BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047O13

Length=653
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245703.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    129   2e-31   Solanum lycopersicum
ref|XP_010325452.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    129   2e-31   Solanum lycopersicum
ref|XP_006363727.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    129   2e-31   Solanum tuberosum [potatoes]
emb|CDP09879.1|  unnamed protein product                                128   3e-31   Coffea canephora [robusta coffee]
ref|XP_010918316.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    127   8e-31   Elaeis guineensis
ref|XP_009599696.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       127   9e-31   Nicotiana tomentosiformis
ref|XP_010918315.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    127   9e-31   Elaeis guineensis
ref|XP_010918314.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    127   1e-30   
ref|XP_006368713.1|  hypothetical protein POPTR_0001s08030g             127   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010276572.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       127   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006368714.1|  CPD photolyase family protein                      127   1e-30   
ref|XP_009764740.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       127   1e-30   Nicotiana sylvestris
ref|XP_003611237.1|  CPD photolyase                                     127   2e-30   
emb|CDY31262.1|  BnaC08g15570D                                          126   2e-30   Brassica napus [oilseed rape]
emb|CAN79335.1|  hypothetical protein VITISV_026088                     126   3e-30   Vitis vinifera
ref|XP_011029095.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       126   3e-30   Populus euphratica
gb|KEH27453.1|  CPD photolyase                                          125   4e-30   Medicago truncatula
gb|KFK43499.1|  hypothetical protein AALP_AA1G133300                    125   5e-30   Arabis alpina [alpine rockcress]
ref|XP_010494107.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    125   6e-30   Camelina sativa [gold-of-pleasure]
gb|KEH27451.1|  CPD photolyase                                          125   7e-30   Medicago truncatula
ref|XP_002509621.1|  DNA photolyase, putative                           125   7e-30   Ricinus communis
ref|XP_007209950.1|  hypothetical protein PRUPE_ppa004792mg             125   8e-30   
ref|XP_004511645.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    125   8e-30   Cicer arietinum [garbanzo]
ref|XP_008238652.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       125   8e-30   
gb|KEH27452.1|  CPD photolyase                                          124   9e-30   Medicago truncatula
ref|XP_010476208.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    124   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009110652.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       124   9e-30   Brassica rapa
gb|AES94195.2|  CPD photolyase                                          124   1e-29   Medicago truncatula
ref|XP_006306132.1|  hypothetical protein CARUB_v10011602mg             124   1e-29   
ref|XP_006417242.1|  hypothetical protein EUTSA_v10007458mg             124   2e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010458666.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010053402.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       123   3e-29   Eucalyptus grandis [rose gum]
gb|AAF79657.1|AC025416_31  F5O11.9                                      123   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849651.1|  photolyase 1                                          123   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563906.1|  photolyase 1                                          123   4e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAA67683.1|  CPD photolyase                                         123   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892684.1|  hypothetical protein ARALYDRAFT_471385             122   5e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_010533748.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       122   5e-29   Tarenaya hassleriana [spider flower]
ref|NP_001267582.1|  deoxyribodipyrimidine photo-lyase-like             122   7e-29   Cucumis sativus [cucumbers]
ref|XP_008437155.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       122   8e-29   Cucumis melo [Oriental melon]
ref|XP_010676658.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       122   9e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011463773.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    122   1e-28   Fragaria vesca subsp. vesca
ref|XP_002266483.2|  PREDICTED: deoxyribodipyrimidine photo-lyase       121   2e-28   Vitis vinifera
ref|XP_008798542.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       121   2e-28   Phoenix dactylifera
gb|KDO63751.1|  hypothetical protein CISIN_1g010783mg                   120   2e-28   Citrus sinensis [apfelsine]
gb|AAQ10672.1|  type II CPD photolyase                                  120   3e-28   Stellaria longipes
ref|XP_006440418.1|  hypothetical protein CICLE_v10019819mg             120   4e-28   Citrus clementina [clementine]
ref|XP_006477285.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    120   4e-28   Citrus sinensis [apfelsine]
emb|CBI22143.3|  unnamed protein product                                120   4e-28   Vitis vinifera
emb|CDY21047.1|  BnaA08g24780D                                          120   5e-28   Brassica napus [oilseed rape]
gb|EYU30458.1|  hypothetical protein MIMGU_mgv1a005220mg                119   6e-28   Erythranthe guttata [common monkey flower]
ref|XP_011081112.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       119   6e-28   Sesamum indicum [beniseed]
ref|XP_006477286.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    119   6e-28   
ref|XP_006440419.1|  hypothetical protein CICLE_v10019819mg             119   6e-28   Citrus clementina [clementine]
gb|KDO63750.1|  hypothetical protein CISIN_1g010783mg                   119   7e-28   Citrus sinensis [apfelsine]
ref|XP_007039991.1|  Photolyase 1 isoform 4                             118   7e-28   
