRNNSAAGGDLGISCDVVVVGSGCGGGV  276

Query  579  isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            I+ VLA AGY+V++LEKG Y+   +L+ LEGPS   MF
Sbjct  277  IASVLAKAGYQVVILEKGKYFRTEDLTTLEGPSQMAMF  314



>ref|XP_004505474.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=762

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 119/205 (58%), Gaps = 16/205 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GTLLLCG   LS ++PF+ +F  +S  KRE+IV  W     L  IR  F  +K L 
Sbjct  105  ATRLGTLLLCGFLCLSKEWPFVNKFSSMSLDKREKIVQRWLKHRFLTPIRVAFGYIKVLC  164

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
              VFF+ VD+ GDNP+WKAIGY   P+  ++   K+ +              PL KGII+
Sbjct  165  HFVFFSWVDENGDNPTWKAIGYEVSPNEKMTNVSKESEER------------PLEKGIIE  212

Query  441  LNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
                 +    + L+  G +V           I+CDAVVVGSG GGGV + VL+ AGYKV+
Sbjct  213  TMHEHDSTLQKSLSDKGLNVI-VDSKNNILKIKCDAVVVGSGSGGGVAASVLSNAGYKVI  271

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+   + S LEGPSM++ +
Sbjct  272  VLEKGNYFVPKDYSSLEGPSMNQQY  296



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 122/205 (60%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLLLCG  S S ++PF+  F  IS +KRE+I+  W    L   IR  F  +K L 
Sbjct  95   STRLGTLLLCGSLSFSDKWPFINNFSSISLEKREKILQRWFRHRLLTPIRLAFVYIKFLC  154

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L  FFT  D+  +N +W+AIGY    D + S+  K++               PL KG+++
Sbjct  155  LYAFFTLADENSENAAWEAIGYHTDTDGNRSKVPKER---------------PLQKGMVE  199

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +   E  +   L + G  V K  P    + I+CD VVVGSGCGGGV + VLA++G+KV+
Sbjct  200  TMQETESTLVQSLNQKGLKVVK-DPEQKLYKIKCDVVVVGSGCGGGVAAAVLASSGHKVV  258

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+  T+ S LEGPSM+++F
Sbjct  259  VLEKGNYFTATDYSSLEGPSMNQLF  283



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 119/204 (58%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLL+CG  S  +++PFL +F E+S +KRE ++  W+ +  Q  +R  F   K   
Sbjct  108  STRLGTLLICGTLSFGSRWPFLCKFSELSLEKREEVLKKWSRARYQIHLRLMFAMFKIFC  167

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+  D+   NP+W AIGY       S K  K++              PL KGII+ 
Sbjct  168  CFAFFSLTDENSTNPAWDAIGYHVDTYESSHKTDKKR--------------PLQKGIIET  213

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  +  +   LT+ G  V +  P      IECD VVVGSGCGGGV + VLA++G KV+V
Sbjct  214  MNESDSTLVQSLTQKGFKVTE-DPKRNLHKIECDVVVVGSGCGGGVAASVLASSGQKVIV  272

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+A  + S +EGPS+++++
Sbjct  273  LEKGNYFAPEDYSSVEGPSLNQLY  296



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 119/204 (58%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLL+CG  S  +++PFL +F E+S +KRE ++  W+ +  Q  +R  F   K   
Sbjct  114  STRLGTLLICGTLSFGSRWPFLCKFSELSLEKREEVLKKWSRARYQIHLRLMFAMFKIFC  173

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+  D+   NP+W AIGY       S K  K++              PL KGII+ 
Sbjct  174  CFAFFSLTDENSTNPAWDAIGYHVDTYESSHKTDKKR--------------PLQKGIIET  219

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  +  +   LT+ G  V +  P      IECD VVVGSGCGGGV + VLA++G KV+V
Sbjct  220  MNESDSTLVQSLTQKGFKVTE-DPKRNLHKIECDVVVVGSGCGGGVAASVLASSGQKVIV  278

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+A  + S +EGPS+++++
Sbjct  279  LEKGNYFAPEDYSSVEGPSLNQLY  302



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 121/206 (59%), Gaps = 18/206 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF---IRNFFTAMKA  257
            S RIGTLLLCG      ++PF L+F EIS +KRE+I+ +W+ +  ++   +R  F  +K 
Sbjct  95   SFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKREQILKNWSMAHHKYTVLLRMTFMIIKI  154

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
                 FF+ +D+   N +WKA+GY      +  +++                 PL +G+I
Sbjct  155  FCCFKFFSRIDEGTKNVAWKAMGY-----EVDTRKQLNHTQKER---------PLERGMI  200

Query  438  DL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +  N  +  +F  L++ G  V + K  G ++ I+CD V+VGSGCGGGV + VLA +G KV
Sbjct  201  ETGNEDDSTLFRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGSGCGGGVAAAVLAKSGLKV  260

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+   + S LEGPSM++++
Sbjct  261  VVLEKGNYFVAEDYSSLEGPSMNELY  286



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 115/204 (56%), Gaps = 12/204 (6%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR GTLLLCG+ SL   FP++ RF +++ ++RE  +  W      F +R  F  +K L 
Sbjct  21   STRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWNRVRWLFPLRIAFAIVKILC  80

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              VF+  V++  +NP WKAIGY   +P     +                  PL  G+++ 
Sbjct  81   HYVFYAMVNENSENPYWKAIGYSVDEPREDRARTATPSPSR----------PLDVGVVET  130

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             L +++   R L   G +V           ++CDAV+VGSGCGGGV + VLA+AGYKV+V
Sbjct  131  RLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDAVIVGSGCGGGVAAAVLASAGYKVVV  190

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKG+Y+   + S +EGPSM+++F
Sbjct  191  VEKGDYFTAEDYSSIEGPSMERLF  214



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   111 bits (278),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 119/204 (58%), Gaps = 13/204 (6%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLLLCG+  L+  FP++ +F +++ ++RE  +  W      F +R  F  +K L 
Sbjct  112  STRVGTLLLCGRLCLAGGFPYVRKFADMTPERREAALQRWNRVRWLFPLRIAFAIVKILC  171

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              VF+  V++  +NP WKAIGY   +P   + +                  PL  G+++ 
Sbjct  172  HYVFYAMVNENSENPYWKAIGYSVHEPREDQTEAAPSPSR-----------PLDVGVVET  220

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             L +++   R L   G +V          V++CDAV+VGSGCGGGV + VLA+AGYKV+V
Sbjct  221  RLLDDNALLRSLVGRGLTVKPVASDANHHVVQCDAVIVGSGCGGGVAAAVLASAGYKVVV  280

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKG+Y+  ++ S +EGPSM+++F
Sbjct  281  VEKGDYFTASDYSSIEGPSMERLF  304



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 121/205 (59%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLLLCG  S S ++PF+  F  IS +KRE+I+  W    L   IR  F  +K L 
Sbjct  95   STRLGTLLLCGSLSFSDKWPFINNFSSISLEKREKILQRWFKHRLLTPIRLAFVYIKFLC  154

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L  FFT  D+  +N +W+AIGY    D + S+  K++               PL KG+++
Sbjct  155  LYAFFTLADENSENAAWEAIGYHTDTDGNRSKVPKER---------------PLQKGMVE  199

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +   E  +   L + G  V K  P    + I+CD VVVGSGCGGGV + VLA++G+KV+
Sbjct  200  TMQETESTLVQSLNQKGLKVVK-DPEQKLYKIKCDVVVVGSGCGGGVAAAVLASSGHKVV  258

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKG Y+  T+ S LEGPSM+++F
Sbjct  259  VLEKGTYFTATDYSSLEGPSMNQLF  283



>gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 113/204 (55%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STR+GTLLLCG      ++P+L  F  IS  KRE+I+  W  +     IR  F  +K   
Sbjct  96   STRLGTLLLCGSLCFGEKWPYLNTFSSISLDKREKIMQKWFKNRFFTPIRLVFQLIKVGC  155

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L  FF   D+ G NP+W+AIGY      I+ +  +++              PL +GII+ 
Sbjct  156  LYTFFAQADENGKNPAWEAIGYSVDTDEIANQVPQER--------------PLQEGIIET  201

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   E  + + LT+ G  V K  P      I CD  +VGSGCGGGV + VLAT+G KVLV
Sbjct  202  MQENESTLMHNLTQKGLKVTK-DPKKKICKINCDVAIVGSGCGGGVAAAVLATSGQKVLV  260

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPS D+++
Sbjct  261  LEKGNYFTAKDYSGLEGPSHDQLY  284



>ref|XP_003607656.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1, partial [Medicago truncatula]
Length=584

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 121/206 (59%), Gaps = 20/206 (10%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF---FTAMKA  257
            +TR+GTLL+CG   LS ++PF+  F  +S  KRE+IV       L+F+  F   F  +K 
Sbjct  27   ATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQR--ALKLRFLTPFRLAFAYIKV  84

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L L VFF+ VD+ GDNP+WKAIGY      +S   +K  +   +         PL KGII
Sbjct  85   LCLFVFFSWVDENGDNPAWKAIGY-----EVSTADEKMTNDTKKR--------PLEKGII  131

Query  438  DLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            ++    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL+ AGYKV
Sbjct  132  EIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKV  190

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+   + S LEGPSMD+ +
Sbjct  191  VVLEKGNYFVPKDYSSLEGPSMDQQY  216



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score =   110 bits (276),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 77/204 (38%), Positives = 115/204 (56%), Gaps = 12/204 (6%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR GTLLLCG+ SL   FP++ RF +++ ++RE  +  W      F +R  F  +K L 
Sbjct  129  STRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWNRVRWLFPLRIAFAIVKILC  188

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              VF+  V++  +NP WKAIGY   +P     +                  PL  G+++ 
Sbjct  189  HYVFYAMVNENSENPYWKAIGYSVDEPREDRARTATPSPSR----------PLDVGVVET  238

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             L +++   R L   G +V           ++CDAV+VGSGCGGGV + VLA+AGYKV+V
Sbjct  239  RLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDAVIVGSGCGGGVAAAVLASAGYKVVV  298

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKG+Y+   + S +EGPSM+++F
Sbjct  299  VEKGDYFTAEDYSSIEGPSMERLF  322



>gb|KEH15695.1| long-chain-alcohol oxidase FAO1, partial [Medicago truncatula]
Length=653

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 121/206 (59%), Gaps = 20/206 (10%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF---FTAMKA  257
            +TR+GTLL+CG   LS ++PF+  F  +S  KRE+IV       L+F+  F   F  +K 
Sbjct  98   ATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQR--ALKLRFLTPFRLAFAYIKV  155

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L L VFF+ VD+ GDNP+WKAIGY      +S   +K  +   +         PL KGII
Sbjct  156  LCLFVFFSWVDENGDNPAWKAIGY-----EVSTADEKMTNDTKKR--------PLEKGII  202

Query  438  DLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            ++    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL+ AGYKV
Sbjct  203  EIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKV  261

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+   + S LEGPSMD+ +
Sbjct  262  VVLEKGNYFVPKDYSSLEGPSMDQQY  287



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 121/204 (59%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW-ATSSLQFIRNFFTAMKALV  263
            +TR+GTL+LCG  SLS +FPF+ +F ++  +KRE I+  W    S  F+R  F  +K   
Sbjct  104  ATRLGTLVLCGSLSLSWRFPFINKFSDMPVEKREHILMKWNREKSFIFLRLVFVIVKVFC  163

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L VF++  +++ +N +WKAIGY  P      K + ++              PL KGII+ 
Sbjct  164  LYVFYSMTNEEEENRAWKAIGYNTPSEEKPHKSRGER--------------PLEKGIIET  209

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            ++  +  +   L + G +V    P   ++ I CD V+ GSGCGGGV + VLA++G+KV+V
Sbjct  210  MDKTDSSLRQSLIEKGLAVTD-NPREHTYTINCDVVIAGSGCGGGVAAAVLASSGHKVVV  268

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKGNY+   + + LE PSMD+++
Sbjct  269  VEKGNYFTAEDYTALEAPSMDQLY  292



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 121/206 (59%), Gaps = 20/206 (10%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF---FTAMKA  257
            +TR+GTLL+CG   LS ++PF+  F  +S  KRE+IV       L+F+  F   F  +K 
Sbjct  107  ATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQR--ALKLRFLTPFRLAFAYIKV  164

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L L VFF+ VD+ GDNP+WKAIGY      +S   +K  +   +         PL KGII
Sbjct  165  LCLFVFFSWVDENGDNPAWKAIGY-----EVSTADEKMTNDTKKR--------PLEKGII  211

Query  438  DLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            ++    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL+ AGYKV
Sbjct  212  EIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKV  270

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+   + S LEGPSMD+ +
Sbjct  271  VVLEKGNYFVPKDYSSLEGPSMDQQY  296



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 114/209 (55%), Gaps = 10/209 (5%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVL  266
            S+RIGTL+LCG+ + S +FPFL RF  +    RER + SW+  S+    + +   K   +
Sbjct  88   SSRIGTLILCGRHAFSAEFPFLHRFARLPASNRERTLRSWSGGSIAQFHSLYKLFKCFAM  147

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLN  446
              FFT  D +G N SWKAIGY  PDP  +  +        +D+ E     PL    +  N
Sbjct  148  FAFFTKADARGRNDSWKAIGYPVPDPLWNGLKDDDDAKVTDDNEEPRP--PLRVFDVHQN  205

Query  447  LPEEHVFNRLTKLGCSVAKPKPPGPS-------FVIECDAvvvgsgcgggvisgvLATAG  605
               E V + L+     V++    G           I+CD VV+GSGCGGGV +GVL+  G
Sbjct  206  SAAELV-DYLSSSKFRVSEEVRDGGDGGSGQAMLAIDCDVVVIGSGCGGGVCAGVLSQKG  264

Query  606  YKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            YKV+V+EKG YY    LSLLEGPSM  M+
Sbjct  265  YKVVVIEKGKYYVGDQLSLLEGPSMRAMY  293



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 114/209 (55%), Gaps = 10/209 (5%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVL  266
            S+RIGTL+LCG+ + S +FPFL RF  +    RER + SW+  S+    + +   K   +
Sbjct  88   SSRIGTLILCGRHAFSAEFPFLHRFARLPASNRERTLRSWSGGSIAQFHSLYKLFKCFAM  147

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLN  446
              FFT  D +G N SWKAIGY  PDP  +  +        +D+ E     PL    +  N
Sbjct  148  FAFFTKADARGRNDSWKAIGYPVPDPLWNGLKDDDDAKVTDDNEEPRP--PLRVFDVHQN  205

Query  447  LPEEHVFNRLTKLGCSVAKPKPPGPS-------FVIECDAvvvgsgcgggvisgvLATAG  605
               E V + L+     V++    G           I+CD VV+GSGCGGGV +GVL+  G
Sbjct  206  SAAELV-DYLSSSKFRVSEEVRDGGDGGSGQAMLAIDCDVVVIGSGCGGGVCAGVLSQKG  264

Query  606  YKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            YKV+V+EKG YY    LSLLEGPSM  M+
Sbjct  265  YKVVVIEKGKYYVGDQLSLLEGPSMRAMY  293



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 128/230 (56%), Gaps = 19/230 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +I +R        +   L  LSTR+GTLL+CG  S   ++P+L +F EIS +KRE+
Sbjct  75   EVAELIKKRGSWEAKILVRATLRILSTRLGTLLICGSHSFDKKWPYLKKFSEISLEKREK  134

Query  192  IVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqk  365
            +V  W  + L   +R  F  +K LVL VFFT V +   NP+WKA+ Y    D  + +  K
Sbjct  135  VVQKWFRNRLLTPVRLAFVFIKFLVLYVFFTQVGEDAKNPAWKAMDYRVDVDEKLRDAPK  194

Query  366  kqkhhdheddieeLLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECD  542
            ++               PL +G+++     +  F N L   G  V +       + ++CD
Sbjct  195  ER---------------PLEQGMVETRHETDLTFANSLAAKGLKVTQ-NAQRSMYKVKCD  238

Query  543  AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             V+VGSGCGGGV + VL+ AG KV+VLEKGNYY   + S LEGPSM +++
Sbjct  239  VVIVGSGCGGGVAAAVLSRAGLKVVVLEKGNYYTSKDYSALEGPSMSELY  288



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 118/205 (58%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GT LLCG    S ++PF+  F  +S KKRER++  W  +  +  IR  F  +K L 
Sbjct  100  ATRLGTFLLCGLLCFSEKWPFINNFSSMSLKKRERVMQWWLKNRFITPIRLAFAYLKVLC  159

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L  +FT VD+ GDNP+WKAIGY    D  +      +                L KGI++
Sbjct  160  LFAYFTWVDENGDNPAWKAIGYEVSADEKLPNSSNGRL---------------LEKGIVE  204

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             ++     +   LT+ G +V           ++CDA+VVGSGCGGGV + VL+ AG+KV+
Sbjct  205  TMHETNSTLQQSLTEKGLNVTLDSRNNI-LKVKCDAIVVGSGCGGGVAASVLSGAGHKVV  263

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+A  + S LEGPSMD+++
Sbjct  264  VLEKGNYFAPRDYSSLEGPSMDQLY  288



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 119/206 (58%), Gaps = 18/206 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF---IRNFFTAMKA  257
            S RIGTLLLCG      ++PF L+F EIS +KRERI+ +W+ +  ++   +R  F  +K 
Sbjct  95   SFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKRERILKNWSMAHHKYTVLLRMTFMIIKI  154

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
                 FF+ +D+   N +WK +GY      +  +++                 PL +G+I
Sbjct  155  FCCFKFFSRIDEGTKNVAWKGMGY-----KVDTRKQLNHTQKER---------PLERGMI  200

Query  438  DL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +  N  +  +   L++ G  V + K  G ++ I+CD V+VGSGCGGGV + VLA +G KV
Sbjct  201  ETGNEDDSTLLRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGSGCGGGVAAAVLAKSGLKV  260

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+   + S LEGPSM++++
Sbjct  261  VVLEKGNYFVAEDYSSLEGPSMNELY  286



>ref|XP_002529832.1| electron carrier, putative [Ricinus communis]
 gb|EEF32533.1| electron carrier, putative [Ricinus communis]
Length=745

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 114/204 (56%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GTLLLCG   L   +PF+ +F EIS  KRE IV  WA     F +R  F A+K   
Sbjct  102  SFRLGTLLLCGFICLEWNWPFIHKFSEISLSKREDIVKRWAKQKYFFPLRVLFMAVKIFC  161

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
               FF+  DD  +NP+W+AIGY                   E   +     PL KGI++L
Sbjct  162  SYTFFSRTDDNSENPAWEAIGY--------------HKDTREKLTKSRKERPLEKGIVEL  207

Query  444  -NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             N  +  +   L + G  V +  P   ++ I+CD V++GSGCGGGV + VLA++G KVLV
Sbjct  208  ANEDDLTLVKSLMQKGIQVTE-DPDHNTYKIKCDVVIIGSGCGGGVAAAVLASSGQKVLV  266

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S +EGPSM +++
Sbjct  267  LEKGNYFVPEDYSSVEGPSMAELY  290



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 138/232 (59%), Gaps = 20/232 (9%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +I +R+    +  + ++L  LSTR+GTLL CG   L  ++PF+ +F E+S +KRE+
Sbjct  77   EVAEIIVKRVLPEAVILIRVVLKLLSTRLGTLLFCGCLCLEWKWPFIHKFSEMSLEKREK  136

Query  192  IVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSISekq  362
            ++  W+T S    +R  F  +K     +FFT  DD  +NP+W+AIGY     +P +   Q
Sbjct  137  LLQRWSTESYWTSLRVVFLLIKIACCFIFFTRTDDNAENPAWEAIGYNVDTREPPVHSSQ  196

Query  363  kkqkhhdheddieeLLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIEC  539
            +++               P+ KGI++   + +  V   L + G +V++         ++C
Sbjct  197  EQR---------------PIQKGIVECRMMNDSTVVQILEEKGLTVSEDVDQ-SVLKVQC  240

Query  540  DAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            D V+VGSGCGGGV + +LA+ G+KV++LEKGNY+A  + S LEGPS+++++L
Sbjct  241  DVVIVGSGCGGGVAAAILASHGHKVVILEKGNYFAPGDYSSLEGPSLNELYL  292



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 117/204 (57%), Gaps = 18/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            +TR+GTLLLCG      ++PF+ +F E+  K RE  +  W  + +   IR     +K + 
Sbjct  94   ATRLGTLLLCGSLCFCEKWPFVWKFSEMPLKNREEALRRWFKNKVFTPIRAALALIKLVS  153