gb|KHN34970.1|  Deoxyribodipyrimidine photo-lyase                       119   9e-28   Glycine soja [wild soybean]
ref|NP_001238710.1|  CPD photolyase                                     119   1e-27   
gb|KDP25590.1|  hypothetical protein JCGZ_20746                         119   1e-27   Jatropha curcas
ref|XP_007039990.1|  Photolyase 1 isoform 3                             118   1e-27   
gb|KHG30720.1|  Deoxyribodipyrimidine photo-lyase -like protein         118   2e-27   Gossypium arboreum [tree cotton]
ref|XP_007157316.1|  hypothetical protein PHAVU_002G059800g             118   2e-27   Phaseolus vulgaris [French bean]
ref|XP_007039988.1|  Photolyase 1 isoform 1                             118   2e-27   
gb|KJB20820.1|  hypothetical protein B456_003G166800                    117   3e-27   Gossypium raimondii
gb|EPS68392.1|  hypothetical protein M569_06376                         117   3e-27   Genlisea aurea
ref|XP_011463777.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    115   1e-26   Fragaria vesca subsp. vesca
ref|XP_008369510.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       116   1e-26   
ref|XP_011463776.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    115   1e-26   Fragaria vesca subsp. vesca
gb|AAP31406.1|  CPD photolyase                                          115   2e-26   Spinacia oleracea
ref|XP_009362139.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       115   3e-26   Pyrus x bretschneideri [bai li]
gb|EEE50627.1|  hypothetical protein OsJ_30831                          115   4e-26   Oryza sativa Japonica Group [Japonica rice]
sp|Q6F6A2.1|PHR_ORYSJ  RecName: Full=Deoxyribodipyrimidine photo-...    114   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382010.1|  PREDICTED: deoxyribodipyrimidine photo-lyase       114   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
pdb|3UMV|A  Chain A, Eukaryotic Class Ii Cpd Photolyase Structure...    114   5e-26   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF97091.1|  CPD photolyase                                         114   5e-26   Oryza meridionalis [Australian wild rice]
gb|AAN04184.1|  Putative CPD photolyase                                 115   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010234649.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    112   6e-26   
dbj|BAF97083.1|  CPD photolyase                                         114   6e-26   Oryza meridionalis [Australian wild rice]
dbj|BAF97089.1|  CPD photolyase                                         114   6e-26   Oryza meridionalis [Australian wild rice]
ref|XP_006662213.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    113   1e-25   
gb|EEC66611.1|  hypothetical protein OsI_32845                          113   1e-25   Oryza sativa Indica Group [Indian rice]
dbj|BAD52107.1|  CPD photolyase                                         112   2e-25   Oryza sativa Indica Group [Indian rice]
dbj|BAF97082.1|  CPD photolyase                                         112   2e-25   Oryza rufipogon [common wild rice]
ref|XP_010234648.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    112   2e-25   
ref|XP_003573808.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    112   2e-25   Brachypodium distachyon [annual false brome]
dbj|BAF97088.1|  CPD photolyase                                         112   3e-25   Oryza barthii [African wild rice]
dbj|BAF97093.1|  CPD photolyase                                         112   3e-25   Oryza barthii [African wild rice]
ref|XP_006851849.1|  hypothetical protein AMTR_s00041p00085460          111   7e-25   
dbj|BAE45635.1|  photolyase                                             110   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EMS58863.1|  Deoxyribodipyrimidine photo-lyase                       109   1e-24   Triticum urartu
dbj|BAK03208.1|  predicted protein                                      110   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF85532.1|  unknown                                                 106   2e-23   Zea mays [maize]
ref|NP_001130580.1|  type II CPD DNA photolyase                         106   3e-23   Zea mays [maize]
gb|ACG43030.1|  hypothetical protein                                    105   4e-23   Zea mays [maize]
ref|XP_004983328.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...    104   2e-22   Setaria italica
ref|XP_002972041.1|  hypothetical protein SELMODRAFT_96351              101   2e-21   
ref|XP_002972587.1|  hypothetical protein SELMODRAFT_97206              101   2e-21   Selaginella moellendorffii
gb|AAQ18175.1|  type II CPD DNA photolyase                              100   7e-21   Pityrogramma austroamericana
ref|XP_001764990.1|  PHR1 AtPHR1-like type 2 CPD DNA photolyase       96.3    2e-19   
ref|XP_002489250.1|  hypothetical protein SORBIDRAFT_0012s014620      90.9    4e-17   
gb|AAT39131.1|  type II CPD DNA photolyase                            84.0    6e-17   Zea mays [maize]
dbj|BAO57737.1|  cyclobutane pyrimidine dimer photolyase              89.0    9e-17   Marchantia polymorpha
ref|XP_005650117.1|  CPD photolyase                                   83.2    5e-15   Coccomyxa subellipsoidea C-169
gb|AAT39132.1|  type II CPD DNA photolyase                            78.6    6e-15   Picea glauca
emb|CAF97542.1|  unnamed protein product                              83.2    6e-15   Tetraodon nigroviridis
ref|XP_005851091.1|  CPD photolyase                                   82.4    8e-15   Chlorella variabilis
gb|KGB42392.1|  Deoxyribodipyrimidine photo-lyase                     77.8    9e-15   Schistosoma haematobium
gb|ADE60791.1|  CPD photolyase                                        78.2    4e-14   Trichoplusia ni
gb|ADE60793.1|  CPD photolyase                                        78.2    4e-14   Chrysodeixis chalcites
gb|KFM75819.1|  Deoxyribodipyrimidine photo-lyase                     78.6    4e-14   Stegodyphus mimosarum
ref|XP_005763851.1|  hypothetical protein EMIHUDRAFT_67418            80.1    7e-14   Emiliania huxleyi CCMP1516
ref|XP_009060728.1|  hypothetical protein LOTGIDRAFT_125833           80.1    7e-14   Lottia gigantea
ref|XP_002507183.1|  predicted protein                                80.1    8e-14   Micromonas commoda