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L +FF+ VD  GDNPSW+AI Y    P I E   K                PL KGII+ 
Sbjct  154  LYIFFSRVDVNGDNPSWEAIKYV---PEIDEHPSKSSDVR-----------PLQKGIIEP  199

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +LA++G KV+V
Sbjct  200  NNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAILASSGQKVMV  257

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+  ++ S LEGPS+++++
Sbjct  258  LEKGNYFTASDYSSLEGPSLEQLY  281



>gb|EMT02982.1| Putative GMC-type oxidoreductase [Aegilops tauschii]
Length=598

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 116/208 (56%), Gaps = 26/208 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLLLCG+ SL      L RF ++  +++E  +  W  +   F +R  F  +K L 
Sbjct  112  STRVGTLLLCGRLSLCGAAGELRRFADMPAERQEAALQRWNRTRWLFPLRIVFALVKILS  171

Query  264  LLVFFTSVDDKGDNPSWKAIGYC----GPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
              VF+T VD+  +NP WKAIGY       DP+ +    +                PL  G
Sbjct  172  HYVFYTMVDENSENPHWKAIGYSVEEWQRDPAEAPAPSR----------------PLDNG  215

Query  432  IIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            +++   L +  +   L   G     P  PG    +ECDAV+VGSGCGGGV + +LA+AGY
Sbjct  216  VVETRALNDTTLLRSLADRGL----PVKPGAQHTVECDAVIVGSGCGGGVAAAILASAGY  271

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+V+EKG+Y+A  + S +EGPSM+++F
Sbjct  272  KVVVVEKGDYFAADDYSSVEGPSMERLF  299



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 118/204 (58%), Gaps = 18/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            +TR+GTLLLCG      ++PF+ +F E+  +KRE  +  W  + +   +R     +K + 
Sbjct  26   ATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKVFTPVRAALALIKLVF  85

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L VFF+ VD  GDNPSW+AI Y    P I E   K                PL KGII+ 
Sbjct  86   LYVFFSRVDVNGDNPSWEAIKYV---PEIDEHPSKSSDAR-----------PLEKGIIEP  131

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +LA++G KV++
Sbjct  132  NNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAILASSGQKVMI  189

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+  ++ S LEGPS+++++
Sbjct  190  LEKGNYFIASDYSSLEGPSLEQLY  213



>ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum tuberosum]
Length=734

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 124/204 (61%), Gaps = 16/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+G+LLLCG+  L  ++PF+  F E+  K RE ++  W+  +    +R  F  +K + 
Sbjct  91   STRLGSLLLCGRVCLDKRWPFVHNFSELDLKDREALLQRWSRETFLIPLRITFLMIKIVC  150

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
              +FF+  D+   NP+W+AIGY  P+ + +    K++              PL +GI++ 
Sbjct  151  FFIFFSWTDENCKNPTWEAIGYHLPETTETLSVNKKER-------------PLERGIVET  197

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  +E +   L+K G ++A+      +F I+CD ++VGSGCGGGV +G+LA +GYKV+V
Sbjct  198  INESDETLKESLSKKGVAIAEDTKDN-TFKIKCDVLIVGSGCGGGVAAGILAKSGYKVVV  256

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGPS+ +++
Sbjct  257  LEKGHYFVPEDYSGLEGPSLSELY  280



>ref|XP_004157399.1| PREDICTED: LOW QUALITY PROTEIN: puromycin-sensitive aminopeptidase-like 
[Cucumis sativus]
Length=934

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 118/204 (58%), Gaps = 18/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            +TR+GTLLLCG      ++PF+ +F E+  +KRE  +  W  + +   +R     +K + 
Sbjct  95   ATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKVFTPVRAALALIKLVX  154

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L VFF+ VD  GDNPSW+AI Y    P I E   K                PL KGII+ 
Sbjct  155  LYVFFSRVDVNGDNPSWEAIKYV---PEIDEHPSKSSDAR-----------PLEKGIIEP  200

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +LA++G KV++
Sbjct  201  NNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAILASSGQKVMI  258

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+  ++ S LEGPS+++++
Sbjct  259  LEKGNYFIASDYSSLEGPSLEQLY  282



>gb|EMS51759.1| Long-chain-alcohol oxidase FAO2 [Triticum urartu]
Length=515

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 116/205 (57%), Gaps = 20/205 (10%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLLLCG+ SL      L RF ++  +++E  +  W  +   F +R  F  +K L 
Sbjct  21   STRVGTLLLCGRLSLCGAAGELRRFADMPAERQEAALQRWNRTRWLFPLRIVFALVKILS  80

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              VF+T VD+  +NP WKAIGY     S+ E Q+ +               PL  G+I  
Sbjct  81   HYVFYTMVDENSENPHWKAIGY-----SVEEWQRDRDEAPATSR-------PLDNGVI--  126

Query  444  NLPEEHVFNRLTKLGCSVAK--PKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
               E    N  T L     +  P  PG    ++CDAV+VGSGCGGGV + +LA+AGYKV+
Sbjct  127  ---ETRALNDTTLLRSLADRWLPVKPGAQHTVQCDAVIVGSGCGGGVAAAMLASAGYKVV  183

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            V+EKG+Y+A  + S +EGPSM+++F
Sbjct  184  VVEKGDYFAADDYSSVEGPSMERLF  208



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
Length=738

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 118/204 (58%), Gaps = 18/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            +TR+GTLLLCG      ++PF+ +F E+  +KRE  +  W  + +   +R     +K + 
Sbjct  95   ATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKVFTPVRAALALIKLVF  154

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L VFF+ VD  GDNPSW+AI Y    P I E   K                PL KGII+ 
Sbjct  155  LYVFFSRVDVNGDNPSWEAIKYV---PEIDEHPSKSSDAR-----------PLEKGIIEP  200

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +LA++G KV++
Sbjct  201  NNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAILASSGQKVMI  258

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+  ++ S LEGPS+++++
Sbjct  259  LEKGNYFIASDYSSLEGPSLEQLY  282



>ref|XP_010038987.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
Length=441

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 138/237 (58%), Gaps = 25/237 (11%)
 Frame = +3

Query  3    NNLQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  182
            N  QVA ++ +R +   +  + ++L  LS R+GTL+LC    L++ +PF+L F E+  ++
Sbjct  83   NGEQVAEILTKRAQRQVVVMVSIVLKMLSFRLGTLMLCWGSCLASTWPFILNFSEMPVER  142

Query  183  RERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-----CGPDP  344
            RER++ +W+       +R  F  +K   L +F+T  D+  +N +W+AIGY       P+ 
Sbjct  143  RERVLMNWSRQKFVVPLRIVFVMIKIYCLFIFYTRTDENSNNLAWEAIGYRVDKRQKPNE  202

Query  345  SISekqkkqkhhdheddieeLLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGP  521
            S +++++                 PL +G+++ ++  +  +   LT+ G  V +  P   
Sbjct  203  SHNKQER-----------------PLQRGLVETVHETDSSLIQSLTQKGLKVTQI-PQHN  244

Query  522  SFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            +F I+CD V++GSGCGGGV + VLA +G KV+VLEKGNY+   + S LEGPS+D+++
Sbjct  245  AFKIKCDVVIIGSGCGGGVAAAVLAHSGQKVVVLEKGNYFVPQDYSSLEGPSLDQLY  301



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 118/205 (58%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STR+GT LLCG      ++P+   F  I   KRER++  W        IR  F  +K LV
Sbjct  100  STRLGTFLLCGSLCFGEKWPYFKNFSSIPLDKRERVLQKWFKHRFFTPIRTAFVYVKILV  159

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L VFF+ VD+KGDNP+W+AI Y  G D +  +  K++               PL KG+ID
Sbjct  160  LYVFFSRVDEKGDNPAWEAIEYNAGTDENPDQVPKER---------------PLQKGLID  204

Query  441  LNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             N   +  + + L + G  V +  P    + I+CD V+VGSGCGGGV + VLA +G KV 
Sbjct  205  TNQETDSTLLHSLKEKGLRVTQ-DPRKNLYKIKCDVVIVGSGCGGGVAAAVLAASGQKVF  263

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+  T+ S LEGPSMD+++
Sbjct  264  VLEKGNYFTATDYSGLEGPSMDQLY  288



>ref|XP_006283178.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=598

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 100/147 (68%), Gaps = 8/147 (5%)
 Frame = +3

Query  276  FTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPE  455
              SVD+KG N +WKAIGY GP    S+   +++ ++ +   E  +FGPLY GI+DLN P 
Sbjct  1    MNSVDEKGRNLAWKAIGYNGPSLDDSDHDLEEELNEKKKKPE-EIFGPLYNGIVDLNCPR  59

Query  456  EHVFNRLTKLGCSVA--KPKPPG-----PSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            E V  +LT  G +V+  K K  G     P   I CDAVVVGSG GGGV++GVLA AGYKV
Sbjct  60   EAVTKKLTGRGFTVSSQKNKSKGSSLSNPVMTIRCDAVVVGSGSGGGVVAGVLAKAGYKV  119

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMFL  695
            LV+E GNYYAR+NLSLLEG +M+ M+L
Sbjct  120  LVVESGNYYARSNLSLLEGQAMEDMYL  146



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 120/211 (57%), Gaps = 30/211 (14%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L T++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  98   ATRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVIQKQFRNWI---LTPIRAGFVYIK  154

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYC----GPDPSISekqkkqkhhdheddieeLLFGPL  422
             + L  FF+ V  KG+NP+W+AIGY        PS + K +                 PL
Sbjct  155  VIFLFCFFSRVSPKGENPAWEAIGYHVNLDENKPSATYKAR-----------------PL  197

Query  423  YKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLAT  599
             KGI++ +N  E+ +   L + G   A       +  I+CDAVV+GSG GGGV + VLA 
Sbjct  198  EKGIVETMNETEQTLLESLARKGLE-ADHDMDQDTIRIKCDAVVIGSGSGGGVAASVLAK  256

Query  600  AGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            +G KV+VLEKG+YY  ++    EGP MDK++
Sbjct  257  SGLKVVVLEKGSYYTPSDYRPYEGPGMDKLY  287



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 137/230 (60%), Gaps = 19/230 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KRE+
Sbjct  74   KVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKREK  133

Query  192  IVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqk  365
            ++  W  + +   +R  F  +K   L VFF  +D+ G NP+W+AI Y    D  +SE Q+
Sbjct  134  VLQKWFKNWIFTPVRIAFVTLKIFCLFVFFCQLDENGKNPAWEAIDYHVENDEDVSEVQQ  193

Query  366  kqkhhdheddieeLLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECD  542
            ++               PL KGI++ +   +  + + LT+ G  V K       + I+CD
Sbjct  194  ER---------------PLEKGIVETMYETDSTIVHSLTQKGLQVTKDSKQ-KVYKIKCD  237

Query  543  AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             V+VGSGCGGGV + VLA+AG KV+V+EKGNY+   + SLLEGPS ++++
Sbjct  238  VVIVGSGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLY  287



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 118/204 (58%), Gaps = 16/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GTLL+CG   LS ++PF+  F  +S  KRE+IV        L   R  F  +K L 
Sbjct  98   ATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQRGLKHKFLTPFRLAFVYIKILC  157

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L VFF+ VD+ GDNP+WKAIGY      +S   +K  +   +         PL KGII++
Sbjct  158  LFVFFSWVDENGDNPAWKAIGY-----EVSTADEKMINDTKKR--------PLEKGIIEI  204

Query  444  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
                +    + L+  G +V           I+CDAVVVGSGCGGGV + VL+ AGYKV+V
Sbjct  205  MHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKVVV  263

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPSMD+ +
Sbjct  264  LEKGNYFVPKDYSSLEGPSMDQQY  287



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 117/205 (57%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STR+GT LLCG      ++P+   F  I   KRER++  W        IR  F  +K L+
Sbjct  100  STRLGTFLLCGSLCFEEKWPYFKNFSSIPLDKRERVLQKWFKHRFFTPIRAAFVYVKILI  159

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L VFF+ VD+KGDNP+W+AI Y  G D S  +  K++               PL KG+ID
Sbjct  160  LYVFFSRVDEKGDNPAWEAIEYNVGADESPDQVPKER---------------PLQKGLID  204

Query  441  LNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             N      + + L + G  V +  P    + I+CD V+VGSGCGGGV + VLA +G KV 
Sbjct  205  TNQETASTLLHSLKEKGLRVTQ-DPRKNVYKIKCDVVIVGSGCGGGVAAAVLAASGQKVF  263

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+  ++ S LEGPSMD+++
Sbjct  264  VLEKGNYFTASDYSGLEGPSMDQLY  288



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 115/204 (56%), Gaps = 16/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STR+GTLLLCG      ++PF+L F  +   KRER++  W     L  IR  F  +K L 
Sbjct  75   STRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWFKHRFLTPIRLAFVYIKFLC  134

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L +FF+ VD   +NP W+AIGY       +     ++              PL KGII+ 
Sbjct  135  LYIFFSRVDKNAENPIWQAIGYHVDTDDQNTPTAPKER-------------PLQKGIIET  181

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   +  + +   + G +V +  P    + I+CD VVVGSGCGGGV + VLA++G KV+V
Sbjct  182  IYETDTTLLHSFAEKGLTV-RHDPQEKLYKIKCDVVVVGSGCGGGVAAAVLASSGQKVVV  240

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNYY  ++ S LEGPS D+M+
Sbjct  241  LEKGNYYTHSDYSSLEGPSQDQMY  264



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 118/207 (57%), Gaps = 22/207 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L T++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  98   ATRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVIQKQFRNWI---LTPIRAGFVYIK  154

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
             + L  FF+ V  KG+NP+W+AIGY               + D     E     PL KGI
Sbjct  155  VVFLFCFFSRVSPKGENPAWEAIGY-------------HVNLDENKPSETYKARPLEKGI  201

Query  435  ID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
            ++ +N  E+ +   L + G   A       +  I+CDAVV+GSG GGGV + VLA +G K
Sbjct  202  VETMNETEQTLLESLARKGLK-ADHDMDQDTIRIKCDAVVIGSGSGGGVAASVLAKSGLK  260

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+VLEKG+YY  ++    EGP MDK++
Sbjct  261  VVVLEKGSYYTPSDYRPYEGPGMDKLY  287



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 121/204 (59%), Gaps = 18/204 (9%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--IRNFFTAMKALV  263
            TR+G+LLLCG+  L  ++P +  F  +  +KRE+++ +W      F  IR  F  +K   
Sbjct  102  TRVGSLLLCGRQCLGKEWPIINDFGSMGLEKREKVMQNWLKHGFLFTPIRAAFIYLKVFC  161

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L V+F+ V + G+NP+W+AIGY     ++ + + + +              PL KG+I+ 
Sbjct  162  LFVYFSRVGEDGENPAWEAIGY-----NVDKVEDQPQARKER---------PLQKGMIET  207

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            ++  +  ++  L++ G  V +       + I+CDAV++GSGCGGGV + +LA +G KV+V
Sbjct  208  VHEKDSTLYRSLSQKGLLVTEDTQQN-VYRIKCDAVIIGSGCGGGVAAAMLAGSGLKVVV  266

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKGNY+  T+ S  EGPSMDK++
Sbjct  267  VEKGNYFTSTDYSPFEGPSMDKLY  290



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 19/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS-SLQFIRNFFTAMKALV  263
            S R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I  +W    S   +R  F  +K   
Sbjct  77   SFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWVALRVVFVLIKLFC  136

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+  D  G NP+WKAIGY                     +       PL KG+I+ 
Sbjct  137  FYNFFSRTDANGQNPTWKAIGY----------------QVDTKEKLIRKERPLEKGLIET  180

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   +  +   LT+ G  V + K     + ++CD V+VGSGCGGGV + VLA +G+KV+V
Sbjct  181  MYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVIVGSGCGGGVAAAVLANSGHKVVV  239

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG Y+   + S LEGPSMD+ +
Sbjct  240  LEKGEYFVSHDYSSLEGPSMDEQY  263



>ref|XP_010475034.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Camelina sativa]
Length=752

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 119/204 (58%), Gaps = 20/204 (10%)
 Frame = +3

Query  93   RIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVL  266
            R+GTLLLCG  +L    +PFLL+F EIS +KRE+++  W T       R  F  +KA+ L
Sbjct  104  RLGTLLLCGLVNLDKASWPFLLKFSEISLEKREKVLQRWNTQWYNPLARIGFMMIKAIFL  163

Query  267  LVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              +FT  D+  +NP+W AIGY  G D +   + K++               PL KGII+ 
Sbjct  164  FYYFTWTDENTENPAWDAIGYSVGIDENEGMEHKER---------------PLEKGIIET  208

Query  444  N-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            + + E  +  R+   G  V + +    ++ IECDAVVVGSGCGGGV +  LA +G +V+V
Sbjct  209  DKVNEMTIKQRMINKGLKVTEDRES-DTYKIECDAVVVGSGCGGGVAAANLAKSGLRVVV  267

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPS  ++F
Sbjct  268  LEKGNYFVSRDYSALEGPSTFELF  291



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 19/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS-SLQFIRNFFTAMKALV  263
            S R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I  +W    S   +R  F  +K   
Sbjct  98   SFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWVALRVVFVLIKLFC  157

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+  D  G NP+WKAIGY                     +       PL KG+I+ 
Sbjct  158  FYNFFSRTDANGQNPTWKAIGY----------------QVDTKEKLIRKERPLEKGLIET  201

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   +  +   LT+ G  V + K     + ++CD V+VGSGCGGGV + VLA +G+KV+V
Sbjct  202  MYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVIVGSGCGGGVAAAVLANSGHKVVV  260

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG Y+   + S LEGPSMD+ +
Sbjct  261  LEKGEYFVSHDYSSLEGPSMDEQY  284



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 19/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS-SLQFIRNFFTAMKALV  263
            S R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I  +W    S   +R  F  +K   
Sbjct  98   SFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWVALRVVFVLIKLFC  157

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+  D  G NP+WKAIGY                     +       PL KG+I+ 
Sbjct  158  FYNFFSRTDANGQNPTWKAIGY----------------QVDTKEKLIRKERPLEKGLIET  201

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   +  +   LT+ G  V + K     + ++CD V+VGSGCGGGV + VLA +G+KV+V
Sbjct  202  MYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVIVGSGCGGGVAAAVLANSGHKVVV  260

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG Y+   + S LEGPSMD+ +
Sbjct  261  LEKGEYFVSHDYSSLEGPSMDEQY  284



>gb|KJB10007.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=665

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 120/206 (58%), Gaps = 23/206 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  260
            S R+G LLLCG      ++PF+ +F E+  ++RE+I+  W+++    +  R  F  +K  
Sbjct  23   SFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWSSNGHHRLPLRAVFALIKTY  82

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPL-YKGII  437
             L +FF+  D+K +NPSWKAIGY                  + D  ++ +  P   KGII
Sbjct  83   CLFIFFSMTDEKSENPSWKAIGY------------------NVDKRQKRVSSPHGRKGII  124

Query  438  DLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +    ++  F   LT+ G  V +  P    F I+CD V+VGSGCGGGV + VLA++G KV
Sbjct  125  ETMHEDDSTFVQSLTEKGLQVTE-DPDHNVFNIKCDVVIVGSGCGGGVAAAVLASSGQKV  183

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+A T+ + LEGPSM +++
Sbjct  184  VVIEKGNYFATTDYTSLEGPSMSELY  209



>ref|XP_010457422.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Camelina sativa]
Length=752

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 115/203 (57%), Gaps = 18/203 (9%)
 Frame = +3

Query  93   RIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVL  266
            R+GTLLLCG   L    +PFLL+F EIS +KRE+++  W T       R  F  +KA+ L
Sbjct  104  RLGTLLLCGLVCLDQANWPFLLKFSEISLEKREKVLQRWNTQWYNPLARIGFMMIKAIFL  163

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLN  446
              +FT  D+  +NP+W AIGY     S+   + +   H            PL KGII+ +
Sbjct  164  FYYFTWTDENTENPAWDAIGY-----SVDMNESEGMEHKER---------PLEKGIIETD  209

Query  447  LPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
              +E     R+   G  V + +    ++ IECDAVVVGSGCGGGV +  LA +G +V+VL
Sbjct  210  KEDEMTIKQRMINKGLKVTEDRES-DTYKIECDAVVVGSGCGGGVAAANLAKSGLRVVVL  268

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKGNY+   + S LEGPS  +MF
Sbjct  269  EKGNYFVPRDYSSLEGPSTFEMF  291



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 136/230 (59%), Gaps = 19/230 (8%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KRE+
Sbjct  74   KVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKREK  133