ref|XP_003082644.1|  class II DNA photolyase (ISS)                    79.7    8e-14   Ostreococcus tauri
gb|EHJ68626.1|  DNA photolyase                                        79.7    8e-14   
ref|WP_035274114.1|  deoxyribodipyrimidine photolyase                 79.3    9e-14   
sp|P34205.1|PHR_CARAU  RecName: Full=Deoxyribodipyrimidine photo-...  79.7    1e-13   Carassius auratus
ref|XP_001845657.1|  deoxyribodipyrimidine photo-lyase                79.3    1e-13   Culex quinquefasciatus
ref|XP_003227011.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   Anolis carolinensis [Carolina anole]
gb|AAD39433.1|AF129458_1  class II DNA photolyase                     79.3    2e-13   Chlamydomonas reinhardtii
ref|XP_008211914.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  78.6    2e-13   Nasonia vitripennis
ref|XP_008211911.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   Nasonia vitripennis
ref|XP_008211912.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   Nasonia vitripennis
ref|XP_010732065.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   
ref|XP_008211910.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   Nasonia vitripennis
ref|XP_001603285.2|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   Nasonia vitripennis
ref|XP_007511873.1|  CPD photolyase                                   79.0    2e-13   Bathycoccus prasinos
ref|XP_008211913.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   Nasonia vitripennis
ref|XP_003975844.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  79.0    2e-13   
ref|WP_014559387.1|  deoxyribodipyrimidine photo-lyase                78.6    2e-13   Ignavibacterium album
ref|WP_043793639.1|  deoxyribodipyrimidine photolyase                 78.2    2e-13   
ref|NP_001089127.1|  CPD photolyase-like                              79.0    2e-13   Xenopus laevis [clawed frog]
gb|EFL52891.1|  deoxyribodipyrimidine photolyase                      78.2    2e-13   Desulfovibrio fructosivorans JJ
ref|XP_008283888.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  78.6    2e-13   Stegastes partitus
gb|ADZ46042.1|  CPD photolyase                                        75.9    2e-13   Dunaliella tertiolecta
ref|XP_002953304.1|  class II photolyase                              79.0    2e-13   Volvox carteri f. nagariensis
dbj|BAE48230.1|  CPD photolyase                                       78.2    2e-13   Auxenochlorella pyrenoidosa
ref|XP_007441920.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.8    2e-13   
emb|CAX73098.1|  photorepair                                          78.2    3e-13   Schistosoma japonicum
ref|XP_008431493.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  78.2    3e-13   Poecilia reticulata
ref|XP_002502908.1|  DNA photolyase                                   78.2    3e-13   Micromonas commoda
emb|CCD58864.1|  DNA photolyase, putative                             78.2    3e-13   Schistosoma mansoni
gb|KIY94077.1|  deoxyribodipyrimidine photo-lyase                     76.6    3e-13   Monoraphidium neglectum
ref|XP_003390970.2|  PREDICTED: deoxyribodipyrimidine photo-lyase...  76.6    3e-13   Amphimedon queenslandica
ref|XP_004930027.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.8    3e-13   
ref|XP_005939131.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  78.2    3e-13   Haplochromis burtoni
gb|AIE57497.1|  CPD photolyase                                        77.8    4e-13   Platynereis dumerilii
ref|XP_011484602.1|  PREDICTED: photolyase isoform X2                 77.8    4e-13   Oryzias latipes [Japanese rice fish]
ref|XP_005939133.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.8    4e-13   Haplochromis burtoni
ref|NP_001098271.1|  photolyase                                       77.8    4e-13   Oryzias latipes [Japanese rice fish]
ref|XP_011484603.1|  PREDICTED: photolyase isoform X3                 77.8    4e-13   Oryzias latipes [Japanese rice fish]
emb|CDQ80029.1|  unnamed protein product                              77.4    4e-13   Oncorhynchus mykiss
ref|XP_005939132.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.8    4e-13   Haplochromis burtoni
ref|XP_011484604.1|  PREDICTED: photolyase isoform X1                 77.8    4e-13   Oryzias latipes [Japanese rice fish]
emb|CDI97220.1|  deoxyribodipyrimidine photo lyase                    77.4    5e-13   Echinococcus multilocularis
ref|XP_004570537.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.4    5e-13   Maylandia zebra
ref|XP_005752546.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.4    5e-13   Pundamilia nyererei
ref|XP_010781206.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.4    5e-13   Notothenia coriiceps [yellowbelly rockcod]
gb|EUB56980.1|  Deoxyribodipyrimidine photo-lyase                     77.8    5e-13   Echinococcus granulosus
ref|XP_007555082.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.8    5e-13   Poecilia formosa
ref|XP_010781205.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.4    5e-13   Notothenia coriiceps [yellowbelly rockcod]
emb|CDS21501.1|  deoxyribodipyrimidine photo lyase                    77.4    5e-13   Echinococcus granulosus
gb|ELT97477.1|  hypothetical protein CAPTEDRAFT_152478                77.4    5e-13   Capitella teleta
ref|WP_015850844.1|  deoxyribodipyrimidine photo-lyase                77.0    6e-13   Desulfovibrio salexigens
ref|XP_003438096.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.0    6e-13   Oreochromis niloticus
ref|XP_002190613.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.4    6e-13   
ref|NP_957358.1|  uncharacterized protein LOC394039                   77.0    7e-13   Danio rerio [leopard danio]
ref|XP_003390874.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  76.6    7e-13   
ref|XP_005168472.1|  PREDICTED: uncharacterized protein LOC394039...  77.0    7e-13   Danio rerio [leopard danio]
ref|XP_005802444.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.0    7e-13   Xiphophorus maculatus
ref|XP_005476033.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  77.0    7e-13   Oreochromis niloticus
ref|XP_005168471.1|  PREDICTED: uncharacterized protein LOC394039...  77.0    7e-13   Danio rerio [leopard danio]
ref|XP_003078467.1|  class II DNA photolyase (ISS)                    75.1    7e-13   