Query  192  IVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqk  365
            ++  W  + +   +R  F  +K   L VFF  +D+ G NP+W+AI Y    D  +SE Q+
Sbjct  134  VLQKWFKNWIFTPVRIAFFILKTFCLFVFFCQLDENGKNPAWEAIDYHVENDEDVSEVQQ  193

Query  366  kqkhhdheddieeLLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECD  542
            ++               PL KGI++ +   +  +   LT+ G  V K       + I+CD
Sbjct  194  ER---------------PLEKGIVETMYETDSTIVQSLTQKGLQVTKDSKQNV-YKIKCD  237

Query  543  AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             V+VGSGCGGGV + VLA+AG KV+V+EKGNY+   + SLLEGPS ++++
Sbjct  238  VVIVGSGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLY  287



>gb|KJB10006.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=742

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 120/206 (58%), Gaps = 23/206 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  260
            S R+G LLLCG      ++PF+ +F E+  ++RE+I+  W+++    +  R  F  +K  
Sbjct  100  SFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWSSNGHHRLPLRAVFALIKTY  159

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPL-YKGII  437
             L +FF+  D+K +NPSWKAIGY                  + D  ++ +  P   KGII
Sbjct  160  CLFIFFSMTDEKSENPSWKAIGY------------------NVDKRQKRVSSPHGRKGII  201

Query  438  DLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +    ++  F   LT+ G  V +  P    F I+CD V+VGSGCGGGV + VLA++G KV
Sbjct  202  ETMHEDDSTFVQSLTEKGLQVTE-DPDHNVFNIKCDVVIVGSGCGGGVAAAVLASSGQKV  260

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+A T+ + LEGPSM +++
Sbjct  261  VVIEKGNYFATTDYTSLEGPSMSELY  286



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 122/204 (60%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+G+L+LCG+  L  ++PF+  F E+S K+RE ++  W+  S    +R  F  +K + 
Sbjct  98   STRLGSLVLCGRVCLDKRWPFVHNFSELSLKQRESLLQRWSRESFLLPLRITFLLIKTMC  157

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
              +FF+  D+   NP+W+AIGY  PD   +  +  ++              PL KGI++ 
Sbjct  158  FFIFFSWTDENCKNPAWEAIGY-QPDTRQTPSENHKER-------------PLEKGIVET  203

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  +E +   L+K G  + +      +F I CD V+VGSGCGGGV + +LA +G+KV+V
Sbjct  204  INESDETLKESLSKKGVPLTEDTKDN-TFKIRCDVVIVGSGCGGGVAAAILAKSGHKVVV  262

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGPS+++++
Sbjct  263  LEKGHYFVPEDYSGLEGPSLNELY  286



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 114/206 (55%), Gaps = 19/206 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            S R+GTLLLCG       +PF+  F EIS +KRE+I+  W+    L  +R  F  +K   
Sbjct  98   SFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKKWSRERYLLPLRIVFVMIKMFC  157

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L  FF   D+K +NP+W+AIGY       S K + ++              PL KGI++ 
Sbjct  158  LFDFFARTDEKSENPAWEAIGYHVDTREPSNKPRGER--------------PLQKGIVET  203

Query  444  ---NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
               N  +  +F RL   G  V         F I+CD VVVGSGCGGGV + VLA++G KV
Sbjct  204  VHENENDHSLFQRLVDHGLQVTVDHEHNL-FEIKCDVVVVGSGCGGGVAAAVLASSGQKV  262

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            LVLEKGNY+   + S LEGPSM +++
Sbjct  263  LVLEKGNYFVAEDYSSLEGPSMHELY  288



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 118/207 (57%), Gaps = 22/207 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            ++R+GTLL+CG   L T++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  95   ASRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVIQKQFRNWI---LTPIRAGFVYIK  151

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
             + L  FF+ V  KG+NP+W+AIGY               + D     E     PL KGI
Sbjct  152  VIFLFCFFSRVSPKGENPAWEAIGY-------------HVNLDENKPSETYKARPLEKGI  198

Query  435  ID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
            ++ +N  E+ +   L + G   A       +  I+CDAVV+GSG GGGV + VLA +G K
Sbjct  199  VETMNETEQTLLESLARKGLE-ADHDMDQDTIRIKCDAVVIGSGSGGGVAASVLAKSGLK  257

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+VLEKG+YY  ++    EGP MDK++
Sbjct  258  VVVLEKGSYYTPSDYRPYEGPGMDKLY  284



>gb|KJB72416.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=677

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 135/231 (58%), Gaps = 18/231 (8%)
 Frame = +3

Query  9    LQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  188
            LQVA ++ +R     +  + ++L  L TR+G+LLLCG+  L  ++PF+  F  +  +KRE
Sbjct  6    LQVAELLGKRAFIESVIVVRIVLVLLWTRVGSLLLCGRQCLGKEWPFINDFGSMGVEKRE  65

Query  189  RIVHSWATSSLQF--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekq  362
            +++ +W      F   R  F  +K   L V+F+ V + G NP+W+AIGY     ++ + +
Sbjct  66   KVMQNWLKHGFLFTPTRVAFIYLKVFCLFVYFSRVGEDGYNPAWEAIGY-----NVDKVE  120

Query  363  kkqkhhdheddieeLLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIEC  539
             + +              PL KG+I+ ++  +  ++  L++ G  V++       + I+C
Sbjct  121  DQPQARKER---------PLQKGMIETVHEKDSTLYRSLSQKGLLVSEDTQQNV-YRIKC  170

Query  540  DAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            DAVV+GSGCGGGV + +LA +G KV+V+EKGNY+  T+ S  EGPSMDK++
Sbjct  171  DAVVIGSGCGGGVAAAMLAGSGLKVVVVEKGNYFTSTDYSPFEGPSMDKLY  221



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 119/206 (58%), Gaps = 20/206 (10%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STR+GTLLLCG      ++PF+L F  +   KRER++  W     L  IR  F  +K L 
Sbjct  101  STRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWFKHRFLTPIRLAFVYIKFLC  160

Query  264  LLVFFTSVDDKGDNPSWKAIGYCG--PDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L +FF+ VD   +NP W+AIGY     D +I    K++               PL KG+I
Sbjct  161  LYIFFSRVDKNAENPIWQAIGYHVDIDDQNIPTAPKER---------------PLQKGMI  205

Query  438  D-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            + +   +  + + L + G +V +  P    + I+CD VVVGSGCGGGV + VLA++G KV
Sbjct  206  ETIYETDTTLLHSLAEKGLTV-RHDPQENLYKIKCDVVVVGSGCGGGVAAAVLASSGQKV  264

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+  ++ S LEGPS D+M+
Sbjct  265  IVLEKGNYFTHSDYSSLEGPSQDQMY  290



>gb|KHG08529.1| Long-chain-alcohol oxidase FAO2 [Gossypium arboreum]
Length=684

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 137/232 (59%), Gaps = 24/232 (10%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlns-lllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  188
            +VA ++ +R+  P++ S + ++L  +S R+G LLLCG      ++PF+ +F E+  ++RE
Sbjct  74   EVAEMMVKRVVEPRVLSFVKVVLAVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERRE  133

Query  189  RIVHSWATSSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekq  362
            +I+  W+++    +  R  F  +K   L +FF+  D+  +NPSWKAIGY           
Sbjct  134  KILMKWSSNGHHRLPLRAVFALIKTYCLFIFFSMTDENSENPSWKAIGY-----------  182

Query  363  kkqkhhdheddieeLLFGPL-YKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIE  536
                   + D  ++ +  P   KGII+    ++  F   LT+ G  V +  P    F I+
Sbjct  183  -------NVDKRQKRVSSPHGRKGIIETMHEDDSTFVQSLTEKGLQVTE-DPDHNVFKIK  234

Query  537  CDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            CD V+VGSGCGGGV + VLA++G+KV+V+EKGNY+A T+ + LEGPSM +++
Sbjct  235  CDVVIVGSGCGGGVAAAVLASSGHKVVVIEKGNYFATTDYTSLEGPSMSELY  286



>ref|XP_006306477.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
 gb|EOA39375.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
Length=752

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 118/206 (57%), Gaps = 24/206 (12%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVL  266
            R+GTLLLCG  SL  + +PFLL+F +IS +KRE+++  W T       R  F  +KA+ L
Sbjct  104  RLGTLLLCGLVSLDKENWPFLLKFSDISLEKREKVLQRWNTQWYNPLARLGFMMIKAIFL  163

Query  267  LVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              +FT  ++  +NP+W AIGY    G +  +  K++                 PL KGII
Sbjct  164  FYYFTWTNENTENPAWDAIGYRVDMGENEGMEHKER-----------------PLEKGII  206

Query  438  DL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +   + E  +  R+   G  V + +    ++ IECDAV+VGSGCGGGV +  LA +G KV
Sbjct  207  ETAEVDEMTIKQRMINKGLKVTEDRES-DTYKIECDAVIVGSGCGGGVAAANLAKSGLKV  265

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+   + S LEGPS  ++F
Sbjct  266  VVLEKGNYFVPRDYSALEGPSTFELF  291



>dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 76/203 (37%), Positives = 118/203 (58%), Gaps = 12/203 (6%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALVL  266
            TR+GTL LCG+  +S +FP++ RF ++   +RE  +  W  +  L  ++  F  +K+L  
Sbjct  108  TRLGTLALCGRLCVSGEFPYVRRFADMPVGRREEALGRWTRARWLIPVKIAFAIVKSLCF  167

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL-  443
             VF+T V++  +NP WKAIG+  P+          K    +   E     PL KG+++  
Sbjct  168  NVFYTKVNENSENPCWKAIGFSVPN---------VKEQRKKHPTEAAALRPLDKGVVETR  218

Query  444  NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
             L +  +   L   G +V KP   G    +ECD V+VGSGCGGGV + VLA+ G+KVLV+
Sbjct  219  ELDDATLLRSLADKGLAV-KPATSGYYHAVECDVVIVGSGCGGGVAAAVLASVGHKVLVV  277

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKG+Y+   + S +EGPSM++++
Sbjct  278  EKGDYFTPDDYSSVEGPSMERLY  300



>ref|XP_010501308.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO1-like 
[Camelina sativa]
Length=744

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 116/203 (57%), Gaps = 18/203 (9%)
 Frame = +3

Query  93   RIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVL  266
            R+GTLLLCG   L    +PFLL+F EIS +KRE+++  W T       R  F  +KA+ L
Sbjct  104  RLGTLLLCGLVCLDKANWPFLLKFSEISLEKREKVLQRWNTQWYNPLARIGFMMIKAIFL  163

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLN  446
              +FT  D+  +NP+W AIGY     S+   + +   H            PL KGII+ +
Sbjct  164  FYYFTWTDENTENPAWDAIGY-----SVDMNENEGMKHKER---------PLEKGIIETD  209

Query  447  -LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
             + E  +  R+   G  V + +    ++ IECDAVVVGSGCGGGV +  LA +G +V+VL
Sbjct  210  KVNEMTIKQRMINKGLKVTEDRES-DTYKIECDAVVVGSGCGGGVAAANLAKSGLRVVVL  268

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKGNY+   + S LEGPS  +MF
Sbjct  269  EKGNYFVPRDYSALEGPSTFEMF  291



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 122/205 (60%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            ST++GTL+LCG   LS ++P++  F  +S +KRE+++  W  + +   +R  F  +K   
Sbjct  99   STKLGTLMLCGSLCLSEKWPYINNFSSMSLEKREKVLQKWFKNWIFTPVRIAFFILKIFC  158

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP-DPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L VFF+ +D+ G NP+W+AI Y    D  +SE Q+++               PL KGI++
Sbjct  159  LFVFFSQLDENGKNPAWEAIDYHAENDEDVSEVQQER---------------PLEKGIVE  203

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +      +   LT+ G  V K       + I+CD V+VGSGCGGGV + VLA+AG KV+
Sbjct  204  TMYETGSTIVQSLTQKGLQVTKDSKQNV-YKIKCDVVIVGSGCGGGVAAAVLASAGQKVV  262

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            V+EKGNY+   + SLLEGPS ++++
Sbjct  263  VIEKGNYFTPKDYSLLEGPSFEQLY  287



>gb|KJB72414.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=746

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 121/204 (59%), Gaps = 18/204 (9%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--IRNFFTAMKALV  263
            TR+G+LLLCG+  L  ++PF+  F  +  +KRE+++ +W      F   R  F  +K   
Sbjct  102  TRVGSLLLCGRQCLGKEWPFINDFGSMGVEKREKVMQNWLKHGFLFTPTRVAFIYLKVFC  161

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L V+F+ V + G NP+W+AIGY     ++ + + + +              PL KG+I+ 
Sbjct  162  LFVYFSRVGEDGYNPAWEAIGY-----NVDKVEDQPQARKER---------PLQKGMIET  207

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            ++  +  ++  L++ G  V++       + I+CDAVV+GSGCGGGV + +LA +G KV+V
Sbjct  208  VHEKDSTLYRSLSQKGLLVSEDTQQN-VYRIKCDAVVIGSGCGGGVAAAMLAGSGLKVVV  266

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKGNY+  T+ S  EGPSMDK++
Sbjct  267  VEKGNYFTSTDYSPFEGPSMDKLY  290



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 122/205 (60%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            ST++GTL+LCG   LS ++P++  F  +S +KRE+++  W  + +   +R  F  +K   
Sbjct  99   STKLGTLMLCGSLCLSEKWPYINNFSSMSLEKREKVLQKWFKNWIFTPVRIAFFILKIFC  158

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP-DPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L VFF+ +D+ G NP+W+AI Y    D  +SE Q+++               PL KGI++
Sbjct  159  LFVFFSQLDENGKNPAWEAIDYHAENDEDVSEVQQER---------------PLEKGIVE  203

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +      +   LT+ G  V K       + I+CD V+VGSGCGGGV + VLA+AG KV+
Sbjct  204  TMYETGSTIVQSLTQKGLQVTKDSKQNV-YKIKCDVVIVGSGCGGGVAAAVLASAGQKVV  262

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            V+EKGNY+   + SLLEGPS ++++
Sbjct  263  VIEKGNYFTPKDYSLLEGPSFEQLY  287



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 122/205 (60%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  260
            +T++GTL+LCG  SL  +FPF+ +F ++S +KRE ++  W   ++ FI  R  F  +K  
Sbjct  107  ATKLGTLVLCGSLSLCGEFPFINKFSDMSVEKREEVLKRWNKENI-FIPLRMVFVMVKVF  165

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
             L +F++  ++  +N SW AIGY  P      K + ++              PL KGII+
Sbjct  166  CLHIFYSMTNENSENLSWNAIGYSLPTEEKPPKSQSER--------------PLEKGIIE  211

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             ++  +  + + LTK G +V++  P    + I CD  +VGSGCGGGV + VLA+AG+KV+
Sbjct  212  TMDQNDSSLLHSLTKKGLAVSQ-DPIQNMYRIRCDVAIVGSGCGGGVAAAVLASAGHKVV  270

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            V+EKGNY+   + + +E PSM +M+
Sbjct  271  VIEKGNYFTSEDYTSIEAPSMYEMY  295



>gb|KHN11789.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=622

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 99/159 (62%), Gaps = 19/159 (12%)
 Frame = +3

Query  276  FTSVDDKGDNPSWKAIGYCGPDPSI----------SekqkkqkhhdheddieeLLFGPLY  425
            +  +D+  DN +WKAIGYCGPDP               +   +    ED+  E + GPLY
Sbjct  5    YFQIDESEDNVAWKAIGYCGPDPEFKAQLKNHFLDGTSKGGGQEDKEEDEDAEEMIGPLY  64

Query  426  KGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG-------PSFVIECDAvvvgsgcgggv  578
            KG++ LN P++   + L + G   SV + K          PS VI+CDAVVVGSG GGGV
Sbjct  65   KGLVHLNYPQDITADALRRFGFPVSVIRRKHKAAAANLSCPSLVIQCDAVVVGSGSGGGV  124

Query  579  isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  695
            I+GVLA AGYKVLVLEKG Y A+ NLSLLEGP+MD+M+L
Sbjct  125  IAGVLAKAGYKVLVLEKGGYSAKNNLSLLEGPTMDQMYL  163



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 113/202 (56%), Gaps = 19/202 (9%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLL  269
            R+GTLLLCG       +PF  +F E+S KKRE I+  W+     F +R  F A++   L 
Sbjct  23   RLGTLLLCGFICFDWNWPFFHKFSELSVKKREEILLKWSRQKYIFPLRAAFVAVRIFCLY  82

Query  270  VFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL-N  446
             FF+  D+  +NP+W+AIGY   +     ++++                PL KGI++L N
Sbjct  83   TFFSRTDENSENPAWEAIGYHKDNREKLRREER----------------PLQKGIVELAN  126

Query  447  LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLE  626
              +  +   L + G  V +         I+CD V+VGSGCGGGV + VLA++G KVLVLE
Sbjct  127  EDDSTILQSLIEKGLEVTEDSEH-KICKIKCDVVIVGSGCGGGVAAAVLASSGLKVLVLE  185

Query  627  KGNYYARTNLSLLEGPSMDKMF  692
            KGNY+   + S LEGPSM +++
Sbjct  186  KGNYFVAEDYSSLEGPSMAELY  207



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 112/204 (55%), Gaps = 19/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GTLL+CG+  L  ++PF+ +F EIS +KRE I+ +W+       +R  F  +K + 
Sbjct  93   SFRLGTLLICGRLCLDWKWPFIHKFSEISLEKREEILRNWSREKRWVPLRLVFVLIKLIF  152

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
               FF+  D+ G NP WKAIGY                             PL KG+I+ 
Sbjct  153  FCTFFSRSDENGHNPVWKAIGY----------------QVDTKKKLVRKERPLEKGLIET  196

Query  444  NLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
                +H +   L + G  V++ K     + ++CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  197  MHETDHTLMQSLAEKGLEVSEDKLQNL-YKVKCDVVIVGSGCGGGVAAAVLANSGQKVIV  255

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG Y+   + S LEGPSMD+++
Sbjct  256  LEKGEYFVSHDYSSLEGPSMDELY  279



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 123/205 (60%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GTLLLCG   L  ++P++  F  IS +KRE ++  W     L  IR  F  +K L 
Sbjct  105  ATRLGTLLLCGFLCLGEKWPYVNNFSNISLEKREMVMQKWLKHRFLTPIRLAFAYIKVLC  164

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP-DPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L VFF+ VD+ GDNP+WKAIGY  P D +++   K +               PL KGII+
Sbjct  165  LFVFFSWVDENGDNPAWKAIGYEVPADENLTNASKTR---------------PLEKGIIE  209

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +N  +  +   L   G +V           ++CDA+VVGSGCGGGV + VL++AGYKV+
Sbjct  210  TMNESDSALQQSLANKGLNVTLDSKSNI-LKVKCDALVVGSGCGGGVAAAVLSSAGYKVV  268

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY++  + S LEGPSM++++
Sbjct  269  VLEKGNYFSTQDYSSLEGPSMNQLY  293



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 121/205 (59%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GTLLLCG   L   +P++ +F  IS +KRE+I+  W     L  IR  F  +K L 
Sbjct  104  ATRLGTLLLCGFLCLGENWPYINKFSNISLEKREKIMQKWLKHRFLTPIRLTFACIKVLC  163

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP-DPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L VFF+ VD+ GDNP+WKAIGY  P D  ++     +               PL KGII+
Sbjct  164  LFVFFSWVDENGDNPAWKAIGYEVPADEKMTNTSNTR---------------PLEKGIIE  208

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +N  +  +   L   G +V           ++CDA+VVGSGCGGGV + VL++AG+KV+
Sbjct  209  TMNESDSTLQQSLANKGLNVTLDSKSNI-LKVKCDALVVGSGCGGGVAAAVLSSAGHKVV  267

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+   + S LEGPSM++++
Sbjct  268  VLEKGNYFTPQDYSSLEGPSMNQLY  292



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 121/205 (59%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GTLLLCG   L   +P++ +F  IS +KRE+I+  W     L  IR  F  +K L 
Sbjct  104  ATRLGTLLLCGFLCLGENWPYINKFSNISLEKREKIMQKWLKHRFLTPIRLTFACIKVLC  163

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP-DPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L VFF+ VD+ GDNP+WKAIGY  P D  ++     +               PL KGII+
Sbjct  164  LFVFFSWVDENGDNPAWKAIGYEVPADEKMTNTSNTR---------------PLEKGIIE  208

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +N  +  +   L   G +V           ++CDA+VVGSGCGGGV + VL++AG+KV+
Sbjct  209  TMNESDSTLQQSLANKGLNVTLDSKSNI-LKVKCDALVVGSGCGGGVAAAVLSSAGHKVV  267

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+   + S LEGPSM++++
Sbjct  268  VLEKGNYFTPQDYSSLEGPSMNQLY  292



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 122/204 (60%), Gaps = 16/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            +TR+G+LLLCG+  L  ++PF+  F E+  K RE ++  W+  +    +R  F  +K + 
Sbjct  88   TTRLGSLLLCGRVCLDKRWPFVHNFTELDLKDREALLQRWSRETFLIPLRITFLMIKIIY  147

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L +FF+  D+   NP+W+AIGY  P+ + +  + K++              PL +GI++ 
Sbjct  148  LFIFFSWTDENCKNPTWEAIGYHLPETTEALYENKKER-------------PLERGIVET  194

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  +E +   L+K    + +       F IECD ++VGSGCGGGV +G+LA +GYKV+V
Sbjct  195  INESDETLKESLSKKDVVITEDAKDNI-FKIECDVLIVGSGCGGGVAAGILAKSGYKVVV  253

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGPS+ +++
Sbjct  254  LEKGHYFVPEDYSGLEGPSLSELY  277



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 122/210 (58%), Gaps = 29/210 (14%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STR+GTLLLCG   L+ ++PF+  F  IS + RE+++  W     L  +R  F  +K L 
Sbjct  101  STRLGTLLLCGSLCLNKKWPFINNFSNISLENREKVIQKWLKHRFLTPVRLVFIYIKVLC  160

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L+VFF+  ++ G+N +W+AIGY    D + S   K++               PL KGI++
Sbjct  161  LIVFFSRCNENGENQAWEAIGYEVESDENTSNDHKER---------------PLEKGIVE  205

Query  441  ------LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATA  602
                  L+LP+      L++ G  + +         ++CD V+VGSGCGGGV + VLA +
Sbjct  206  AMNEDNLSLPQS-----LSQKGLEI-EIDAKNNILKVKCDVVIVGSGCGGGVAAAVLAKS  259

Query  603  GYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            G KVLVLEKGNY+ + + S LEGPS+++++
Sbjct  260  GLKVLVLEKGNYFTQNDYSSLEGPSLNELY  289



>emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 emb|CAB78940.1| putative protein [Arabidopsis thaliana]
Length=678

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 92/144 (64%), Gaps = 8/144 (6%)
 Frame = +3

Query  285  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHV  464
            VD+KG N +WKAIGY GP P  S+ + +      +   E  +FGPLY GI+DL  P E V
Sbjct  86   VDEKGRNLAWKAIGYNGPSPDHSDHEVELNEEKKKKKPE-EIFGPLYNGIVDLKSPREAV  144

Query  465  FNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
              +L   G +V+  K          P   I+CDAVVVGSG GGGV +GVLA AGYKVLV+
Sbjct  145  EKKLAGRGFAVSNQKRNTNGSSISDPVMKIQCDAVVVGSGSGGGVAAGVLAKAGYKVLVI  204

Query  624  EKGNYYARTNLSLLEGPSMDKMFL  695
            E GNYYAR+ LSLLEG +MD M+L
Sbjct  205  ESGNYYARSKLSLLEGQAMDDMYL  228



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 121/204 (59%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+G+L+LCG+  L  + PF+  F E+S K+RE ++  W+  S    +R  F  +K + 
Sbjct  83   STRLGSLVLCGRVCLDKRRPFVHNFSELSLKQREPLLQRWSRESFLLPLRITFLLIKIMS  142

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
              +FF+  D+   NP+W+AIGY  PD   +  +  ++              PL KGI++ 
Sbjct  143  FFIFFSWTDENFKNPAWEAIGY-HPDTRQTPSEYHKER-------------PLEKGIVET  188

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  +E +   LTK G  + +      +F I CD V+VGSGCGGGV + +LA +G+KV+V
Sbjct  189  INESDETLKESLTKKGVPLTEDTKDN-TFKIRCDVVIVGSGCGGGVAAAILAKSGHKVVV  247

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGPS+++++
Sbjct  248  LEKGHYFVPEDYSGLEGPSLNELY  271



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 120/207 (58%), Gaps = 23/207 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STR+GT LLCG  +    +PFL +F E+  +KRE+I+  W+ +   + +R FF  +K   
Sbjct  100  STRLGTSLLCGVLTFGCGWPFLYKFSELPLEKREQILQKWSGARYHRHLRMFFMLLKVFC  159

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            +L FF+  ++  +NP+W AIGY       S K ++++              PL KGII+ 
Sbjct  160  MLTFFSMTNENSENPAWDAIGYHVDTERRSYKTERKR--------------PLEKGIIET  205

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSF---VIECDAvvvgsgcgggvisgvLATAGYK  611
            ++  +  +   LT  G  V +    GP +    IECD ++VGSGCGGGV + VLA++G K
Sbjct  206  VSESDSTLVQSLTIKGFKVTR----GPRWNLHKIECDVIIVGSGCGGGVAAAVLASSGQK  261

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+VLEKGNY+   + S LEGPS  +++
Sbjct  262  VIVLEKGNYFVPEDYSSLEGPSFSQLY  288



>ref|XP_006857358.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
 gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 110/209 (53%), Gaps = 27/209 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAM-----  251
            STR+GTLLLCG   LS  FPF+  F E+  +KRE+++ +W+       R+FF+A+     
Sbjct  115  STRLGTLLLCGSTCLSLNFPFIRSFSEMPVEKREKVLMAWSRE-----RSFFSALRLSFA  169

Query  252  --KALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLY  425
              K   + VF++  D    NPSW+AI Y        +    +   D              
Sbjct  170  LFKIFCVYVFYSWTDVNSKNPSWEAIDYSPGPLKPPKNPPPKSFKDSI------------  217

Query  426  KGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAG  605
              I    L +E + + +   G +V +  P      +ECDAVVVGSG GG V +  LA +G
Sbjct  218  --ISTTTLTKESLVSTIKTKGITVTE-DPSADLLTLECDAVVVGSGPGGSVAAAKLAKSG  274

Query  606  YKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            Y+VLVLEKG Y+   + SLLEGPSMD+M+
Sbjct  275  YQVLVLEKGLYFTPQDYSLLEGPSMDQMY  303



>ref|XP_008382898.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2 
[Malus domestica]
Length=674

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 111/204 (54%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GT LLCGK     ++PF+ +F E+S  KRE+++  W+   L   IR  F  +K   
Sbjct  28   SLRLGTFLLCGKCCFDWKWPFIHKFAEMSLDKREQVLKKWSRQKLVITIRLMFMVVKMFC  87

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
               FF+ VD+   NP+WKAIGY              +    E  I+     PL KGII+ 
Sbjct  88   FYTFFSRVDENSRNPAWKAIGY--------------ELDRKEKLIKTPKERPLEKGIIET  133

Query  444  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
                +      LTK G  +A          I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  134  AYESDSTLVESLTKKGLDLA-DDAVNNIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVVV  192

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPSM++++
Sbjct  193  LEKGNYFVPKDYSSLEGPSMNELY  216



>ref|XP_006418179.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
 gb|ESQ36532.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
Length=763

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 117/206 (57%), Gaps = 24/206 (12%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVL  266
            R+GTLLLCG   L  + +PFLL+F +IS  KRE+++  W+T      +R  F  +KA+ L
Sbjct  112  RLGTLLLCGFVCLDKKNWPFLLKFSDISLDKREKVLQKWSTQWYNPLVRIAFMMIKAIFL  171

Query  267  LVFFTSVDDKGDNPSWKAIGYC---GPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              +FT  ++  + P+W AIGY    G +  +  +++                 PL KGII
Sbjct  172  FYYFTWTNENSETPAWDAIGYSVNLGENEDMEHRER-----------------PLEKGII  214

Query  438  DLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +    +E  +  RL   G  V + K    S+ IECDAVVVGSGCGGGV +  LA +G +V
Sbjct  215  ETAKEDEMSIKQRLINKGLIVTEDKES-DSYKIECDAVVVGSGCGGGVAAANLAKSGLRV  273

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            ++LEKGNY+   + S LEGPS  ++F
Sbjct  274  VILEKGNYFVPRDYSALEGPSTFELF  299



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 115/204 (56%), Gaps = 18/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GTLLLCG      ++PF+ +F EI  ++RE+I+  W+       +R  F  +K   
Sbjct  99   SFRLGTLLLCGWDCCDWKWPFIHKFSEIPVERREKILIKWSWKVHPLPLRAVFALIKTYC  158

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L +FF+  D+   NP+WKAIGY   +       + +               PL KGII+ 
Sbjct  159  LFIFFSMTDENSGNPAWKAIGYQVDNRQKKAYPQGR---------------PLQKGIIET  203

Query  444  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
               ++  F   LT+ G  V +  P    + I+CD V+VGSGCGGGV + VLA++G KV+V
Sbjct  204  MHEDDSTFVQSLTEKGLQVME-DPEHNVYKIKCDVVIVGSGCGGGVAAAVLASSGQKVVV  262

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKGNY+A  + + LEGPSM +++
Sbjct  263  IEKGNYFAPQDYTSLEGPSMSELY  286



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 116/204 (57%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GTLLLCG   LS ++PF+  F E+S +KRE ++  W+   L   +R  F  +K   
Sbjct  107  SFRLGTLLLCGHRCLSWKWPFIHSFSEMSLEKREEVLKKWSKEKLVLTLRLMFLVVKIFC  166

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+ +D+   NP+WKA+GY   D + ++K  K                PL +GII+ 
Sbjct  167  FYTFFSRLDENSRNPAWKAVGY---DLNTNKKLIKTPKER-----------PLEQGIIET  212

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            LN  +      LTK G  V+          I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  213  LNESDSTFVQSLTKRGLQVSDDTTHNI-HKIKCDVVIVGSGCGGGVAAAVLAQSGQKVMV  271

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKGNY+   + S LEGPSM++++
Sbjct  272  VEKGNYFLPKDYSSLEGPSMNELY  295



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 137/234 (59%), Gaps = 25/234 (11%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA ++ +R +   +  + ++L  LS R+GTL+LC    L++ +PF+L F E+  ++RER
Sbjct  73   EVAEILTKRAQRQVVVMVSIVLKMLSFRLGTLVLCWGSCLASTWPFILNFSEMPVERRER  132

Query  192  IVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-----CGPDPSIS  353
            ++ +W+       +R  F  +K   L +F+T  D+  +N +W+AIGY       P+ S +
Sbjct  133  VLMNWSRQKFVVPLRVVFMMIKIYCLFIFYTRTDENSNNLAWEAIGYRVDKRQKPNESHN  192

Query  354  ekqkkqkhhdheddieeLLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFV  530
            ++++                 PL +G+++ ++  +  +   LT+ G  V +  P   +F 
Sbjct  193  KQER-----------------PLQRGLVETVHETDSSLIQSLTQKGLKVTQI-PQHNAFK  234

Query  531  IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            I+CD V++GSGCGGGV + VLA +G KV+VLEKGNY+   + S LEGPS+D+++
Sbjct  235  IKCDVVIIGSGCGGGVAAAVLAHSGQKVVVLEKGNYFVPQDYSSLEGPSLDQLY  288



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 114/206 (55%), Gaps = 19/206 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            S R+GTLLLCG       +PF+  F EIS +KRE+I+ +W+    L  +R  F  +K   
Sbjct  98   SFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKNWSRERYLLPLRVVFVMIKMFC  157

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L  FF   D+K +NP+W+AIGY       S K + ++              PL KGI++ 
Sbjct  158  LFYFFARTDEKSENPAWEAIGYHVDTREPSNKPRGER--------------PLQKGIVET  203

Query  444  ---NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
               N  +  +F  L   G  V         F I+CD VVVGSGCGGGV + VLA++G KV
Sbjct  204  VHENENDHSLFQCLVDHGLQVTVDHEHNL-FEIKCDVVVVGSGCGGGVAAAVLASSGQKV  262

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            LVLEKGNY+   + S LEGPSM +++
Sbjct  263  LVLEKGNYFVAEDYSSLEGPSMLELY  288



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 115/204 (56%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     +R  F  +K L 
Sbjct  94   STRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTPVRLAFVFVKFLC  153

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L +FFT V +  +NP+W  IGY   +   S +   ++              PL KGII+ 
Sbjct  154  LYIFFTQVGEDSNNPAWDDIGYQVDNEENSSETPDER--------------PLQKGIIET  199

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   E  +   L + G  V +       + ++CD V+VGSGCGGGV + VLA++G KV+V
Sbjct  200  IYETESSIVKSLVEKGLKVTED-TTNNMYKVQCDVVIVGSGCGGGVAASVLASSGQKVVV  258

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+A+++ S LEGPS  +M+
Sbjct  259  LEKGNYFAKSDYSSLEGPSQSQMY  282



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 119/207 (57%), Gaps = 24/207 (12%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF---IRNFFTAMKA  257
            STR+GTLLLCG      ++P++ +F  +  ++RERI+ +W  SS +F   +R  F  +K+
Sbjct  100  STRLGTLLLCGFLCFGKEWPYITKFSHLPIERRERILKNW--SSHRFFSPLRLVFYFLKS  157

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L L   F+ VDD   NP+W+AI Y  PD + S+   +++              PL  GII
Sbjct  158  LCLYFCFSLVDDHAHNPAWEAIDY-KPDTTNSKAINQER--------------PLENGII  202

Query  438  DL--NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
            +     P   +   LT  G SV +       + I+CD V+VGSGCGGGV + +LA AG K
Sbjct  203  ETFYETPTT-LLQSLTSKGLSVTEDHIDNL-YRIKCDVVIVGSGCGGGVAAAILAGAGQK  260

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+VLEKGNYY   + S LEGPSMD++ 
Sbjct  261  VVVLEKGNYYTAPDYSSLEGPSMDELL  287



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 118/204 (58%), Gaps = 14/204 (7%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLL+CG   +S ++PFL +F EI  + RE++V  W T+ L   +R  F  +K LV
Sbjct  100  STRVGTLLICGSSGVSKKWPFLKKFSEIPLENREKVVQKWFTNWLLTPVRLAFVFLKFLV  159

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            LLVFFT V +   NP+WKA+ Y      +    +       ++        PL KGII+ 
Sbjct  160  LLVFFTQVGEDSSNPAWKAMDY-----KVDVIGENSPEEMSKER-------PLDKGIIET  207

Query  444  NLP-EEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             L  +  +   L   G           ++ ++CDAV+VGSGCGGGV + VLA AG KV+V
Sbjct  208  RLETDSSLAAALAGKGLKPTLNPASRDTYTVKCDAVIVGSGCGGGVAAAVLAAAGLKVVV  267

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGPS+D+++
Sbjct  268  LEKGDYFTAGDYSSLEGPSLDRLY  291



>ref|XP_011080081.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Sesamum indicum]
Length=742

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 122/204 (60%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S+R+GTLLLCG   L  ++PF+  F E++ KKRE I+  W+  +L   +R  F  +K + 
Sbjct  96   SSRLGTLLLCGWICLDWKWPFVHSFCELTLKKREAILQKWSRETLFLPLRIAFLLLKIMC  155

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L VFF+  D+   NP+W+AIGY     +I  + K++K              PL KGII+ 
Sbjct  156  LFVFFSWTDENSSNPAWEAIGY--QVEAIERETKREKER------------PLEKGIIEI  201

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  E  +   L + G ++A+ +     + I+CD V++GSGCGGGV + VLA +G KVL+
Sbjct  202  MNEDELSLKKSLVQKGINIAEDENENV-YKIKCDVVIIGSGCGGGVAAAVLAKSGQKVLI  260

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGP+  +++
Sbjct  261  LEKGHYFVPEDYSGLEGPAFSELY  284



>ref|XP_006354464.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Solanum 
tuberosum]
Length=667

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 114/204 (56%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     +R  F  +K L 
Sbjct  20   STRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTPVRLAFVFVKFLC  79

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L +FFT V +   NP+W  IGY   +   S +   ++              PL KGII+ 
Sbjct  80   LYIFFTQVGEDSKNPAWDDIGYQVDNEENSSETPDER--------------PLQKGIIET  125

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   E  +   L + G  V +       + ++CD V+VGSGCGGGV + VLA++G KV+V
Sbjct  126  IYETESTIVKSLVEKGLKVTED-TKNNMYKVQCDVVIVGSGCGGGVAASVLASSGQKVVV  184

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+A+++ S LEGPS  +M+
Sbjct  185  LEKGNYFAKSDYSSLEGPSQSQMY  208



>ref|XP_001753124.1| predicted protein [Physcomitrella patens]
 gb|EDQ82165.1| predicted protein [Physcomitrella patens]
Length=699

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 117/211 (55%), Gaps = 25/211 (12%)
 Frame = +3

Query  105  LLLCGKG--SLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFF  278
            LL CG G  ++S ++PF  +F  ++ ++RE+++  W+TS L  +R  F +MK++     +
Sbjct  24   LLACGGGVNTVSLKYPFFRKFANLTPEEREKMLQGWSTSLLSPLRRLFKSMKSITGYTLY  83

Query  279  TSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEE  458
            + ++D+G+N +WKAIGY G DP++  + K++               PL  G +D      
Sbjct  84   SKINDEGENAAWKAIGYTGMDPTVRSRSKEEYWKPR----------PLGDGHVDAKEAGV  133

Query  459  HVFNRLTKLGCSV--------AKPKPPGPS-----FVIECDAvvvgsgcgggvisgvLAT  599
             +   L   G SV         + +  G S       +ECD V+VGSG GGGV++ VLA 
Sbjct  134  RLKAILGAKGFSVLDEIKSFRVQSRKWGYSESSSDIYMECDVVIVGSGSGGGVMAAVLAK  193

Query  600  AGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             G+KVLVLEKG Y+A  +++ LEGP M  M+
Sbjct  194  QGFKVLVLEKGQYFAAQDITSLEGPGMVNMY  224



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 114/204 (56%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     +R  F  +K L 
Sbjct  94   STRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTPVRLAFVFVKFLC  153

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L +FFT V +   NP+W  IGY   +   S +   ++              PL KGII+ 
Sbjct  154  LYIFFTQVGEDSKNPAWDDIGYQVDNEENSSETPDER--------------PLQKGIIET  199

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   E  +   L + G  V +       + ++CD V+VGSGCGGGV + VLA++G KV+V
Sbjct  200  IYETESTIVKSLVEKGLKVTED-TKNNMYKVQCDVVIVGSGCGGGVAASVLASSGQKVVV  258

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+A+++ S LEGPS  +M+
Sbjct  259  LEKGNYFAKSDYSSLEGPSQSQMY  282



>ref|XP_004982884.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=764

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 122/204 (60%), Gaps = 10/204 (5%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            ST++GT +LCG   +S++FP++ +F ++  ++RE ++  W+ +   F ++  F  +K L 
Sbjct  110  STKVGTFVLCGWLCVSSRFPYVFKFADMPLERREEVLKWWSKTRWLFPLKVTFVLVKILS  169

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
               F+T++++  DNPSWKAIGY  PD    ++   +               PL  G+++ 
Sbjct  170  HYSFYTTINEHSDNPSWKAIGYSVPDVDRPQEDLSEAAPSPSPR-------PLDSGVVET  222

Query  444  -NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             +L +  +   L   G +V K    GP   ++CD V+VGSGCGGGV + VLA AG+KV+V
Sbjct  223  RSLDDAALLRSLMDKGLAV-KADVSGPHHTVQCDVVIVGSGCGGGVAAAVLAAAGHKVVV  281

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKG+Y+   + S +EGPSM++++
Sbjct  282  VEKGDYFTAEDYSSIEGPSMERLY  305



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 116/204 (57%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STRIGTLLLCG      ++P++ +F +I  +KRE ++  W  +  L  +R  F  +K L 
Sbjct  95   STRIGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQKWFKNRFLTPVRLAFMFIKFLC  154

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L +FFT V +   N +W  IGY   +     +  +++              PL KGI++ 
Sbjct  155  LYIFFTQVGEDSKNQAWDDIGYQVDNEEKHSETAEER--------------PLEKGIVEA  200

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   E  +   L + G  V         + ++CD V+VGSGCGGGV + VLA++G+KV+V
Sbjct  201  IYETESTIVKSLVQKGLKVI-DDTKNNMYKVQCDVVIVGSGCGGGVAASVLASSGHKVIV  259

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNYY +++ S LEGPSM++M+
Sbjct  260  LEKGNYYTKSDYSSLEGPSMNQMY  283



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GT LLCGK     ++PF+ +F E+S  KRE++++ W+   L   IR  F  +K   
Sbjct  103  SLRLGTFLLCGKICFDWKWPFIHKFSEMSLDKREQVLNKWSRGKLVITIRLMFMVVKMCC  162