ref|XP_004347271.1|  deoxyribodipyrimidine photo-lyase                77.0    8e-13   Capsaspora owczarzaki ATCC 30864
ref|XP_003388746.2|  PREDICTED: deoxyribodipyrimidine photo-lyase...  76.6    8e-13   Amphimedon queenslandica
gb|AGH70335.1|  CPD photolyase                                        77.0    8e-13   Chlamydomonas sp. ICE-L
ref|WP_014856093.1|  deoxyribodipyrimidine photo-lyase                76.3    9e-13   Melioribacter roseus
ref|XP_003726308.1|  PREDICTED: LOW QUALITY PROTEIN: deoxyribodip...  76.6    1e-12   
ref|XP_005093310.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  76.6    1e-12   
gb|KFR06048.1|  Deoxyribodipyrimidine photo-lyase                     75.5    1e-12   Opisthocomus hoazin [hoatzin]
emb|CDS28155.1|  deoxyribodipyrimidine photo lyase                    76.3    1e-12   Hymenolepis microstoma
gb|KFB48037.1|  hypothetical protein ZHAS_00016157                    76.3    1e-12   Anopheles sinensis
ref|WP_013718172.1|  deoxyribodipyrimidine photo-lyase                75.9    1e-12   Methanothrix soehngenii
ref|XP_001620432.1|  hypothetical protein NEMVEDRAFT_v1g223118        75.1    1e-12   Nematostella vectensis
ref|XP_009929546.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  75.9    2e-12   Opisthocomus hoazin [hoatzin]
gb|AHA91712.1|  cpd photolyase                                        73.9    2e-12   Astyanax mexicanus [blind cave fish]
ref|WP_033192140.1|  deoxyribodipyrimidine photolyase                 75.5    2e-12   Fervidobacterium islandicum
gb|AHA91711.1|  cpd photolyase                                        73.9    2e-12   Astyanax mexicanus [blind cave fish]
ref|XP_010794949.1|  PREDICTED: LOW QUALITY PROTEIN: deoxyribodip...  73.2    2e-12   Notothenia coriiceps [yellowbelly rockcod]
dbj|GAA56147.1|  deoxyribodipyrimidine photo-lyase                    76.3    2e-12   Clonorchis sinensis [oriental liver fluke]
emb|CEF97357.1|  DNA photolyase, class 2                              75.5    2e-12   Ostreococcus tauri
gb|ETN58118.1|  deoxyribodipyrimidine photo-lyase                     75.5    2e-12   Anopheles darlingi [American malaria mosquito]
ref|XP_001636254.1|  predicted protein                                74.7    3e-12   Nematostella vectensis
ref|WP_025305602.1|  deoxyribodipyrimidine photolyase                 74.7    3e-12   Thermocrinis ruber
ref|XP_010900290.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  75.1    3e-12   Esox lucius
ref|XP_001420955.1|  predicted protein                                74.7    4e-12   Ostreococcus lucimarinus CCE9901
ref|XP_009680452.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  74.7    4e-12   Struthio camelus australis
ref|XP_009177023.1|  hypothetical protein T265_11930                  74.7    4e-12   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|NP_039121.1|  Photolyase                                          74.3    5e-12   Fowlpox virus
ref|WP_014452083.1|  deoxyribodipyrimidine photo-lyase                74.3    5e-12   Fervidobacterium pennivorans
ref|XP_009680451.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  74.3    5e-12   Struthio camelus australis
gb|KFQ33489.1|  Deoxyribodipyrimidine photo-lyase                     73.9    5e-12   Merops nubicus
gb|KFQ08100.1|  Deoxyribodipyrimidine photo-lyase                     73.9    5e-12   Leptosomus discolor
gb|KFV85047.1|  Deoxyribodipyrimidine photo-lyase                     73.9    5e-12   Struthio camelus australis
ref|XP_009946273.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.9    5e-12   Leptosomus discolor
gb|KFP42943.1|  Deoxyribodipyrimidine photo-lyase                     73.9    5e-12   Chlamydotis macqueenii
gb|KFV09905.1|  Deoxyribodipyrimidine photo-lyase                     73.6    5e-12   Pterocles gutturalis
ref|XP_010120777.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.9    6e-12   Chlamydotis macqueenii
ref|WP_023405803.1|  hypothetical protein                             73.9    6e-12   
gb|KFW81474.1|  Deoxyribodipyrimidine photo-lyase                     73.9    6e-12   Manacus vitellinus
ref|XP_008942592.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.9    6e-12   Merops nubicus
ref|XP_008922818.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  74.3    6e-12   
ref|XP_010075306.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.9    6e-12   Pterocles gutturalis
gb|ACO51512.1|  photolyase                                            73.2    7e-12   Mesocentrotus franciscanus
ref|XP_005142392.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  74.7    7e-12   Melopsittacus undulatus
gb|KFQ47505.1|  Deoxyribodipyrimidine photo-lyase                     72.8    7e-12   Pelecanus crispus
ref|XP_006022489.1|  PREDICTED: LOW QUALITY PROTEIN: deoxyribodip...  73.9    7e-12   
ref|XP_313925.3|  AGAP005052-PA                                       73.9    7e-12   Anopheles gambiae str. PEST
ref|XP_001653955.1|  AAEL001787-PA                                    73.9    8e-12   Aedes aegypti
ref|XP_006264229.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.9    9e-12   
ref|XP_008331859.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.9    9e-12   
ref|WP_028895847.1|  deoxyribodipyrimidine photolyase                 73.6    9e-12   Syntrophorhabdus aromaticivorans
gb|KFQ30198.1|  Deoxyribodipyrimidine photo-lyase                     73.2    1e-11   Mesitornis unicolor
ref|XP_008171965.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.6    1e-11   Chrysemys picta bellii
gb|ACG63558.1|  DNA photolyase II                                     71.2    1e-11   Pseudoplusia includens nucleopolyhedrovirus
ref|XP_009083471.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.2    1e-11   Acanthisitta chloris
gb|KFP74647.1|  Deoxyribodipyrimidine photo-lyase                     73.2    1e-11   Acanthisitta chloris
gb|KFV57896.1|  Deoxyribodipyrimidine photo-lyase                     72.8    1e-11   Tyto alba [Schleiereule]
gb|ACD01432.1|  DNA photolyase                                        70.9    1e-11   Thysanoplusia orichalcea nucleopolyhedrovirus
ref|XP_009805516.1|  PREDICTED: LOW QUALITY PROTEIN: deoxyribodip...  72.4    1e-11   Gavia stellata
ref|WP_013049221.1|  deoxyribodipyrimidine photo-lyase                73.2    1e-11   Aminobacterium colombiense