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+ +D+   NP+WKAIG+              +    E  I+     PL KGII+ 
Sbjct  163  FYTFFSRIDENSRNPAWKAIGF--------------ELDKKEKLIKTPKERPLDKGIIET  208

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   +  +   LTK G  VA          I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  209  VYESDSTLVQSLTKKGLEVAD-DAENNIHRIKCDVVIVGSGCGGGVAAAVLAQSGQKVVV  267

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPSM +++
Sbjct  268  LEKGNYFVPKDYSSLEGPSMSELY  291



>ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Length=732

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 77/209 (37%), Positives = 121/209 (58%), Gaps = 19/209 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQ-----FPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTA  248
            STR+GTL LCG+  L        FPF+ +F ++  K+RE+++  W+ +   F ++  F  
Sbjct  75   STRVGTLALCGRLCLCFSDNGKFFPFVCKFADMPVKRREQVLKRWSKARWLFPLKITFLI  134

Query  249  MKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYK  428
             K L    F+T V++  DNPSWKAIGY  P+P +    ++                PL  
Sbjct  135  AKLLSHYSFYTMVNENSDNPSWKAIGYSVPEPDVDRPPEEAPSAW-----------PLDA  183

Query  429  GIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAG  605
            GI++  +L +  +   LT+ G +V K    G    ++CD V+VGSGCGGGV + VLA AG
Sbjct  184  GIVETRSLNDATLLRSLTERGLAV-KADVSGAHHTVQCDVVIVGSGCGGGVAAAVLAAAG  242

Query  606  YKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            +KV+V+EKG+Y+   + + +EGPSM++++
Sbjct  243  HKVIVVEKGDYFTAESYTSVEGPSMERLY  271



>gb|EMS48507.1| Long-chain-alcohol oxidase FAO1 [Triticum urartu]
Length=579

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 116/203 (57%), Gaps = 12/203 (6%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALVL  266
            TR+GTL LCG+  +S +FP++ RF ++   +RE  +  W  +  L  ++  F  +K L  
Sbjct  108  TRLGTLALCGRLCVSGEFPYVRRFADMPVGRREEALRRWTRARWLIPVKIAFAMVKTLCF  167

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL-  443
             VF+T +++  +NP  KAIG+  P+     K+   +              PL  G+++  
Sbjct  168  NVFYTKLNENSENPCLKAIGFSLPNVEEQRKKHPAEAAAPR---------PLDNGVVETR  218

Query  444  NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
             L +  +   L   G +V KP   G    +ECD V+VGSGCGGGV + VLA++G+KVLV+
Sbjct  219  ELDDATLLRSLADKGVAV-KPATSGDYHAVECDVVIVGSGCGGGVAAAVLASSGHKVLVV  277

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKG+Y+   + S +EGPSM++++
Sbjct  278  EKGDYFTPDDYSSVEGPSMERLY  300



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 126/229 (55%), Gaps = 17/229 (7%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  191
            +VA +I +R +   ++++ L L  LS R+GT LLCGK     ++PF+ +F E S  KRE+
Sbjct  76   EVAEMIVKRAQPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEXSLDKREQ  135

Query  192  IVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkk  368
            +++ W+   L   IR  F  +K      FF+ +D+   NP+WKAIG+   D    EK  K
Sbjct  136  VLNKWSRGKLVITIRLMFMVVKMFCFYTFFSRIDENSRNPAWKAIGF---DLDKKEKLIK  192

Query  369  qkhhdheddieeLLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDA  545
                            PL KGII+ +   +  +   LTK G  VA          I CD 
Sbjct  193  TPKER-----------PLDKGIIETVYESDSTLVQSLTKKGLEVAD-DAANNIHRINCDV  240

Query  546  vvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+VGSGCGGGV + VLA +G KV+VLEKGNY+   + S LEGPSM +++
Sbjct  241  VIVGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELY  289



>ref|XP_006406028.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
 gb|ESQ47481.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
Length=746

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 118/214 (55%), Gaps = 38/214 (18%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-------IRNFFT  245
            +TR+GTLL+CG+  L T++PF+ +F E+S +KRER+         QF       IR  F 
Sbjct  96   ATRLGTLLICGRECLVTKWPFVEKFSELSLEKRERVFQK------QFKNWFFTPIRAAFV  149

Query  246  AMKALVLLVFFTSVDDKGDNPSWKAIGYCG----PDPSISekqkkqkhhdheddieeLLF  413
             +K   L  FF+ V   G+NPSW+AIGY        PS ++K++                
Sbjct  150  YIKVAFLFCFFSRVSPNGENPSWEAIGYRANLDQKKPSETQKER----------------  193

Query  414  GPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgv  590
             PL KGI++ +   E+ +   L + G    +      +  I+CDAVVVGSG GGGV + V
Sbjct  194  -PLEKGIVETMKETEQTLLESLAQKGL---EADADHDAITIKCDAVVVGSGSGGGVAASV  249

Query  591  LATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            LA +G KV+V+EKG+Y+  ++    EGP MDK++
Sbjct  250  LAKSGLKVVVMEKGSYFTESDYPPFEGPGMDKLY  283



>gb|KGN53994.1| hypothetical protein Csa_4G246400 [Cucumis sativus]
Length=386

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 103/156 (66%), Gaps = 11/156 (7%)
 Frame = +3

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSIS-----ekqkkqkhhdheddieeLLFGPL  422
            ++L++ +  VD++ +N SWKAI Y G DP        +++  +     E +  E L+GPL
Sbjct  1    MLLVLSYVWVDEELNNISWKAIDYPGSDPQFKPPSNLKEKDSKSKEVDEGEEAEELYGPL  60

Query  423  YKGIIDLNLPEE--HVFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvis  584
            +KGI++L   ++       L K G  V       KPP PS +I+CDAVVVGSG GGGVI+
Sbjct  61   FKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVIA  120

Query  585  gvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+
Sbjct  121  GVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMY  156



>gb|KJB10008.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=749

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 85/239 (36%), Positives = 137/239 (57%), Gaps = 31/239 (13%)
 Frame = +3

Query  12   QVAWVINQRMKHPKlns-lllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  188
            +VA ++ +R+  P++ S + ++L  +S R+G LLLCG      ++PF+ +F E+  ++RE
Sbjct  74   EVAEMMVKRVVEPRVLSFVKVVLTVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERRE  133

Query  189  RIVHSWATSSLQF--IRNFFTAMKALVLLVFF-------TSVDDKGDNPSWKAIGYCGPD  341
            +I+  W+++      +R  F  +K   L +FF       +  D+K +NPSWKAIGY    
Sbjct  134  KILMKWSSNGHHRLPLRAVFALIKTYCLFIFFSMLLKFVSQTDEKSENPSWKAIGY----  189

Query  342  PSISekqkkqkhhdheddieeLLFGPL-YKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPP  515
                          + D  ++ +  P   KGII+    ++  F   LT+ G  V +  P 
Sbjct  190  --------------NVDKRQKRVSSPHGRKGIIETMHEDDSTFVQSLTEKGLQVTE-DPD  234

Query  516  GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
               F I+CD V+VGSGCGGGV + VLA++G KV+V+EKGNY+A T+ + LEGPSM +++
Sbjct  235  HNVFNIKCDVVIVGSGCGGGVAAAVLASSGQKVVVIEKGNYFATTDYTSLEGPSMSELY  293



>ref|NP_171895.2| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
 sp|Q9ZWB9.2|FAO1_ARATH RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Arabidopsis thaliana]
 gb|AEE27643.1| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
Length=758

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 118/206 (57%), Gaps = 24/206 (12%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVL  266
            R+GTLLLCG   L  + +PFLL+F E+S +KRE+++  W T       R  F  +KA+ L
Sbjct  110  RLGTLLLCGLVCLDKKHWPFLLKFSEMSLEKREKVLQRWNTQWYNPLARIGFMMIKAIFL  169

Query  267  LVFFTSVDDKGDNPSWKAIGYC---GPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              +FT  ++  +NP W AI Y    G +  + +K++                 PL +GII
Sbjct  170  FYYFTWTNENSENPVWDAINYSVEIGENEDMEQKER-----------------PLDEGII  212

Query  438  DLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +    +E     R+   G  V + +    ++ IECDAVVVGSGCGGGV + +LA +G +V
Sbjct  213  ETAKEDEMTIKQRMINKGLKVTEDRER-DTYKIECDAVVVGSGCGGGVAAAILAKSGLRV  271

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+A  + S LEGPSM ++F
Sbjct  272  VVIEKGNYFAPRDYSALEGPSMFELF  297



>gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Erythranthe guttata]
Length=744

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 117/205 (57%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S+R+GTL+LCG       +PF+  F E+  KKRE ++ +W+  +L   +R  F  +K + 
Sbjct  103  SSRLGTLVLCGYICFDKNWPFVRTFSELPLKKRESVLQNWSRQTLLLPLRIAFLLLKIIT  162

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
            L +FF+  D+   NP+W+AIGY      + E  +KQ++             PL KG+I+ 
Sbjct  163  LFIFFSWTDENSSNPAWEAIGY-----HVEEILEKQENEP-----------PLKKGVIET  206

Query  444  --NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
              N  +  +   L + G SV +      +F I+CD  +VGSG GGGV + VLA +G KV+
Sbjct  207  MKNEDDASLKESLLQKGVSVIEDPNEKNTFKIKCDVAIVGSGSGGGVAAAVLAKSGQKVI  266

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            ++EKGNY+   + S LEGPS+ +++
Sbjct  267  IIEKGNYFTPQDYSGLEGPSLSELY  291



>ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
Length=774

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 72/207 (35%), Positives = 120/207 (58%), Gaps = 13/207 (6%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLST-QFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKAL  260
            ST++GTL LCG+  +S  +FP++ +F ++  ++RE+ +  W  +   F ++  F  +K L
Sbjct  115  STKVGTLALCGRLCISGGKFPYVRKFADMPVERREQALTQWNRTRWLFPLKITFVVVKIL  174

Query  261  VLLVFFTSVDDKGD-NPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
                F+T++++  D NPSWKAIGY  P      ++ + +              PL  GI+
Sbjct  175  SHYAFYTTINENSDDNPSWKAIGYSVPHGEEETREDETEAAPSPR--------PLDNGIV  226

Query  438  DLN-LPEEHVFNRLTKLGCSVAKPKPPGPSF-VIECDAvvvgsgcgggvisgvLATAGYK  611
            +   L +  +   L   G  V    PP  ++  + CD V+VGSGCGGGV + VLA+AG+K
Sbjct  227  ETKALDDTALLTSLMARGLEVKPAAPPANAYHTVRCDVVIVGSGCGGGVAAAVLASAGHK  286

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+V+EKG+Y+   + S +EGPSM++++
Sbjct  287  VVVIEKGDYFTAEDYSSVEGPSMERLY  313



>ref|XP_011080082.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Sesamum indicum]
Length=742

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 120/204 (59%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S+R+GTLLLCG      ++PF+  F E++ KKRE I+  W+  +L   +R  F  +K + 
Sbjct  96   SSRLGTLLLCGWICSDWKWPFVHSFCELTLKKREAILQKWSRETLFLPLRIAFLLLKIMC  155

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L VFF+  D+   NP+W+AIGY      +   +++ K+             PL KGII+ 
Sbjct  156  LFVFFSWTDENSSNPAWEAIGY-----QVEATERETKYEKER---------PLEKGIIEI  201

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  E  +   L + G + A+ +     + I+CDAV++GSGCGGGV + VLA +G KVL+
Sbjct  202  MNEDESSLKESLMQKGINFAEDEDENV-YKIKCDAVIIGSGCGGGVTAAVLAKSGQKVLI  260

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+   + S LEGP+  +++
Sbjct  261  LEKGHYFVPEDYSGLEGPAFSELY  284



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 116/211 (55%), Gaps = 31/211 (15%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAM-----  251
            STR+GT LLCG      ++  +  F  IS  KRE+++  W      F R FFTA+     
Sbjct  101  STRLGTFLLCGSLCFGEKWLCIKNFSSISLDKREKVLQKW------FKRRFFTAIRIAFI  154

Query  252  --KALVLLVFFTSVDDKGDNPSWKAIGYC-GPDPSISekqkkqkhhdheddieeLLFGPL  422
              K L + VFF+ V   GDNP+W+AI YC G D +  +  K++               PL
Sbjct  155  YVKVLCVFVFFSRVGQNGDNPAWEAIEYCAGTDENPDQVPKER---------------PL  199

Query  423  YKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLAT  599
             KG+ID N   +    R LT+ G  V +  P      I+CD V+VGSGCGGGV + VLA 
Sbjct  200  QKGLIDTNQETDSTLLRSLTEKGLEVTR-DPRRNLCKIKCDVVIVGSGCGGGVAAAVLAA  258

Query  600  AGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            +G KV VLEKGNY+  T+ S LEGPS+ +++
Sbjct  259  SGQKVFVLEKGNYFTATDYSGLEGPSLAQLY  289



>ref|XP_009119340.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Brassica rapa]
Length=761

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 112/206 (54%), Gaps = 23/206 (11%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQ-FPFLL-RFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALV  263
            R+GTLLLCG   L  + + FLL +F +IS +KRE+++  W         R  F  +KA+ 
Sbjct  115  RLGTLLLCGFVCLDKKNWSFLLLKFSDISLEKREKVLQKWNKQWYNPLARIAFMMIKAIF  174

Query  264  LLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
            L  +FT  ++  +NP+W AIGY    G +  I  KQ+                 PL KGI
Sbjct  175  LFYYFTWTNENTENPAWDAIGYKVDIGENEDIERKQR-----------------PLEKGI  217

Query  435  IDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            I+    +E    +L        K      +F IECDAVV+GSGCGGGV +  LA +G KV
Sbjct  218  IETAKEDEATIKQLMINKGLKLKEDKESNTFKIECDAVVIGSGCGGGVAAANLAKSGLKV  277

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+   + S LEGPSM +MF
Sbjct  278  IVVEKGNYFVPQDYSTLEGPSMFEMF  303



>emb|CDX89850.1| BnaA10g02320D [Brassica napus]
Length=752

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 112/206 (54%), Gaps = 23/206 (11%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQ-FPFLL-RFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALV  263
            R+GTLLLCG   L  + + FLL +F +IS +KRE+++  W         R  F  +KA+ 
Sbjct  108  RLGTLLLCGFVCLDKKNWSFLLLKFSDISLEKREKVLQKWNKQWYNPLARIAFMMIKAIF  167

Query  264  LLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
            L  +FT  ++  +NP+W AIGY    G +  I  KQ+                 PL KGI
Sbjct  168  LFYYFTWTNENTENPAWDAIGYKVDIGENEDIKRKQR-----------------PLEKGI  210

Query  435  IDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            I+    +E    +L        K      +F IECDAVV+GSGCGGGV +  LA +G KV
Sbjct  211  IETAKEDEATIKQLMINKGLKLKEDKESNTFKIECDAVVIGSGCGGGVAAANLAKSGLKV  270

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+   + S LEGPSM +MF
Sbjct  271  IVVEKGNYFVPQDYSTLEGPSMFEMF  296



>ref|XP_002889487.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65746.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
Length=760

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 118/206 (57%), Gaps = 24/206 (12%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVL  266
            R+GTLLLCG   L  + +PFLL+F E+S +KRE+++  W T       R  F  +KA+ L
Sbjct  111  RLGTLLLCGLVCLDMKNWPFLLKFSEMSLEKREKVLQRWNTQWYNPLARIGFMMIKAIFL  170

Query  267  LVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              +FT  ++  +NP+W AI Y    G +  + +K++                 PL +GII
Sbjct  171  FYYFTWTNENTENPAWDAINYRVEIGENEGMEQKER-----------------PLDQGII  213

Query  438  DLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +    +E     R+   G  V + +    ++ IECDAVVVGSGCGGGV + +LA +G +V
Sbjct  214  ETAKEDEMTIKQRMINKGLKVTEDR-DSDTYKIECDAVVVGSGCGGGVAAAILAKSGLRV  272

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+   + S LEGPSM ++F
Sbjct  273  VVIEKGNYFVPRDYSALEGPSMFELF  298



>ref|XP_009369442.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=749

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 108/204 (53%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GT LLCGK     ++PF+ +F E+S  KRE +   W+   L   IR  F  +K   
Sbjct  103  SLRLGTFLLCGKSCFDWKWPFIHKFSEMSLDKRELVRKKWSRQKLVITIRLMFMVIKMFC  162

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
               FF+ VD+   NP+WKAIGY              +    E  I+     PL KGII+ 
Sbjct  163  FYTFFSRVDENSRNPAWKAIGY--------------ELDRKEKLIKTPKQRPLEKGIIET  208

Query  444  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
                +      LTK G  +           I+CD V+VGSGCGGGV + +LA +G KV+V
Sbjct  209  AYESDSTLVESLTKKGLDLTD-DAVNNIHKIKCDVVIVGSGCGGGVAAAILAQSGQKVVV  267

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPSM++++
Sbjct  268  LEKGNYFVPKDYSSLEGPSMNELY  291



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 116/204 (57%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STR+GTLLLCG      ++P++ +F +I    RE+++  W     L  IR  F  +K L 
Sbjct  102  STRLGTLLLCGALCFGKKWPYINKFSDIPVDNREKVIQKWLKHKFLTPIRLPFVLIKFLC  161

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L  FFT V +   NP+W+A+ Y   +   S     +K              PL KG+++ 
Sbjct  162  LYAFFTQVWEDFKNPAWEAMDYQVDNRKDSSTTPHEK--------------PLMKGMVET  207

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
             +  E  + + L + G  VA+  P    + I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  208  THETESTIVSSLVQKGLRVAE-DPKEKLYKIKCDVVIVGSGCGGGVAAAVLAKSGQKVVV  266

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKGNY+ +T+ S LEGPSM++++
Sbjct  267  IEKGNYFTKTDYSSLEGPSMNELY  290



>ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cucumis sativus]
Length=617

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 103/156 (66%), Gaps = 11/156 (7%)
 Frame = +3

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSIS-----ekqkkqkhhdheddieeLLFGPL  422
            ++L++ +  VD++ +N SWKAI Y G DP        +++  +     E +  E L+GPL
Sbjct  1    MLLVLSYVWVDEELNNISWKAIDYPGSDPQFKPPSNLKEKDSKSKEVDEGEEAEELYGPL  60

Query  423  YKGIIDLNLPEE--HVFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvis  584
            +KGI++L   ++       L K G  V       KPP PS +I+CDAVVVGSG GGGVI+
Sbjct  61   FKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVIA  120

Query  585  gvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+
Sbjct  121  GVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMY  156



>gb|AAK64154.1| unknown protein [Arabidopsis thaliana]
Length=748

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 112/206 (54%), Gaps = 15/206 (7%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG   L   +PF+LRF ++   KRE I+ +W+  S   L F   FF A K 
Sbjct  95   SFRFGTLLLCGSLCLDKSWPFVLRFSQLPLDKREAILRNWSRQSGFLLPFRITFFLA-KF  153

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              L  FF+  D+   NP+ +AIGYC      S  +K +               PL KGII
Sbjct  154  YTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR---------PLEKGII  204

Query  438  D-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            + ++  +  +   LT+ G  VA+       + I CDAVVVGSG GGGV +  LA AG KV
Sbjct  205  ETMHESDVTITQSLTEKGVHVARDDGDNV-YRIRCDAVVVGSGSGGGVAAANLAKAGLKV  263

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            LVLEKGNY+   + S LE PSM +++
Sbjct  264  LVLEKGNYFTAHDYSGLEVPSMLELY  289



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=743

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 112/204 (55%), Gaps = 16/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            S R+G LL+CG   L   +PF+  F E+S +KRE  +  W+    L  +R  F  +K   
Sbjct  94   SYRLGNLLVCGYPCLDKNWPFIHNFAEMSLEKREEALQRWSREKRLIPLRLLFVVVKIFC  153

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+ +     NPSWKAIGY     ++++++K  K              PL KGII+ 
Sbjct  154  FFCFFSRIVGDSQNPSWKAIGY-----NVNKREKLIKTPKER---------PLEKGIIET  199

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   +  +   LTK G  V           I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  200  MKKTDSTLIESLTKKGIEVTDGAAHPQIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVVV  259

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + SLLEGPSM++++
Sbjct  260  LEKGNYFVPKDYSLLEGPSMNELY  283



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 116/204 (57%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            S R+GTLLLC    LS ++PF+  F E+S +KRE ++  W+   L   +R  F  +K   
Sbjct  107  SFRLGTLLLCRHRCLSWKWPFIHSFSEMSLEKREEVLKKWSREKLVLTLRLMFLVVKIFC  166

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
               FF+ +D+   NP+WKA+GY   D + ++K  K                PL +GII+ 
Sbjct  167  FYTFFSWLDENSRNPAWKAVGY---DLNTNKKLIKTPKER-----------PLEQGIIET  212

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +N  +  +   LTK G  V+          I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  213  MNESDSTLVQSLTKRGLRVSDDTTHNL-HKIQCDVVIVGSGCGGGVAAAVLAESGQKVIV  271

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            +EKGNY+   + S LEGPSM++++
Sbjct  272  VEKGNYFLPKDYSSLEGPSMNELY  295



>emb|CDY18199.1| BnaC05g02220D [Brassica napus]
Length=752

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 109/206 (53%), Gaps = 23/206 (11%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQ--FPFLLRFPEISQKKRERIVHSWATSSLQ-FIRNFFTAMKALV  263
            R+GTLLLCG   L  +     LL+F +IS +KRE+++  W         R  F  +KA+ 
Sbjct  108  RLGTLLLCGFVCLDKKNWSSLLLKFSDISLEKREKVLQKWNKQWYNPLARIAFMMIKAIF  167

Query  264  LLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
            L  +FT  ++  +NP+W AIGY    G +     KQ+                 PL KGI
Sbjct  168  LFYYFTWTNENTENPAWDAIGYKVDIGENEDTEHKQR-----------------PLEKGI  210

Query  435  IDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            I+    +E    +L        K      +F IECDAVV+GSGCGGGV +  LA +G KV
Sbjct  211  IETAKEDEATIKQLMISKGLKLKEDKESNTFKIECDAVVIGSGCGGGVAAANLAKSGLKV  270

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+   + S LEGPSM +MF
Sbjct  271  IVVEKGNYFVPQDYSTLEGPSMFEMF  296



>gb|KFK39637.1| hypothetical protein AALP_AA3G269600 [Arabis alpina]
Length=744

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 119/211 (56%), Gaps = 32/211 (15%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L +++PF+ +F E+S ++RER++     +W    L   R  F  +K
Sbjct  95   ATRLGTLLICGTECLVSRWPFVEKFSELSLERRERVIQKQFKNWL---LTPFRAAFVYLK  151

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYC----GPDPSISekqkkqkhhdheddieeLLFGPL  422
            +  L  FF+ V   G+NP+W+AIGYC       PS + K++                 PL
Sbjct  152  SAFLFCFFSRVSSNGENPAWEAIGYCVNLEENKPSETHKER-----------------PL  194

Query  423  YKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLAT  599
             KG+++ +    + +   L + G  V        +  I+CDAV+VGSG GGGV + VLA 
Sbjct  195  EKGMVETMKETNQTLLESLAQKGLEVDHDT---DAIRIKCDAVIVGSGSGGGVAASVLAK  251

Query  600  AGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            +G KV+V+EKG+Y+   + +  EGPS++KM+
Sbjct  252  SGLKVVVMEKGSYFTPLDYTPFEGPSVEKMY  282



>ref|XP_002981110.1| hypothetical protein SELMODRAFT_114089, partial [Selaginella 
moellendorffii]
 gb|EFJ17811.1| hypothetical protein SELMODRAFT_114089, partial [Selaginella 
moellendorffii]
Length=656

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 113/199 (57%), Gaps = 5/199 (3%)
 Frame = +3

Query  105  LLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTS  284
            LLLCG  S    +P+  +F E+  ++RE++++ WA S     R  F   K  +L   ++ 
Sbjct  1    LLLCGAESTDKAYPYDKKFSEVPLEEREKLMYQWANSDDDDSRLNFKIFKTFILNTVYSK  60

Query  285  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHV  464
            VD KG NP+W+AIGY GPDP+  +     K    +  + ++   P  +G+  L      +
Sbjct  61   VDAKGYNPTWEAIGYAGPDPNSMKATLPPKPSALKSAVFDVREHPDLRGV--LKHTGYTL  118

Query  465  FNRLTKLGCSV--AKPKPPGPSFV-IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGN  635
             + ++ L  ++  +     G   + I+CD ++VG+G GG V + VL+TAG KVL+LEKG 
Sbjct  119  LDDISHLKPALLPSNKLEDGEDVIGIKCDVIIVGAGSGGSVPAQVLSTAGLKVLLLEKGR  178

Query  636  YYARTNLSLLEGPSMDKMF  692
            Y+AR +LSLLE P+  +++
Sbjct  179  YFAREDLSLLEQPTFSELY  197



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 115/205 (56%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-SWATSSLQFIRNFFTAMKALV  263
            +TRIGTLL+CG   L +++PF+ +F E+S +KRER++   +    L  +R  F  +K  +
Sbjct  94   ATRIGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNWFLTPVRAGFVYIKVAI  153

Query  264  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
            L  FF+ V   G+N +W+AIGY    D +  E  K +               PL KGI++
Sbjct  154  LFCFFSRVSPNGENSAWEAIGYKVNLDENKPETHKAR---------------PLEKGIVE  198

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +N  EE +   L +  C          +  I+CDAVVVGSG GGGV + VLA +G KV+
Sbjct  199  TMNETEETLLESLAR-KCLQTDHDVDNDAIRIKCDAVVVGSGSGGGVAASVLAKSGLKVV  257

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKG+YY  +     EGP MDK++
Sbjct  258  VLEKGSYYTPSEYLPFEGPGMDKLY  282



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 119/207 (57%), Gaps = 24/207 (12%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L +++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  95   ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNWI---LTPIRAAFVYIK  151

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
               L  FF+ V   G+NP+W+AIGY     +++  + K      E         PL KG+
Sbjct  152  VAFLFCFFSWVSPNGENPAWEAIGY-----NVNTNENKPSETHRER--------PLEKGM  198

Query  435  ID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
            ++ +   E+ +   L ++G    + +    +  I+CDAVVVGSG GGGV + VLA AG K
Sbjct  199  VETMQETEQTLLESLAQMGL---EAETDHDTIRIKCDAVVVGSGSGGGVAASVLAKAGLK  255

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+V+EKG+YY  +     EGP MDK++
Sbjct  256  VVVMEKGSYYTPSTYPSTEGPGMDKLY  282



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 81/224 (36%), Positives = 116/224 (52%), Gaps = 45/224 (20%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQ-------FPFLLRFPEISQKKRERIVHSW-ATSSLQFIRNFF  242
            STR+GTLLLCG+ SLS         FP + RF ++   +RE  +  W +T  L  +R  F
Sbjct  120  STRVGTLLLCGRLSLSFSGGARDFSFPCVSRFADMPVARREAALQRWNSTRWLLPLRIVF  179

Query  243  TAMKALVLLVFFTSVDDKGDNPSWKAIGY-------------CGPDPSISekqkkqkhhd  383
            T +K L   VF+  V++K +NP WKAIGY                 PS S          
Sbjct  180  TLVKILSHYVFYAMVNEKSENPHWKAIGYRVDKRRTEQADDAAAKSPSPSR---------  230

Query  384  heddieeLLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgs  560
                       PL  G+++   L +  +   L   G +V+          ++CDAV+VGS
Sbjct  231  -----------PLDSGVVETRALNDTTLLRSLADRGLAVSS---DARHHTVQCDAVIVGS  276

Query  561  gcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            GCGGGV + +LA+AG KV+VLEKG+Y+   + S +EGPSM+++F
Sbjct  277  GCGGGVAAAMLASAGLKVVVLEKGDYFTAEDYSSVEGPSMERLF  320



>ref|XP_009369441.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=746

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 111/204 (54%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA-TSSLQFIRNFFTAMKALV  263
            S R+GT LLCGK     ++ F+ +F E+S  KRE+++  W+   S+  IR  F  +K   
Sbjct  100  SLRLGTFLLCGKCCFDWKWTFIDKFSEMSLDKREQVLKKWSRQKSVITIRLMFMVIKMFC  159

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              +FF+ VD+   NP+WKAIGY              +    E  I+     PL KGII+ 
Sbjct  160  FYIFFSRVDENSRNPAWKAIGY--------------ELDRKEKLIKTPKQRPLEKGIIET  205

Query  444  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
                +      LTK G  +           I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  206  AYESDSTLVESLTKKGLDLTD-DAVNNIHKIKCDVVIVGSGCGGGVAAAVLARSGQKVVV  264

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPSM++++
Sbjct  265  LEKGNYFVPKDYSSLEGPSMNELY  288



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 119/204 (58%), Gaps = 18/204 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLLLCG   L  ++PF+L+F EIS +KRE+++ +W+     F +R FF  MK   
Sbjct  103  STRLGTLLLCGFLCLGWKWPFILKFSEISLEKREQVLKNWSRQRFLFPLRLFFAIMKIFC  162

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              +FF+  DD  +NP+W AIGY        +K  K++              P+ KGI++ 
Sbjct  163  FFIFFSRTDDNLENPAWDAIGYHVETKEYVKKPPKER--------------PIRKGIVET  208

Query  444  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
                +      L++ G  V + +       I+CD V++GSGCGGGV + VLA++GYKVL+
Sbjct  209  MYENDSTLVQSLSQRGIKVIEDQK--NICKIKCDVVIIGSGCGGGVTAAVLASSGYKVLI  266

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY+   + S LEGPSM + +
Sbjct  267  LEKGNYFEPEDYSSLEGPSMSEQY  290



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 115/204 (56%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            STR GTLLLCG      ++P++ +F +I  +KRE ++  W  +  L  +R  F  +K L 
Sbjct  95   STRFGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQKWFKNRFLTPVRLAFLFIKFLS  154

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L +FFT V +   N +W  IGY   +     +  +++              PL KGI++ 
Sbjct  155  LYIFFTQVGEDSKNQAWDDIGYQVDNEEKHSETAEER--------------PLEKGIVET  200

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            +   E  V   L + G  V +       + ++CD V+VGSGCGGGV + VLA++G KV+V
Sbjct  201  IYETESTVVKSLVQKGLKVIED-TKNNMYKVQCDVVIVGSGCGGGVAASVLASSGNKVIV  259

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNYY +++ S LEGPSM++M+
Sbjct  260  LEKGNYYTKSDYSSLEGPSMNQMY  283



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 111/206 (54%), Gaps = 15/206 (7%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG   L   +PF+L+F E+   +RE I+  W+  S   L F   FF + K 
Sbjct  100  SFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREEILRKWSRKSGFLLPFRITFFLS-KF  158

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              L  FF+  D+   NP+ +AIGY       S  +K +               PL +GI+
Sbjct  159  YTLFYFFSQTDENQKNPALEAIGYSLDTADASSNKKTEADEKRR---------PLQRGIV  209

Query  438  D-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            + ++  +  +   LT+ G  VAK         I CDAVVVGSG GGGV +  LA AG KV
Sbjct  210  ETMHESDITITQTLTEKGVYVAKDDGENV-HRIRCDAVVVGSGSGGGVAAANLAKAGLKV  268

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            LVLEKGNY+A  + S LEGPSM +++
Sbjct  269  LVLEKGNYFAAQDYSGLEGPSMLELY  294



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 107/205 (52%), Gaps = 13/205 (6%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS--LQFIRNFFTAMKAL  260
            S R GTLLLCG   L   +PF+ +F E+   KRE ++  W+  S  L  +R  F   K  
Sbjct  100  SFRFGTLLLCGSLCLDKDWPFVHKFSELPLDKREEVLRKWSRQSGFLLPLRITFFLTKFY  159

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
             L  FF+  D+   NP+ +AIGY       S  + +++              PL  GII+
Sbjct  160  TLFYFFSQTDENLKNPALEAIGYSIATTETSSNKTRKEEGTRR---------PLEAGIIE  210

Query  441  LNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
                 +  +   L + G  VA+    G    I CDAV+VGSG GGGV +  LA AG KVL
Sbjct  211  TKHETDITITQSLIEKGVHVARDDDNGV-HRIRCDAVIVGSGSGGGVAAANLAKAGLKVL  269

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+A  + S LEGPSM +++
Sbjct  270  VLEKGNYFAAQDYSALEGPSMQELY  294



>emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
Length=678

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 116/208 (56%), Gaps = 24/208 (12%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L +++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  27   ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFKNWI---LTPIRAAFVYIK  83

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
               L  FF+ V+  G+NP+W+AIGY   PD +   +   ++              PL KG
Sbjct  84   VAFLFCFFSRVNPNGENPAWEAIGYRVNPDENKPSETHNER--------------PLEKG  129

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            I++ +   E+ +   L   G   A       +  I+CD VVVGSG GGGV + VLA +G 
Sbjct  130  IVETMEETEQTLLESLAHKGLE-AVLDTEHDAIRIKCDVVVVGSGSGGGVAASVLAKSGL  188

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+VLEKG+Y+  +     EGP +DK++
Sbjct  189  KVVVLEKGSYFTPSEHRPFEGPGLDKLY  216



>ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
 sp|Q94BP3.2|FAO4B_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4B; AltName: Full=Long-chain 
fatty alcohol oxidase 4B [Arabidopsis thaliana]
 emb|CAB81445.1| putative protein [Arabidopsis thaliana]
 emb|CAC87644.1| alcohol oxidase [Arabidopsis thaliana]
 gb|AAN71941.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85508.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
Length=748

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 116/208 (56%), Gaps = 19/208 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG   L   +PF+L+F ++   KRE I+ +W+  S   L F   FF A K 
Sbjct  95   SFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWSRQSGFLLPFRITFFLA-KF  153

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
              L  FF+  D+   NP+ +AIGYC  G + S ++K +  +              PL KG
Sbjct  154  YTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR-----------PLEKG  202

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            II+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG GGGV +  LA AG 
Sbjct  203  IIETMHESDVTITQSLTEKGVHVARDDGDNV-YRIRCDAVVVGSGSGGGVAAANLAKAGL  261

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KVLVLEKGNY+   + S LE PSM +++
Sbjct  262  KVLVLEKGNYFTAHDYSGLEVPSMLELY  289



>ref|XP_008664883.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Zea mays]
 tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
Length=762

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 78/208 (38%), Positives = 122/208 (59%), Gaps = 7/208 (3%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLS---TQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMK  254
            STRIGTL LCG+   S   + FP+  RF ++  ++RER++  W+ +   F ++  F   K
Sbjct  100  STRIGTLALCGRLCFSAGKSSFPYACRFADMPVERRERVLQRWSGARWLFPLKITFVIAK  159

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFG-PLYKG  431
             L    F+T V++  DNPSWKAIGY  P P+ +    + +  +      E     PL  G
Sbjct  160  LLSHYAFYTMVNENSDNPSWKAIGYSVPVPAAAADVDRLRPRELGPAEAEAPSPRPLDSG  219

Query  432  IIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            +++  +L +  +   LT+ G +V K    G    ++CD V+VGSGCGGGV + VLA AG 
Sbjct  220  VVETRSLNDATLLKSLTERGVAV-KAGVSGAHHTVQCDVVIVGSGCGGGVAAAVLAAAGR  278

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+V+EKG+Y+   + + +EGPSM++++
Sbjct  279  KVVVVEKGDYFTAESYTSVEGPSMERLY  306



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 117/205 (57%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  260
            +T++GTL+LC   SL  +FPF+ +F ++  +KRE ++  W      F+  R  F  +K  
Sbjct  109  ATKLGTLVLCRSLSLCGRFPFINKFSDMPIEKREEVLKRW-NKEKNFVPLRMVFVMVKIF  167

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
             L +F++  ++  +N SW AIGY  P      K + ++              PL KGII+
Sbjct  168  CLYIFYSMTNENSENQSWNAIGYSLPTEEKPPKSQSER--------------PLEKGIIE  213

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             ++  +  +   LT  G +V++  P    + I+CD  +VGSGCGGGV + VLA+AG KV+
Sbjct  214  TMDQTDSSLLQSLTMKGLAVSQ-DPNQNLYEIKCDVAIVGSGCGGGVAAAVLASAGRKVV  272

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            V+EKGNY+   + + +E PSM++M+
Sbjct  273  VIEKGNYFTSEDYTSIEAPSMNEMY  297



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 116/208 (56%), Gaps = 24/208 (12%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L +++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  95   ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFKNWI---LTPIRAAFVYIK  151

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
               L  FF+ V+  G+NP+W+AIGY   PD +   +   ++              PL KG
Sbjct  152  VAFLFCFFSRVNPNGENPAWEAIGYRVNPDENKPSETHNER--------------PLEKG  197

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            I++ +   E+ +   L   G   A       +  I+CD VVVGSG GGGV + VLA +G 
Sbjct  198  IVETMEETEQTLLESLAHKGLE-AVLDTEHDAIRIKCDVVVVGSGSGGGVAASVLAKSGL  256

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+VLEKG+Y+  +     EGP +DK++
Sbjct  257  KVVVLEKGSYFTPSEHRPFEGPGLDKLY  284



>gb|AAM63097.1| unknown [Arabidopsis thaliana]
Length=748

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 116/208 (56%), Gaps = 19/208 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG   L   +PF+L+F ++   KRE I+ +W+  S   L F   FF A K 
Sbjct  95   SFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWSRQSGFLLPFRITFFLA-KF  153

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
              L  FF+  D+   NP+ +AIGYC  G + S ++K +  +              PL KG
Sbjct  154  YTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR-----------PLEKG  202

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            II+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG GGGV +  LA AG 
Sbjct  203  IIETMHESDLTITQSLTEKGVHVARDDGDNV-YRIRCDAVVVGSGSGGGVAAANLAKAGL  261

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KVLVLEKGNY+   + S LE PSM +++
Sbjct  262  KVLVLEKGNYFTAHDYSGLEVPSMLELY  289



>ref|XP_002994642.1| hypothetical protein SELMODRAFT_138935, partial [Selaginella 
moellendorffii]
 gb|EFJ04292.1| hypothetical protein SELMODRAFT_138935, partial [Selaginella 
moellendorffii]
Length=656

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 112/199 (56%), Gaps = 5/199 (3%)
 Frame = +3

Query  105  LLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTS  284
            LLLCG  S    +P+  +F E+  ++RE++++ WA S     R  F   K  +L  F++ 
Sbjct  1    LLLCGAESTDKAYPYDKKFSEVPLEEREKLMYQWANSDDDDSRLNFKIFKTFILNTFYSK  60

Query  285  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHV  464
            VD  G NP+W+AIGY GPDP+  +     K    +  + ++   P  + +  L      +
Sbjct  61   VDASGYNPTWEAIGYAGPDPNSMKATLPPKPSALKSAVFDVREHPDLRAV--LKHTGYTL  118

Query  465  FNRLTKLGCSV--AKPKPPGPSFV-IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGN  635
             + ++ L  ++  +     G   + I+CD ++VG+G GG V + VL+TAG KVL+LEKG 
Sbjct  119  LDDISHLKPALLPSNKLEDGEDVIGIKCDVIIVGAGSGGSVPAQVLSTAGLKVLLLEKGR  178

Query  636  YYARTNLSLLEGPSMDKMF  692
            Y+AR +LSLLE P+  +++
Sbjct  179  YFAREDLSLLEQPTFSELY  197



>ref|XP_002982582.1| hypothetical protein SELMODRAFT_116855, partial [Selaginella 
moellendorffii]
 gb|EFJ16335.1| hypothetical protein SELMODRAFT_116855, partial [Selaginella 
moellendorffii]
Length=656

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 112/199 (56%), Gaps = 5/199 (3%)
 Frame = +3

Query  105  LLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTS  284
            LLLCG  S    +P+  +F E+  ++RE++++ WA S     R  F   K  +L  F++ 
Sbjct  1    LLLCGAESTDKAYPYDKKFSEVPLEEREKLMYQWANSDDDDSRLNFKIFKTFILNTFYSK  60

Query  285  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHV  464
            VD  G NP+W+AIGY GPDP+  +     K    +  + ++   P  + +  L      +
Sbjct  61   VDASGYNPTWEAIGYAGPDPNSMKATLPPKPSALKSAVFDVREHPDLRAV--LKHTGYTL  118

Query  465  FNRLTKLGCSV--AKPKPPGPSFV-IECDAvvvgsgcgggvisgvLATAGYKVLVLEKGN  635
             + ++ L  ++  +     G   + I+CD ++VG+G GG V + VL+TAG KVL+LEKG 
Sbjct  119  LDDISHLKPALLPSNKLEDGEDVIGIKCDVIIVGAGSGGSVPAQVLSTAGLKVLLLEKGR  178