ref|XP_009491311.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    1e-11   Pelecanus crispus
ref|XP_010177056.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.2    1e-11   Mesitornis unicolor
ref|WP_034621121.1|  deoxyribodipyrimidine photolyase                 73.2    1e-11   Desulfovermiculus halophilus
ref|XP_010210371.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.2    1e-11   Tinamus guttatus
gb|KGL75518.1|  Deoxyribodipyrimidine photo-lyase                     72.8    1e-11   Tinamus guttatus
ref|WP_013513037.1|  deoxyribodipyrimidine photo-lyase                72.8    1e-11   Pseudodesulfovibrio aespoeensis
ref|YP_009046386.1|  photolyase                                       72.8    1e-11   Pigeonpox virus
ref|XP_005525231.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  73.2    1e-11   
ref|XP_005484958.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    1e-11   Zonotrichia albicollis
gb|KFZ50447.1|  Deoxyribodipyrimidine photo-lyase                     72.8    1e-11   Antrostomus carolinensis
ref|XP_009087372.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    2e-11   
ref|XP_005419165.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    2e-11   Geospiza fortis
ref|XP_009970528.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Tyto alba [Schleiereule]
ref|XP_001949151.1|  PREDICTED: deoxyribodipyrimidine photo-lyase     72.8    2e-11   Acyrthosiphon pisum
gb|KFW08398.1|  Deoxyribodipyrimidine photo-lyase                     72.4    2e-11   Fulmarus glacialis
ref|XP_009513296.1|  PREDICTED: LOW QUALITY PROTEIN: deoxyribodip...  72.4    2e-11   Phalacrocorax carbo [common cormorant]
ref|XP_010166885.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    2e-11   
sp|Q28811.1|PHR_POTTR  RecName: Full=Deoxyribodipyrimidine photo-...  72.8    2e-11   Potorous tridactylus [long-nosed rat kangaroo]
ref|XP_010306667.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Balearica regulorum gibbericeps
ref|XP_001417095.1|  predicted protein                                72.8    2e-11   Ostreococcus lucimarinus CCE9901
ref|WP_029552168.1|  deoxyribodipyrimidine photolyase                 72.4    2e-11   Thermocrinis sp. GBS
gb|KFW12078.1|  Deoxyribodipyrimidine photo-lyase                     72.4    2e-11   Eurypyga helias
gb|KFQ69809.1|  Deoxyribodipyrimidine photo-lyase                     72.4    2e-11   Phaethon lepturus
ref|NP_048306.1|  ORF MSV235 putative CPD photolyase, similar to ...  72.4    2e-11   Melanoplus sanguinipes entomopoxvirus
ref|XP_009998675.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    2e-11   Chaetura pelagica
ref|XP_005051202.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    2e-11   
ref|WP_031480322.1|  deoxyribodipyrimidine photolyase                 72.4    2e-11   Desulfovibrio frigidus
gb|KFP58169.1|  Deoxyribodipyrimidine photo-lyase                     72.4    2e-11   Cathartes aura
ref|XP_003763719.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.8    2e-11   Sarcophilus harrisii
gb|KFU84257.1|  Deoxyribodipyrimidine photo-lyase                     72.4    2e-11   Chaetura pelagica
ref|NP_955229.1|  CNPV206 putative photolyase                         72.4    2e-11   Canarypox virus
gb|KFQ05356.1|  Deoxyribodipyrimidine photo-lyase                     72.4    2e-11   Haliaeetus albicilla
ref|XP_010292047.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Phaethon lepturus
ref|WP_034609492.1|  deoxyribodipyrimidine photolyase                 72.4    2e-11   Desulfovibrio aminophilus
gb|KFR00584.1|  Deoxyribodipyrimidine photo-lyase                     72.0    2e-11   Nipponia nippon
ref|NP_001028149.1|  DNA photolyase                                   72.4    2e-11   Monodelphis domestica
ref|XP_009579959.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Fulmarus glacialis
gb|KFP63074.1|  Deoxyribodipyrimidine photo-lyase                     72.0    2e-11   Cariama cristata
gb|KFP13269.1|  Deoxyribodipyrimidine photo-lyase                     72.0    2e-11   Egretta garzetta
ref|XP_010157260.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Eurypyga helias
ref|XP_005443744.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Falco cherrug
ref|XP_005237868.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Falco peregrinus [peregrine]
ref|XP_009867267.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Apaloderma vittatum
ref|XP_009918891.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.0    2e-11   Haliaeetus albicilla
ref|XP_009466780.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Nipponia nippon
ref|YP_009046150.1|  photolyase                                       72.0    2e-11   Penguinpox virus
ref|XP_010571412.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Haliaeetus leucocephalus
ref|XP_009633927.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.4    2e-11   Egretta garzetta
gb|EMC79236.1|  Deoxyribodipyrimidine photo-lyase                     72.0    3e-11   
gb|KFZ69140.1|  Deoxyribodipyrimidine photo-lyase                     72.0    3e-11   
ref|XP_009694516.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.0    3e-11   
ref|WP_029735852.1|  deoxyribodipyrimidine photolyase                 72.0    3e-11   
ref|WP_029234120.1|  deoxyribodipyrimidine photolyase                 72.0    3e-11   
ref|WP_015419438.1|  MULTISPECIES: DNA photolyase FAD-binding pro...  72.0    3e-11   
ref|XP_004994459.1|  DNA photolyase                                   72.0    3e-11   
ref|WP_029230393.1|  deoxyribodipyrimidine photolyase                 72.0    3e-11   
ref|XP_005513288.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.0    3e-11   
ref|WP_034406022.1|  deoxyribodipyrimidine photolyase                 72.0    3e-11   
gb|KFV06630.1|  Deoxyribodipyrimidine photo-lyase                     71.6    3e-11   
gb|KFV69614.1|  Deoxyribodipyrimidine photo-lyase                     71.6    3e-11   
ref|XP_001458001.1|  hypothetical protein                             71.6    3e-11   
ref|XP_009901881.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.0    3e-11   
ref|XP_009990258.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  72.0    3e-11   
gb|KFO54884.1|  Deoxyribodipyrimidine photo-lyase                     71.6    4e-11   