Query  636  YYARTNLSLLEGPSMDKMF  692
            Y+AR +LSLLE P+  +++
Sbjct  179  YFAREDLSLLEQPTFSELY  197



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 117/205 (57%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  260
            S R+GTLLLCG      ++PFL +F E+S +KRE ++  W+    +F+  R  F  +K  
Sbjct  96   SFRLGTLLLCGFICFDWKWPFLHKFSEMSLEKREAVLKKWSKQR-RFVPLRLAFVLIKLF  154

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
                FF+ VD+   NP+W+AIGY      +  +++  K              PL  G+I+
Sbjct  155  CFFTFFSRVDENSHNPAWEAIGY-----HVDTRKRMTKTEKER---------PLDNGVIE  200

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             +   +  +   L + G  V +  P   ++ I+CDAVVVGSGCGGGV + VLA +G KV+
Sbjct  201  TMKETDSSLVQSLIQKGLEVTE-DPNDNNYKIKCDAVVVGSGCGGGVAAAVLAKSGQKVI  259

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLE+GNY+   + S LEGPSM++++
Sbjct  260  VLEQGNYFVAQDYSSLEGPSMEELY  284



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 115/211 (55%), Gaps = 31/211 (15%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAM-----  251
            STR+GT LLCG      ++  +  F  IS  KRE+++  W      F R FFT +     
Sbjct  101  STRLGTFLLCGSLCFGEKWLCIQNFSSISLDKREKVLQKW------FKRRFFTPIRIAFI  154

Query  252  --KALVLLVFFTSVDDKGDNPSWKAIGYC-GPDPSISekqkkqkhhdheddieeLLFGPL  422
              K L + VFF+ V   GDNP+W+AI YC G D + ++  K++               PL
Sbjct  155  YVKVLCVFVFFSRVGQNGDNPAWEAIEYCAGTDENPNQVSKER---------------PL  199

Query  423  YKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLAT  599
             KG+ID N   +    R LT+ G  V +  P      I+CD V+VGSGCGGGV + VLA 
Sbjct  200  QKGLIDTNQETDSTLLRSLTEKGLEVTR-DPRRNLCKIKCDVVIVGSGCGGGVAAAVLAA  258

Query  600  AGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            +G KV VLEKGNY+   + S LEGPS+ +++
Sbjct  259  SGQKVFVLEKGNYFTAADYSGLEGPSIAQLY  289



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 116/215 (54%), Gaps = 41/215 (19%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTA------  248
            ST++GTLLLCG      ++P++  F  +   KRE+++ +W      F   FFT       
Sbjct  106  STKVGTLLLCGSHCWGKEWPYINGFTSMPLAKREQVLQAW------FKHRFFTPFRVAFL  159

Query  249  -MKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLY  425
              K  +L + F+ VD+ G+NP+W+AIGY     +I + +                  PL 
Sbjct  160  YFKVAILFIIFSRVDENGENPAWEAIGY-----NIDKVENVPNER------------PLQ  202

Query  426  KGIIDLNLPEEHVFNR------LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  587
            +GI++      HV +       LT+ G  V +  P   +  I+CDAV+VGSGCGGGV + 
Sbjct  203  QGIVETM----HVIDSIDLHKLLTEKGLQVTQ-DPHKNAIKIKCDAVIVGSGCGGGVAAA  257

Query  588  vLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             LA++G KV+VLEKG+Y+   + S  EGPSM+K++
Sbjct  258  TLASSGLKVVVLEKGSYFGPADYSPFEGPSMEKLY  292



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 118/207 (57%), Gaps = 24/207 (12%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L +++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  75   ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNWL---LTPIRAAFVYIK  131

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
               L  FF+ V   G+NP+W+AIGY      I+ + K  + H            PL KG+
Sbjct  132  VAFLFCFFSRVSPNGENPAWEAIGY----NVITNENKPSETHKER---------PLQKGM  178

Query  435  ID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
            ++ +   ++ +   L + G    + +    +  I+CDAVVVGSG GGGV + VLA AG K
Sbjct  179  VETMQETDQTLLESLAQKGL---EAETDHDTIRIKCDAVVVGSGSGGGVAASVLAKAGMK  235

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+V+EKG+YY  +     EGP MDK++
Sbjct  236  VVVMEKGSYYTPSTYPSTEGPGMDKLY  262



>gb|KFK29401.1| hypothetical protein AALP_AA7G128800 [Arabis alpina]
Length=745

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 112/206 (54%), Gaps = 20/206 (10%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R+GTLLLCG   L   +PF+L+F ++    RE I+  W+T S   L F   FF A K 
Sbjct  92   SFRLGTLLLCGSLCLDKNWPFVLKFSQLPLDTREEILRKWSTQSGFLLPFRITFFLA-KF  150

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              L  FF+  D+   NP+ +AIGYC  D S S+K +  +              PL  GII
Sbjct  151  YTLFYFFSQTDENLKNPALEAIGYC-VDTSSSKKSQVDEKRP-----------PLESGII  198

Query  438  DLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +     +    + L + G  VA+         I CDAVVVGSG GGGV +  LA AG+KV
Sbjct  199  ETKHENDITITKSLIEKGLHVARDDNV---HRIRCDAVVVGSGSGGGVAAANLAKAGFKV  255

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKGNY+A  + S LE PSM +++
Sbjct  256  VVLEKGNYFAAQDYSGLEAPSMLELY  281



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 118/207 (57%), Gaps = 23/207 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +T++GTL+LC   SL  +FPF+ +F ++  +KRE     W   +    +R  F  +K   
Sbjct  108  ATKLGTLVLCRSLSLCGRFPFINKFSDMPIEKREEAFKRWNKENFFTPLRLVFVMVKVFC  167

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP---DPSISekqkkqkhhdheddieeLLFGPLYKGI  434
            L +F++  ++  +N SW AIGY  P    P  S+ ++                 PL KG+
Sbjct  168  LYIFYSMTNENSENQSWNAIGYSLPIVEKPLKSQTER-----------------PLEKGV  210

Query  435  ID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
            I+ ++  +  +   L+K G +V++  P    + I+CD  +VGSGCGGGV + VLA+AG+K
Sbjct  211  IETMDQTDSSLLQSLSKKGLAVSQ-DPIQNLYDIKCDVAIVGSGCGGGVAAAVLASAGHK  269

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+V+EKGNY+   + + +E PSM++M+
Sbjct  270  VVVIEKGNYFTSEDYTSIEAPSMNEMY  296



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 109/206 (53%), Gaps = 15/206 (7%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG   L   +PF+L+F ++   KRE I+  W+  S   L F   FF A K 
Sbjct  95   SFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREEILRKWSRQSGFLLPFRITFFLA-KF  153

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              L  FF+  D+   NP+ + IGYC      S  +K +               PL  GII
Sbjct  154  YTLFYFFSQTDENLKNPALETIGYCLDGIETSSNKKSEADKRRR---------PLETGII  204

Query  438  DLNLPEEHVFNRLTKLGCSVAKPKPPGPSF-VIECDAvvvgsgcgggvisgvLATAGYKV  614
            +    E  V    + +G  V   +  G +   I CDAVVVGSG GGGV +  LA AG+KV
Sbjct  205  ETT-HESDVTITQSLIGKGVHVARDDGDNVHRIRCDAVVVGSGSGGGVAAANLAKAGFKV  263

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            LVLEKGNY+A  + S LEGPSM +++
Sbjct  264  LVLEKGNYFAPQDYSGLEGPSMLELY  289



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 16/152 (11%)
 Frame = +3

Query  285  VDDKGDNPSWKAIGYCGPDPSI----------SekqkkqkhhdheddieeLLFGPLYKGI  434
            VD++ +N SWKAI Y G DP            S+ ++  +  D E++  E L+GPL+KGI
Sbjct  119  VDEEMNNISWKAIDYPGSDPQFKPPSNLKEKDSKSREVDEEGDEEEEEAEELYGPLFKGI  178

Query  435  IDLNLPEE--HVFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvisgvLA  596
            ++L   ++       L K G  V       KPP PS +I+CDAVVVGSG GGGV++GVLA
Sbjct  179  VNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVVAGVLA  238

Query  597  TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+
Sbjct  239  NAGYKVLVLEKGSYCARTNLSLLEGPAMEEMY  270



>emb|CDX77517.1| BnaA07g06550D [Brassica napus]
Length=540

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 116/208 (56%), Gaps = 26/208 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-SWATSSLQFIRNFFTAMKALV  263
            +TR+GTLL+CG   L + +PF+ +F E++ +KRER++   +    L  IR  F  +K   
Sbjct  94   ATRLGTLLICGTECLVSSWPFVEKFSELTLEKRERVLQKQFRNWFLTPIRAAFVYIKVAF  153

Query  264  LLVFFTSVDDKGDNPSWKAIGY----CGPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
            L  FF+ V   G+NP+W+AIGY        PS + K++                 PL KG
Sbjct  154  LFCFFSRVSSNGENPAWEAIGYRVNLDENKPSETRKER-----------------PLEKG  196

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            +++ +   E+ +   LT+ G    +      +  I+CDAVVVGSG GGGV + VLA AG 
Sbjct  197  VVETMKETEQTLLESLTQKG---LEADTDHDAIRIKCDAVVVGSGSGGGVAASVLAKAGL  253

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+V+EKG+YY  ++    EG  M+K++
Sbjct  254  KVIVMEKGSYYTESDYPPFEGHGMEKLY  281



>ref|XP_010433200.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Camelina sativa]
Length=748

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 109/208 (52%), Gaps = 18/208 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG       +PF+L+F E+   +RE I+  W+  S   L F   FF A K 
Sbjct  94   SFRFGTLLLCGSLCFDKSWPFVLKFSELPLDRREEILRKWSRQSGYLLPFRITFFLA-KF  152

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
              L  FF+  D+   NP+ +AIG+C    D SIS K+ +                PL  G
Sbjct  153  YTLFYFFSHTDENMKNPALEAIGFCLDPKDSSISNKKSEADEKRR----------PLESG  202

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            II+ L+  +  +   L + G   A+         I CD VVVGSG GGGV +  LA AG 
Sbjct  203  IIETLHESDITITQSLIEKGVHAARDDDENV-HRIRCDVVVVGSGSGGGVAAANLAKAGL  261

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KVLVLEKGNY+   + S LEGPSM +++
Sbjct  262  KVLVLEKGNYFTAQDYSGLEGPSMLELY  289



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 117/204 (57%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GTLLLCG   L  ++P++  F  +S +KRE+IV  W     L  IR  F  +K L 
Sbjct  103  ATRLGTLLLCGFLCLGEKWPYINNFSNMSLEKREKIVQKWLKHRFLTPIRLAFVYVKVLC  162

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L  FF+ VD+ GDNP+WKAIGY   D          +              PL KG I+ 
Sbjct  163  LYSFFSMVDENGDNPAWKAIGYEVSDNEKQNNVSNNR--------------PLEKGTIET  208

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            ++  +  +   L K G +V           ++CDAVVVGSGCGGGV + VL++AG+KV+V
Sbjct  209  MHESDSTLQQSLAKKGLNVTLDFKSNI-LKVKCDAVVVGSGCGGGVAAAVLSSAGHKVVV  267

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKGNY++  + S LEGPSM +++
Sbjct  268  LEKGNYFSPQDYSSLEGPSMKQLY  291



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 116/208 (56%), Gaps = 26/208 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-SWATSSLQFIRNFFTAMKALV  263
            +TR+GTLL+CG   L + +PF+ +F E++ +KRER++   +    L  IR  F  +K   
Sbjct  94   ATRLGTLLICGTECLVSSWPFVEKFSELTLEKRERVLQKQFRNWFLTPIRAAFVYIKVAF  153

Query  264  LLVFFTSVDDKGDNPSWKAIGY----CGPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
            L  FF+ V   G+NP+W+AIGY        PS + K++                 PL KG
Sbjct  154  LFCFFSRVSSNGENPAWEAIGYRVNLDENKPSETRKER-----------------PLEKG  196

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            +++ +   E+ +   LT+ G    +      +  I+CDAVVVGSG GGGV + VLA AG 
Sbjct  197  VVETMKETEQTLLESLTQKG---LEADTDHDAIRIKCDAVVVGSGSGGGVAASVLAKAGL  253

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+V+EKG+YY  ++    EG  M+K++
Sbjct  254  KVIVMEKGSYYTESDYPPFEGHGMEKLY  281



>gb|KJB38384.1| hypothetical protein B456_006G252500 [Gossypium raimondii]
Length=748

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 114/215 (53%), Gaps = 41/215 (19%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTA------  248
            ST++GTLLLCG      ++P++  F  +   KRE+++ +W      F   FFT       
Sbjct  106  STKVGTLLLCGSHCWGKEWPYINGFTSMPLAKREQVLQAW------FKHRFFTPFRVAFL  159

Query  249  -MKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLY  425
              K  +L   F+ VD+ G+NP+W+AIGY     +I + +                  PL 
Sbjct  160  YFKVAILFTIFSRVDENGENPAWEAIGY-----NIDKVENVPNER------------PLQ  202

Query  426  KGIIDLNLPEEHVFNR------LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  587
            +GI++      HV +       LT+ G  V +  P   +  I+CDAV+VGSGCGGGV + 
Sbjct  203  QGIVETM----HVIDSIDLHKLLTEKGLQVTQ-DPHKNAIKIKCDAVIVGSGCGGGVAAA  257

Query  588  vLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
             LA++G KV+VLEKG Y+   + S  EGPSM+K++
Sbjct  258  TLASSGLKVVVLEKGCYFGPADYSPFEGPSMEKLY  292



>emb|CDY51703.1| BnaA03g58930D [Brassica napus]
Length=737

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 107/205 (52%), Gaps = 18/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  260
            S R GTL LCG   L+  +PF+L+F ++   KRE I+  W+  S  F+  R  F   K  
Sbjct  92   SYRFGTLFLCGSLCLAKDWPFVLKFSDLPLDKREEILRMWSRQSGLFLPLRITFFLAKFY  151

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
             L  FF+  D    NP+ +AIGY      +S+  +  +              PL KGII+
Sbjct  152  TLFSFFSQRDQNMKNPALEAIGYSIDTTEMSKDDEAPR--------------PLEKGIIE  197

Query  441  L-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
              N  +  +   LT+ G  VA+         I CD V+VGSG GGGV +  LA AG KVL
Sbjct  198  TKNESDVTIRQSLTQKGVHVARDDNDNI-HRIRCDVVIVGSGSGGGVAAANLAKAGLKVL  256

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            VLEKGNY+   + S LEGPSM +++
Sbjct  257  VLEKGNYFTSRDYSGLEGPSMLELY  281



>ref|XP_004167305.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A-like, 
partial [Cucumis sativus]
Length=608

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 96/147 (65%), Gaps = 11/147 (7%)
 Frame = +3

Query  285  VDDKGDNPSWKAIGYCGPDPSIS-----ekqkkqkhhdheddieeLLFGPLYKGIIDLNL  449
            VD++ +N SWKAI Y G DP        +++  +     E +  E L+GPL+KGI++L  
Sbjct  1    VDEELNNISWKAIDYPGSDPQFKPPSNLKEKDSKSKEVDEGEEAEELYGPLFKGIVNLQH  60

Query  450  PEE--HVFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
             ++       L K G  V       KPP PS +I+CDAVVVGSG GGGVI+GVLA AGYK
Sbjct  61   QQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVIAGVLANAGYK  120

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            VLVLEKG+Y AR NLSLLEGP+M++M+
Sbjct  121  VLVLEKGSYCARXNLSLLEGPAMEEMY  147



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 116/205 (57%), Gaps = 19/205 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  260
            +T++GTL+LCG  SL   FPF+ +F ++  +KRE ++  W   +  FI  R  F  +K  
Sbjct  109  ATKLGTLVLCGFLSLRGGFPFINKFSDMPVEKREEVLKRWNKENF-FIPLRMVFVMVKVF  167

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
               +F++  ++  +N SW AIGY  P      K ++++              PL KGII+
Sbjct  168  CFHIFYSMTNENSENLSWNAIGYSLPTEEKPRKSQRER--------------PLEKGIIE  213

Query  441  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  617
             ++  +  +   L K G +V++  P    + I CD  +VGSGCGGGV + VLA+AG KV+
Sbjct  214  TMDQTDASLLESLAKKGLTVSQ-DPMQNIYRIRCDVAIVGSGCGGGVAAAVLASAGRKVV  272

Query  618  VLEKGNYYARTNLSLLEGPSMDKMF  692
            V+EKGNY+   + + +E PSM +++
Sbjct  273  VIEKGNYFTSEDYTSIEAPSMYELY  297



>ref|XP_004953134.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Setaria italica]
Length=773

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 71/203 (35%), Positives = 110/203 (54%), Gaps = 11/203 (5%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALVL  266
            TR+G L LCG   LS +FPF+ RF E+  ++RE  +  W+  +L   +R FF   K   L
Sbjct  115  TRLGALALCGARCLSWRFPFVRRFAELPPEEREGAMQRWSRQTLLPPLRIFFLITKVFCL  174

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL-  443
             VF++  D+  +NP W+A GY  P          ++    +         PL  G+++  
Sbjct  175  YVFYSWTDENSENPHWRATGYSPPLADEEHAAAAEEGRPEKR--------PLDDGVVETT  226

Query  444  NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
            N  +  +   L   G +V +         +ECD V+VGSGCGGGV + VLA AGYKV+V+
Sbjct  227  NETDASLAASLAAKGLAVTEDAARNVC-TVECDVVIVGSGCGGGVSAAVLAGAGYKVVVI  285

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKG+Y+   + + +E PSM++++
Sbjct  286  EKGSYFTARDYTAVEAPSMEQLY  308



>ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium 
distachyon]
Length=757

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 117/204 (57%), Gaps = 10/204 (5%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALV  263
            +TR+GTL LCG   L      + RF ++  ++RE  +  W  +  L  ++  F  +K+L+
Sbjct  101  TTRLGTLALCG--WLCVVDSSVRRFADMPVERREAALQRWTRARWLIPVKIAFAIVKSLL  158

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL  443
              VF+T V++  +NP WKAIGY  PD     +++K                PL KG+++ 
Sbjct  159  FNVFYTKVNENSENPCWKAIGYSVPDVEEQRRRRKNGTEATARRR------PLDKGVVET  212

Query  444  -NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
              L +  +   L   G +V      GP   ++CDAV+VGSGCGGGV + VLA AG+KV+V
Sbjct  213  RELDDAALLRSLAAKGLTVKPAASNGPHHTVQCDAVIVGSGCGGGVAAAVLAAAGHKVVV  272

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+A  + S +EGPSM++++
Sbjct  273  LEKGDYFAAQDYSSVEGPSMERLY  296



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 117/208 (56%), Gaps = 24/208 (12%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-SWATSSLQFIRNFFTAMKALV  263
            +TR+GTLL+CG   L +++PF+ +F E+S +KRER++   +    L  IR  F  +K   
Sbjct  94   ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNWFLTPIRAAFVYIKVAF  153

Query  264  LLVFFTSVDDKGDNPSWKAIGYC----GPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
            L  FF+ V   G+NP+W+AIGY        PS + K++                 PL KG
Sbjct  154  LFCFFSRVTPDGENPAWEAIGYHVNLDENKPSETRKER-----------------PLEKG  196

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            I++ +   E+ +   L + G   A       +  I+CDAVVVGSG GGGV + VLA +G 
Sbjct  197  IVETMEETEQTLLELLAQKGLE-ADLDTVHDAIRIKCDAVVVGSGSGGGVAASVLAKSGL  255

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+VLEKG+Y+  ++    EGP +DK++
Sbjct  256  KVVVLEKGSYFTPSDYRPFEGPGLDKLY  283



>ref|XP_010438427.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=745

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 109/208 (52%), Gaps = 18/208 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG   L   +PF+L+F E+   +RE I+  W+  S   L F   FF A K 
Sbjct  91   SFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREEILKKWSRQSGYLLPFRITFFLA-KF  149

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
              L  FF+  D+   NP+ +AIG+C    D S S K+ +                PL  G
Sbjct  150  YTLFYFFSHTDENLKNPALEAIGFCLDTKDSSSSNKKIEADEKRR----------PLESG  199

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            I++ L+  +  +   L + G   A+         I CD ++VGSG GGGV +  LA AG 
Sbjct  200  IVETLHESDITITQTLIEKGVHAARDDDENV-HRIRCDVIIVGSGSGGGVAAANLAKAGL  258

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KVLVLEKGNY+   + S LEGPSM +++
Sbjct  259  KVLVLEKGNYFTAQDYSGLEGPSMLELY  286



>ref|XP_010532673.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=770

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 110/207 (53%), Gaps = 30/207 (14%)
 Frame = +3