ref|WP_028572456.1|  deoxyribodipyrimidine photolyase                 71.6    4e-11   
gb|KFQ44393.1|  Deoxyribodipyrimidine photo-lyase                     71.6    4e-11   
ref|XP_010013708.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  71.6    4e-11   
emb|CCD76100.1|  putative DNA photolyase                              71.6    4e-11   
ref|XP_008642835.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  71.6    4e-11   
ref|WP_029667133.1|  deoxyribodipyrimidine photolyase                 71.6    4e-11   
ref|XP_010395517.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  71.6    4e-11   
gb|ADW19466.1|  Deoxyribodipyrimidine photo-lyase type II             71.6    4e-11   
gb|EKC26192.1|  Deoxyribodipyrimidine photo-lyase                     71.6    4e-11   
ref|WP_034632519.1|  deoxyribodipyrimidine photolyase                 71.2    4e-11   
ref|WP_020001050.1|  MULTISPECIES: hypothetical protein               71.2    4e-11   
ref|WP_043771684.1|  deoxyribodipyrimidine photolyase                 71.2    4e-11   
ref|WP_019553819.1|  hypothetical protein                             71.2    5e-11   
ref|XP_011422754.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  71.6    5e-11   
gb|KFO79451.1|  Deoxyribodipyrimidine photo-lyase                     70.9    5e-11   
ref|XP_009563639.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  71.2    5e-11   
gb|KGL91954.1|  Deoxyribodipyrimidine photo-lyase                     70.9    6e-11   
ref|XP_005833658.1|  hypothetical protein GUITHDRAFT_162898           71.2    6e-11   
ref|XP_009881711.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  71.2    6e-11   
ref|XP_422729.1|  PREDICTED: deoxyribodipyrimidine photo-lyase-like   70.9    6e-11   
ref|XP_003209191.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  70.9    7e-11   
gb|KFP00512.1|  Deoxyribodipyrimidine photo-lyase                     70.5    7e-11   
ref|XP_011395960.1|  Deoxyribodipyrimidine photo-lyase                70.5    7e-11   
ref|XP_008491636.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  70.9    8e-11   
gb|AAT39133.1|  type II CPD DNA photolyase                            66.6    8e-11   
ref|WP_007546640.1|  deoxyribodipyrimidine photolyase                 70.5    9e-11   
ref|WP_006918596.1|  photolyase PhrII                                 70.5    9e-11   
ref|WP_020881360.1|  DNA photolyase FAD-binding protein               70.5    9e-11   
ref|XP_002586934.1|  hypothetical protein BRAFLDRAFT_103595           70.1    1e-10   
ref|XP_002502150.1|  predicted protein                                70.5    1e-10   
ref|WP_011305560.1|  deoxyribodipyrimidine photo-lyase                70.1    1e-10   
ref|XP_001746666.1|  hypothetical protein                             70.9    1e-10   
gb|KFW66786.1|  Deoxyribodipyrimidine photo-lyase                     70.1    1e-10   
ref|XP_009280715.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  70.5    1e-10   
gb|KFM09610.1|  Deoxyribodipyrimidine photo-lyase                     70.1    1e-10   
ref|XP_003061022.1|  predicted protein                                70.1    1e-10   
ref|WP_028587473.1|  deoxyribodipyrimidine photolyase                 70.1    1e-10   
ref|XP_009321872.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  70.1    1e-10   
ref|WP_029482856.1|  deoxyribodipyrimidine photolyase                 70.1    1e-10   
ref|XP_009162804.1|  hypothetical protein T265_00691                  70.9    1e-10   
gb|AAU11091.1|  class-II photolyase                                   70.1    1e-10   
gb|ABK76277.1|  CPD photolyase                                        70.1    2e-10   
ref|WP_027189345.1|  hypothetical protein                             69.7    2e-10   
ref|WP_043634995.1|  deoxyribodipyrimidine photolyase                 69.7    2e-10   
gb|AGW13069.1|  putative deoxyribodipyrimidine photo-lyase            69.7    2e-10   
ref|WP_009107456.1|  deoxyribodipyrimidine photo-lyase                69.7    2e-10   
ref|WP_034607811.1|  deoxyribodipyrimidine photolyase                 69.7    2e-10   
ref|WP_026299157.1|  deoxyribodipyrimidine photolyase                 69.7    2e-10   
ref|WP_011745780.1|  deoxyribodipyrimidine photo-lyase                69.3    2e-10   
ref|XP_003489031.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  69.3    2e-10   
ref|XP_003489032.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  69.3    2e-10   
ref|WP_012459437.1|  deoxyribodipyrimidine photolyase                 68.9    3e-10   
ref|WP_028262718.1|  deoxyribodipyrimidine photolyase                 68.9    3e-10   
ref|WP_006365164.1|  deoxyribodipyrimidine photo-lyase                68.9    3e-10   
ref|WP_010932198.1|  deoxyribodipyrimidine photo-lyase                68.9    3e-10   
gb|KFP34405.1|  Deoxyribodipyrimidine photo-lyase                     68.6    3e-10   
ref|WP_029665713.1|  deoxyribodipyrimidine photolyase                 68.9    3e-10   
ref|XP_011296371.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.9    3e-10   
ref|XP_003398094.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.9    3e-10   
ref|XP_005177055.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.9    3e-10   
ref|XP_003398095.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.9    3e-10   
ref|WP_012502616.1|  deoxyribodipyrimidine photo-lyase                68.6    3e-10   
ref|WP_027186123.1|  deoxyribodipyrimidine photolyase                 68.6    3e-10   
ref|XP_011505805.1|  PREDICTED: deoxyribodipyrimidine photo-lyase     68.9    3e-10   
ref|XP_010206798.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.6    3e-10   
gb|EJK50169.1|  hypothetical protein THAOC_30888                      68.9    4e-10   
ref|XP_008555956.1|  PREDICTED: deoxyribodipyrimidine photo-lyase     68.6    4e-10   
ref|XP_004341122.1|  type II CPD DNA photolyase                       68.9    4e-10   
ref|WP_031386534.1|  deoxyribodipyrimidine photolyase                 68.6    4e-10   
ref|XP_011207519.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.6    4e-10   
ref|XP_003698524.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.6    4e-10   
ref|XP_006564509.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.2    5e-10   
ref|XP_006564510.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.2    5e-10   