Query  99   GTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVF  275
            GTLLLCG   L   +PF+ RF  +S +KRER++  W  + L F IR  F  +K + L  F
Sbjct  128  GTLLLCGTHCLVPNWPFVERFGSLSLEKRERVLQKWFRNRLLFPIRVAFIFIKVIFLFCF  187

Query  276  FTSVDDKGDNPSWKAIGYC--GPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL--  443
            F+ +   GDNP+W+AI Y     D   S   K++               PL KG++D   
Sbjct  188  FSWIGPNGDNPAWEAIQYQVKAEDNESSYVPKER---------------PLEKGMVDTMK  232

Query  444  ----NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
                 LPE     R  +LG +         +  I+CDAV++GSG GGGV + VLA AG K
Sbjct  233  ETDSTLPETI---RQKELGVTFGSKH---DTIEIKCDAVIIGSGSGGGVAAAVLANAGLK  286

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+VLEKG+Y+  +  S  EGP + +++
Sbjct  287  VVVLEKGSYFVSSEYSPFEGPGLSELY  313



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 108/203 (53%), Gaps = 18/203 (9%)
 Frame = +3

Query  93   RIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--IRNFFTAMKALVL  266
            R GTL LCG   L+  +PF+L+F E+   KRE I+  W+  S  F  +R  F   K   L
Sbjct  99   RFGTLFLCGSLCLAKDWPFVLKFSELPLDKREEILRMWSRQSGFFLPLRITFFLAKFYTL  158

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDL-  443
              FF+  D+   NP+ +AIGY     SI   + +++              PL +GII+  
Sbjct  159  FSFFSQRDENMKNPALEAIGY-----SIDTTEMRKEDETPR---------PLERGIIETK  204

Query  444  NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
            N  +  +   LT+ G  VA+         I CD V+VGSG GGGV +  LA AG KVLVL
Sbjct  205  NESDVTIRQSLTQKGVHVAREDNDNI-HRIRCDVVIVGSGSGGGVAAANLAKAGLKVLVL  263

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKGNY+   + S LEGPSM +++
Sbjct  264  EKGNYFTSRDYSGLEGPSMLELY  286



>ref|XP_010447958.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=750

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 108/206 (52%), Gaps = 13/206 (6%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---LQFIRNFFTAMKA  257
            S R GTLLLCG   L   +PF+L+F E+   +RE I+  W+  S   L F   FF A K 
Sbjct  95   SFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREEILRKWSRQSGFLLPFRITFFLA-KF  153

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
              L  FF+  D+   NP+ +AIG+C      S    K+   D +         PL  GII
Sbjct  154  YTLFYFFSHTDENLKNPALEAIGFCLDTKDSSSNSNKKSEADEKRR-------PLESGII  206

Query  438  DLNLPEEHVFNRLTKLGCSVAKPKPPGPS-FVIECDAvvvgsgcgggvisgvLATAGYKV  614
            +  L E  +    T +G  V   +    +   I CD V+VGSG GGGV +  LA AG KV
Sbjct  207  E-TLHESDITITQTLIGKGVHAARDDDENVHRIRCDVVIVGSGSGGGVAAANLAKAGLKV  265

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            LVLEKGNY+   + S LEGPSM +++
Sbjct  266  LVLEKGNYFTAQDYSGLEGPSMLELY  291



>gb|EEC73620.1| hypothetical protein OsI_08118 [Oryza sativa Indica Group]
Length=770

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 75/206 (36%), Positives = 118/206 (57%), Gaps = 19/206 (9%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSWA-TSSLQFIRNFFTAMKALV  263
            TR+GTL LCG   +S  ++PF+L F E+  ++RE  +  W+  + L  +R FF  +K   
Sbjct  123  TRLGTLALCGGRCVSWGRWPFVLTFAEMPVERREEALRRWSRVTVLPPLRAFFLVVKVFC  182

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP--DPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L VF++ +D+  +NP W+AIGY  P  +P   E  +  K              PL  G++
Sbjct  183  LYVFYSWIDESSENPHWRAIGYSPPTDEPPAEEHTEATKR-------------PLDDGVV  229

Query  438  D-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            + +NL +  + + L + G +V          V ECD  +VGSGCGGGV + VLA AG+KV
Sbjct  230  ETINLTDASLPSSLAEKGLAVTDDAARNVCRV-ECDVAIVGSGCGGGVAAAVLAGAGHKV  288

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+   + +  EGPS+++++
Sbjct  289  VVIEKGNYFTSRDYTSFEGPSINQLY  314



>ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
Length=773

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 80/213 (38%), Positives = 121/213 (57%), Gaps = 31/213 (15%)
 Frame = +3

Query  90   TRIGTLLLCG-KGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            TR+G+L LCG +  LS +FPF+ RF E+  ++RE  +  W+  +L   +R FF  +KA+ 
Sbjct  115  TRLGSLALCGARSCLSWRFPFVRRFDELPLEQREAALRRWSRQTLLLPLRMFFVIIKAIC  174

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP----DPSISekqkkqkhhdheddieeLLFGPLYKG  431
            L VF++  D+   NP W+AIGY  P    +P+ +E ++ +K              PL  G
Sbjct  175  LHVFYSWTDENSKNPHWRAIGYSPPLADDEPAPAESERPEKR-------------PLDDG  221

Query  432  II------DLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  593
            ++      D +LP       L   G +VA         V ECD V+VGSGCGGGV + VL
Sbjct  222  VVETTKETDASLPA-----LLAAKGLTVADDSAQNVCRV-ECDVVIVGSGCGGGVAAAVL  275

Query  594  ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            A AG+KV+V+EKGNY+   + + +E PSM++++
Sbjct  276  AGAGHKVVVIEKGNYFTARDYTAIEAPSMEQLY  308



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 116/208 (56%), Gaps = 26/208 (13%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-SWATSSLQFIRNFFTAMKALV  263
            +TR+GTLL+CG   L + +PF+ +F E+S +KRER++   +    L  IR  F  +K   
Sbjct  94   ATRLGTLLICGTECLVSSWPFVEKFSELSLEKRERVLQKQFRNWFLTPIRAAFVYIKVAF  153

Query  264  LLVFFTSVDDKGDNPSWKAIGY----CGPDPSISekqkkqkhhdheddieeLLFGPLYKG  431
            L  FF+ V   G+NP+W+AIGY        PS ++K++                 PL KG
Sbjct  154  LFCFFSRVSSNGENPAWEAIGYRVNLDENKPSETQKER-----------------PLEKG  196

Query  432  IID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGY  608
            +++ +   E+ +   LT+ G    +      +  I+CDAVVVGSG GGGV + VLA AG 
Sbjct  197  VVETMKETEQTLLESLTQKG---LESDTDHDAIRIKCDAVVVGSGSGGGVAASVLAKAGL  253

Query  609  KVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            KV+V+EKG+Y   ++    EG  M+K++
Sbjct  254  KVVVMEKGSYCTESDYPPFEGHGMEKLY  281



>ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
Length=760

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 73/210 (35%), Positives = 119/210 (57%), Gaps = 18/210 (9%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQ------FPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFT  245
            +TR GTL LCG  +           P + RF ++  ++RE  +  W+++   F ++  FT
Sbjct  110  ATRAGTLALCGAAACVASSAAGGWLPSVRRFADLPPERREAALRRWSSARWLFPLKITFT  169

Query  246  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLY  425
             +K +   VF+T +D+K  NPSWKAIGY  P  + +  ++++               PL 
Sbjct  170  VIKIICHFVFYTKLDEKSRNPSWKAIGYAAPAAAAAAVEQRRPASPSRR--------PLE  221

Query  426  KGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATA  602
             G+++    +++   R L + G +V           ++CDAVVVGSGCGGGV + VLA+ 
Sbjct  222  DGVVETRRMDDNALLRSLVEKGLAVKTGT--AAHHTVQCDAVVVGSGCGGGVAAAVLASK  279

Query  603  GYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            GYKV+V+EKG+Y+A  + + LEGPSM++++
Sbjct  280  GYKVVVVEKGDYFATEDYTSLEGPSMERLY  309



>ref|NP_001047464.1| Os02g0621800 [Oryza sativa Japonica Group]
 dbj|BAD21547.1| putative alcohol oxidase [Oryza sativa Japonica Group]
 dbj|BAF09378.1| Os02g0621800 [Oryza sativa Japonica Group]
Length=770

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 75/206 (36%), Positives = 118/206 (57%), Gaps = 19/206 (9%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSWA-TSSLQFIRNFFTAMKALV  263
            TR+GTL LCG   +S  ++PF+L F E+  ++RE  +  W+  + L  +R FF  +K   
Sbjct  123  TRLGTLALCGGRCVSWGRWPFVLTFAEMPVERREEALGRWSRVTVLPPLRAFFLVVKVFC  182

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP--DPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L VF++ +D+  +NP W+AIGY  P  +P   E  +  K              PL  G++
Sbjct  183  LYVFYSWIDESSENPHWRAIGYSPPTDEPPAEEHTEATKR-------------PLDDGVV  229

Query  438  D-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            + +NL +  + + L + G +V          V ECD  +VGSGCGGGV + VLA AG+KV
Sbjct  230  ETINLTDASLPSSLAEKGLAVTDDAARNVCRV-ECDVAIVGSGCGGGVAAAVLAGAGHKV  288

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+   + +  EGPS+++++
Sbjct  289  VVIEKGNYFTSRDYTSFEGPSINQLY  314



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 117/207 (57%), Gaps = 24/207 (12%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  254
            +TR+GTLL+CG   L +++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  94   ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNWL---LTPIRAAFVYIK  150

Query  255  ALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGI  434
               L  FF+ V   G+N +W+AIGY     +++  + K      E         PL KG+
Sbjct  151  VAFLFCFFSRVSPNGENLAWEAIGY-----NVNTNENKPSETHKER--------PLEKGM  197

Query  435  ID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  611
            ++ +   E+ +   L + G    + +    +  I+CDAVVVGSG GGGV + VLA AG K
Sbjct  198  VETMQETEQTLVESLAQKGL---EAETDHDTIRIKCDAVVVGSGSGGGVAASVLAKAGMK  254

Query  612  VLVLEKGNYYARTNLSLLEGPSMDKMF  692
            V+V+EKG+YY  +     EGP M+K++
Sbjct  255  VVVMEKGSYYTPSTYPSTEGPGMNKLY  281



>dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 115/203 (57%), Gaps = 14/203 (7%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALVL  266
            TR+GTL LCG   LS   PF+ RF E+   +RE  +  W+  ++   +R FF  +K   L
Sbjct  107  TRLGTLALCGARCLSWSSPFVHRFAEMPVDRREDALRRWSRETMIPPLRLFFLLVKVYCL  166

Query  267  LVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-L  443
             VF++  DD  +NP W+AIGY  P    +E++++                PL  G+++ +
Sbjct  167  YVFYSWTDDNSENPHWQAIGYSPPTDEAAEQEEQASIKR-----------PLEDGVVETI  215

Query  444  NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVL  623
            +  +  +   L + G +V +         IECD V+VGSGCGGGV + VLA AG+KV+V+
Sbjct  216  HQTDASLPTSLAEKGLAVTEDAARNVC-RIECDVVIVGSGCGGGVAAAVLAGAGHKVVVI  274

Query  624  EKGNYYARTNLSLLEGPSMDKMF  692
            EKGNY+   + + +EGPSM +++
Sbjct  275  EKGNYFTARDYTSIEGPSMSQLY  297



>gb|EEC67160.1| hypothetical protein OsI_34014 [Oryza sativa Indica Group]
Length=710

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 115/211 (55%), Gaps = 15/211 (7%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLST----QFPFL--LRFPEISQKKRERIVHSWATSSLQF--IRNFF  242
            STR GTLLLCG+ S++      FPF+   RF ++   +RE  +  W+ +   F  +R  F
Sbjct  99   STRAGTLLLCGRDSVAAVDGGGFPFVSVRRFADMPAARREAALRRWSGARWLFFPLRIAF  158

Query  243  TAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPL  422
               K L   VF++ V++  +NP WKAIGY   +P     +              L     
Sbjct  159  AIAKILCHYVFYSMVNENSENPYWKAIGYRVEEPRRDRAESMPSPSPSPASRRPL-----  213

Query  423  YKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLAT  599
              G+++   L +  +   L   G SV +P        + CDAV+VGSGCGGGV + VLA+
Sbjct  214  DNGVVETRALTDTTLLRSLAAKGLSV-RPGASDEHHTVRCDAVIVGSGCGGGVAAAVLAS  272

Query  600  AGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  692
            AGYKV+V+EKG+Y+ + + S +EGPSM+++F
Sbjct  273  AGYKVVVVEKGDYFTKEDYSSIEGPSMERLF  303



>gb|EEE57396.1| hypothetical protein OsJ_07570 [Oryza sativa Japonica Group]
Length=1066

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 75/206 (36%), Positives = 118/206 (57%), Gaps = 19/206 (9%)
 Frame = +3

Query  90   TRIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSWA-TSSLQFIRNFFTAMKALV  263
            TR+GTL LCG   +S  ++PF+L F E+  ++RE  +  W+  + L  +R FF  +K   
Sbjct  123  TRLGTLALCGGRCVSWGRWPFVLTFAEMPVERREEALGRWSRVTVLPPLRAFFLVVKVFC  182

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGP--DPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            L VF++ +D+  +NP W+AIGY  P  +P   E  +  K              PL  G++
Sbjct  183  LYVFYSWIDESSENPHWRAIGYSPPTDEPPAEEHTEATKR-------------PLDDGVV  229

Query  438  D-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKV  614
            + +NL +  + + L + G +V          V ECD  +VGSGCGGGV + VLA AG+KV
Sbjct  230  ETINLTDASLPSSLAEKGLAVTDDAARNVCRV-ECDVAIVGSGCGGGVAAAVLAGAGHKV  288

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKGNY+   + +  EGPS+++++
Sbjct  289  VVIEKGNYFTSRDYTSFEGPSINQLY  314



>gb|EMT04470.1| Putative GMC-type oxidoreductase [Aegilops tauschii]
Length=865

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 115/206 (56%), Gaps = 22/206 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS--LQFIRNFFTAMKAL  260
            ST+ GTL+LCG+  +S +   + RF  +  +++E  +  W+ +S  L   R  F   K L
Sbjct  228  STKAGTLVLCGRLCISDE---IRRFAHMPLERKEEALKKWSKASWFLLPTRIAFVIFKML  284

Query  261  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID  440
               VF+T VD+  DNPSWKAIGY              K  + +         PL KG+++
Sbjct  285  CQYVFYTKVDENYDNPSWKAIGY------------GVKKVEEQWQKRPRRPRPLDKGVLN  332

Query  441  LNLPEEHVFNR-LTKLGCSVAKPKPPGPSF-VIECDAvvvgsgcgggvisgvLATAGYKV  614
                 +  F R +T+ G +V   KP    +  +ECD V+ GSGCGGGV + VLA+AG KV
Sbjct  333  TKELNDQTFLRSVTEKGLAV---KPGTNQYHTVECDVVIAGSGCGGGVAAAVLASAGLKV  389

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +V+EKG+Y+   + S +EGPSM++++
Sbjct  390  VVVEKGDYFIADDYSGIEGPSMEQLY  415



>gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea]
Length=724

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 108/206 (52%), Gaps = 23/206 (11%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFP-FLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKA  257
            STR+GTLLLCG   L  + P FL  F E+   KRE ++  W+     F+  R  F  +K 
Sbjct  85   STRLGTLLLCGFTCLDWRSPPFLPTFSELQLSKREAVLQRWSRQGGTFLPLRITFLLVKI  144

Query  258  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGII  437
            +    FF+  D+   NP+W++IGY    P +                  L   PL  GII
Sbjct  145  MSFFTFFSRTDENSQNPAWESIGYHIETPVV--------------VERPLQRRPLQNGII  190

Query  438  DLNLPEEHVFNRLTKLGCSVAKPKPPGPSFV-IECDAvvvgsgcgggvisgvLATAGYKV  614
                 E    + L + G  V   +     ++ ++CD VVVGSGCGG V + +LA +G+KV
Sbjct  191  -----ETITESSLRQKGLRVITEEDDDDDYLNVDCDVVVVGSGCGGSVAAAILAKSGHKV  245

Query  615  LVLEKGNYYARTNLSLLEGPSMDKMF  692
            +VLEKG+Y+A  + S LEGPS+ +++
Sbjct  246  VVLEKGHYFAAQDYSGLEGPSLSELY  271



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 122/204 (60%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STR+GTLLLCG   L  ++P++  F  +  + RE+++  W  S L   +R  F  +K   
Sbjct  15   STRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKSWLFTLVRIAFIYLKVAC  74

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L VFF+ V +  DNP+W+AIGY   +   S++  K++              PL KG+I+ 
Sbjct  75   LYVFFSRVGENNDNPAWEAIGYQVDNVENSKQVSKER--------------PLQKGMIET  120

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            ++  +  +   LT+ G  V +       + I+CDAV+VGSGCGGGV + +LA++G KV+V
Sbjct  121  MHEKDSTLLQSLTQKGLQVTEDTERNV-YKIKCDAVIVGSGCGGGVAAAILASSGLKVVV  179

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+A ++ S  EGPSMD+++
Sbjct  180  LEKGSYFAPSDYSPFEGPSMDQLY  203



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 105/194 (54%), Gaps = 25/194 (13%)
 Frame = +3

Query  132  STQFPFLLRFPEISQKKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNP  308
            S ++PF+  F  +S   RE+++  W     L  IR  F  +K L   VFF+  DD G+NP
Sbjct  108  SKKWPFINSFSNLSLDNREKVLQKWFKHRFLTPIRLVFIYIKVLCFFVFFSQCDDNGENP  167

Query  309  SWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID------LNLPEEHVFN  470
            +W+AIGY      I+      +              PL KGI++      L+LP+     
Sbjct  168  AWEAIGYQVDSDGITTTSNVHRER------------PLEKGIVEAMKESNLSLPKS----  211

Query  471  RLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYART  650
             L + G  VA       +  I+CD V+VGSGCGGGV + +LA++G KVLVLEKGNY+   
Sbjct  212  -LIEKGLEVA-IDSKNNTLNIKCDVVIVGSGCGGGVAASILASSGLKVLVLEKGNYFTPN  269

Query  651  NLSLLEGPSMDKMF  692
            + S LEGPS+++++
Sbjct  270  DYSSLEGPSLNELY  283



>emb|CDP03771.1| unnamed protein product [Coffea canephora]
Length=766

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 119/205 (58%), Gaps = 17/205 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  263
            STR+GTLL+CG   L+ ++PF+ RF E+  KKRE I+  W+T +    +R  F  +K + 
Sbjct  110  STRLGTLLVCGLICLNWKWPFVHRFSELPVKKRETILQKWSTETFLIPLRIVFLMIKIMC  169

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
              VFF+  D+   + +  AIGY   D    + + +++              PL KG+I+ 
Sbjct  170  CYVFFSWTDENYKSRTLDAIGY-NTDAREDKIKPREER-------------PLEKGVIET  215

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            L   +  +   L + G  V + +P    + I+CD V+VGSGCGGGV + +LA +G+KVLV
Sbjct  216  LYENDSTLKTSLIQKGLFV-EEEPNEDLYKIKCDVVIVGSGCGGGVAAAILAASGHKVLV  274

Query  621  LEKGNYYARTNLSLLEGPSMDKMFL  695
            LEKG+Y+   + S LEGPS ++++L
Sbjct  275  LEKGHYFVPEDYSGLEGPSFEELYL  299



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 122/204 (60%), Gaps = 17/204 (8%)
 Frame = +3

Query  87   STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  263
            STR+GTLLLCG   L  ++P++  F  +  + RE+++  W  S L   +R  F  +K   
Sbjct  104  STRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKSWLFTLVRIAFIYLKVAC  163

Query  264  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIID-  440
            L VFF+ V +  DNP+W+AIGY   +   S++  K++              PL KG+I+ 
Sbjct  164  LYVFFSRVGENNDNPAWEAIGYQVDNVENSKQVSKER--------------PLQKGMIET  209

Query  441  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  620
            ++  +  +   LT+ G  V +       + I+CDAV+VGSGCGGGV + +LA++G KV+V
Sbjct  210  MHEKDSTLLQSLTQKGLQVTEDTERN-VYKIKCDAVIVGSGCGGGVAAAILASSGLKVVV  268

Query  621  LEKGNYYARTNLSLLEGPSMDKMF  692
            LEKG+Y+A ++ S  EGPSMD+++
Sbjct  269  LEKGSYFAPSDYSPFEGPSMDQLY  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160