ref|XP_006619211.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  68.2    5e-10   
dbj|GAN34930.1|  deoxyribodipyrimidine photolyase                     67.8    5e-10   
ref|WP_028840701.1|  deoxyribodipyrimidine photolyase                 68.2    5e-10   
ref|WP_013010334.1|  deoxyribodipyrimidine photo-lyase                68.2    5e-10   
ref|WP_041284371.1|  deoxyribodipyrimidine photolyase                 67.8    6e-10   
gb|AEB09417.1|  deoxyribodipyrimidine photolyase                      67.8    6e-10   
ref|WP_008870866.1|  deoxyribodipyrimidine photo-lyase                67.8    7e-10   
emb|CDJ27030.1|  DNA photolyase, putative                             67.8    8e-10   
ref|WP_039648359.1|  deoxyribodipyrimidine photolyase                 67.4    8e-10   
ref|XP_011190791.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  67.8    8e-10   
ref|WP_041425327.1|  hypothetical protein                             67.4    9e-10   
ref|XP_002089533.1|  GE19152                                          67.8    9e-10   
gb|ACZ43581.1|  Deoxyribodipyrimidine photo-lyase                     67.4    9e-10   
ref|XP_004535731.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  67.4    1e-09   
ref|WP_012750130.1|  deoxyribodipyrimidine photo-lyase                67.4    1e-09   
gb|AHC15834.1|  Deoxyribodipyrimidine photolyase, type II             67.4    1e-09   
emb|CDO63016.1|  deoxyribodipyrimidine photo-lyase, putative          67.8    1e-09   
ref|WP_041276977.1|  deoxyribodipyrimidine photolyase                 67.0    1e-09   
ref|WP_041402946.1|  hypothetical protein                             67.4    1e-09   
ref|XP_001986318.1|  GH21292                                          67.4    1e-09   
gb|KGB33413.1|  Deoxyribodipyrimidine photo-lyase                     67.4    1e-09   
ref|XP_002773871.1|  Deoxyribodipyrimidine photo-lyase, putative      67.0    1e-09   
gb|ABB36980.1|  deoxyribodipyrimidine photolyase                      67.0    1e-09   
ref|WP_027182542.1|  deoxyribodipyrimidine photolyase                 67.0    1e-09   
ref|YP_006607781.1|  DNA photolyase 2                                 66.6    1e-09   
emb|CBN78764.1|  conserved unknown protein                            67.0    1e-09   
ref|XP_002059363.1|  GJ17708                                          67.0    1e-09   
ref|WP_013563604.1|  DNA photolyase FAD-binding protein               67.0    1e-09   
gb|AIU41370.1|  dna photolyase                                        67.0    1e-09   
ref|WP_034404139.1|  deoxyribodipyrimidine photolyase                 66.6    1e-09   
ref|XP_003706826.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  66.6    1e-09   
ref|WP_014586684.1|  deoxyribodipyrimidine photo-lyase                66.6    2e-09   
ref|WP_027721663.1|  deoxyribodipyrimidine photolyase                 66.6    2e-09   
emb|CDJ68615.1|  DNA photolyase, putative                             66.6    2e-09   
dbj|GAA29131.2|  deoxyribodipyrimidine photo-lyase                    66.6    2e-09   
gb|EWM29541.1|  deoxyribodipyrimidine photo-lyase                     66.2    2e-09   
emb|CDJ37039.1|  DNA photolyase, putative                             66.6    2e-09   
ref|WP_011361909.1|  deoxyribodipyrimidine photo-lyase                66.2    2e-09   
gb|ACE03719.1|  deoxyribodipyrimidine photolyase                      66.2    2e-09   
ref|WP_041471512.1|  deoxyribodipyrimidine photolyase                 66.2    2e-09   
gb|ADE60792.1|  CPD photolyase                                        63.5    2e-09   
ref|WP_024333953.1|  deoxyribodipyrimidine photolyase                 66.2    2e-09   
ref|XP_011311461.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  66.2    2e-09   
ref|WP_011023958.1|  deoxyribodipyrimidine photo-lyase                66.2    2e-09   
ref|WP_010943456.1|  deoxyribodipyrimidine photo-lyase                66.2    2e-09   
ref|WP_009181253.1|  deoxyribodipyrimidine photo-lyase                66.2    2e-09   
ref|WP_006965999.1|  deoxyribodipyrimidine photo-lyase Phr            66.2    2e-09   
ref|WP_035247980.1|  deoxyribodipyrimidine photolyase                 65.9    3e-09   
ref|XP_011311459.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  66.2    3e-09   
ref|XP_002004196.1|  GI19782                                          66.2    3e-09   
emb|CDI78435.1|  DNA photolyase, putative                             65.9    3e-09   
ref|XP_008815107.1|  deoxyribodipyrimidine photo-lyase                66.2    3e-09   
ref|XP_011190789.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  65.9    3e-09   
ref|WP_026245011.1|  deoxyribodipyrimidine photolyase                 65.9    3e-09   
ref|XP_001351693.1|  deoxyribodipyrimidine photolyase (photoreact...  66.2    3e-09   
ref|XP_006637912.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  65.9    3e-09   
gb|ETW31873.1|  ribosome biogenesis GTP-binding protein YsxC          66.2    4e-09   
ref|XP_002063542.1|  GK19412                                          65.5    4e-09   
gb|EFX71237.1|  DNA photolyase 2                                      65.5    4e-09   
gb|ACD01434.1|  DNA photolyase II                                     63.9    4e-09   
ref|WP_041278776.1|  deoxyribodipyrimidine photolyase                 65.1    4e-09   
emb|CDJ59149.1|  DNA photolyase, putative                             65.5    5e-09   
emb|CAG37305.1|  probable DNA photolyase                              65.1    5e-09   
gb|EWC78186.1|  hypothetical protein C923_01122                       65.9    5e-09   
ref|WP_002618474.1|  deoxyribodipyrimidine photo-lyase                65.1    5e-09   
ref|WP_024823441.1|  deoxyribodipyrimidine photolyase                 65.1    5e-09   
ref|WP_028574519.1|  deoxyribodipyrimidine photolyase                 65.1    5e-09   
ref|WP_005985611.1|  Deoxyribodipyrimidine photo-lyase type II        65.1    5e-09   
ref|XP_001960977.1|  GF13637                                          65.1    5e-09   
gb|AAB32328.1|  photorepair gene                                      65.1    5e-09   
ref|XP_002259677.1|  deoxyribodipyrimidine photolyase (photoreact...  65.5    6e-09   
ref|WP_011563651.1|  deoxyribodipyrimidine photo-lyase                65.1    6e-09   
ref|WP_012635445.1|  deoxyribodipyrimidine photo-lyase                65.1    6e-09   
ref|NP_724613.1|  photorepair, isoform B                              65.1    6e-09   
ref|XP_002032814.1|  GM20985                                          65.1    6e-09   
ref|WP_015415722.1|  Deoxyribodipyrimidine photo-lyase                64.7    6e-09   
gb|ETW63070.1|  hypothetical protein PFMC_01052                       65.5    6e-09   
dbj|BAA05042.1|  photolyase                                           65.1    6e-09   
ref|WP_027461422.1|  deoxyribodipyrimidine photolyase                 64.7    6e-09   
ref|NP_523653.2|  photorepair, isoform A                              65.1    6e-09   
ref|XP_002080494.1|  GD10512                                          65.1    6e-09   
gb|AFD24534.1|  Deoxyribodipyrimidine photo-lyase type II             64.3    7e-09   
ref|WP_023050081.1|  hypothetical protein                             64.7    7e-09   
ref|XP_004535970.1|  PREDICTED: deoxyribodipyrimidine photo-lyase...  64.7    8e-09   
ref|XP_001970566.1|  GG23307                                          64.7    8e-09   
gb|AGU99810.1|  m127L                                                 64.7    8e-09   
ref|XP_001417753.1|  predicted protein                                64.7    8e-09   
gb|ACB32172.1|  DNA photolyase                                        64.7    8e-09   
ref|WP_043800811.1|  deoxyribodipyrimidine photolyase                 64.3    9e-09   
gb|ACV68609.1|  deoxyribodipyrimidine photolyase                      64.3    1e-08   
ref|WP_027367426.1|  deoxyribodipyrimidine photolyase                 64.3    1e-08   
ref|WP_041282419.1|  deoxyribodipyrimidine photolyase                 64.3    1e-08   
ref|WP_014259973.1|  deoxyribodipyrimidine photo-lyase                64.3    1e-08   
ref|WP_041532722.1|  deoxyribodipyrimidine photolyase                 63.9    1e-08   
gb|ABK99620.1|  Deoxyribodipyrimidine photo-lyase type II             63.9    1e-08   
ref|WP_043411938.1|  deoxyribodipyrimidine photolyase                 63.9    1e-08   
ref|XP_003881384.1|  hypothetical protein NCLIV_044160                64.3    1e-08   
gb|EFQ24730.1|  Deoxyribodipyrimidine photo-lyase type II             63.9    1e-08   
ref|XP_002291031.1|  predicted protein                                63.9    1e-08   
gb|AGE61333.1|  DNA photolyase 2                                      63.9    2e-08   
ref|WP_040346244.1|  deoxyribodipyrimidine photolyase                 63.5    2e-08   
ref|YP_249676.1|  DNA photolyase 2                                    63.5    2e-08   
gb|AGC36286.1|  DNA photolyase 2                                      63.5    2e-08   
ref|WP_011889825.1|  deoxyribodipyrimidine photo-lyase                63.5    2e-08   
gb|ETW20137.1|  hypothetical protein PFFVO_01038                      63.5    2e-08   
ref|WP_018702596.1|  hypothetical protein                             63.5    2e-08   
gb|EQB61210.1|  deoxyribodipyrimidine photolyase                      63.5    2e-08   
ref|WP_034326391.1|  deoxyribodipyrimidine photolyase                 63.5    2e-08   
ref|XP_002017941.1|  GL17032                                          63.5    2e-08   
gb|AFU77559.1|  m127L                                                 63.5    2e-08   
ref|XP_001361001.2|  GA10839                                          63.5    2e-08   
gb|AGW25920.1|  m127L                                                 63.5    2e-08   
ref|NP_051841.1|  m127L                                               63.2    2e-08   
ref|WP_019879836.1|  hypothetical protein                             63.2    2e-08   
ref|WP_041385322.1|  DNA photolyase                                   63.2    2e-08   
ref|WP_041947697.1|  deoxyribodipyrimidine photolyase                 63.2    2e-08   
ref|YP_008003561.1|  DNA photolyase                                   63.2    2e-08   
gb|ADI14423.1|  DNA photolyase FAD-binding protein                    63.2    2e-08   
ref|NP_052016.1|  gp127L                                              63.2    2e-08   
ref|WP_017873771.1|  hypothetical protein                             63.2    3e-08   
gb|AEV30087.1|  deoxyribodipyrimidine photolyase                      63.2    3e-08   
emb|CDJ46645.1|  DNA photolyase, putative                             62.8    3e-08   
ref|WP_037547193.1|  hypothetical protein                             62.8    3e-08   
ref|WP_027481124.1|  deoxyribodipyrimidine photolyase                 62.8    3e-08   
ref|XP_002783615.1|  Deoxyribodipyrimidine photo-lyase, putative      62.8    3e-08   
ref|XP_002783619.1|  DNA photolyase FAD binding domain, putative      62.8    3e-08   
ref|WP_005659205.1|  deoxyribodipyrimidine photo-lyase                62.8    3e-08   
ref|WP_029478425.1|  deoxyribodipyrimidine photolyase                 62.8    3e-08   
gb|EJW74997.1|  hypothetical protein WUBG_14096                       60.5    3e-08   
ref|WP_028830280.1|  deoxyribodipyrimidine photolyase                 62.8    3e-08   
ref|XP_001613820.1|  deoxyribodipyrimidine photolyase                 63.2    4e-08   
ref|WP_042689905.1|  hypothetical protein                             62.4    4e-08   



>ref|XP_004245703.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X2 [Solanum 
lycopersicum]
Length=488

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAA EVLMGSK GFLTTRLK+YSTDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  225  WCEPGEDAAFEVLMGSKKGFLTTRLKTYSTDRNNPLKPQALSGLSPYLHFGQISAQRCAL  284

Query  471  QAQQIQKSH  445
            +A +++K++
Sbjct  285  EANKVRKNY  293


 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            TQAVDTFLEE+IVRREL+DNFCYYQPQYDSL GAWEWARKTLMEH++DKREH+Y
Sbjct  294  TQAVDTFLEEMIVRRELSDNFCYYQPQYDSLLGAWEWARKTLMEHASDKREHIY  347



>ref|XP_010325452.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X1 [Solanum 
lycopersicum]
Length=492

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAA EVLMGSK GFLTTRLK+YSTDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  225  WCEPGEDAAFEVLMGSKKGFLTTRLKTYSTDRNNPLKPQALSGLSPYLHFGQISAQRCAL  284

Query  471  QAQQIQKSH  445
            +A +++K++
Sbjct  285  EANKVRKNY  293


 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            TQAVDTFLEE+IVRREL+DNFCYYQPQYDSL GAWEWARKTLMEH++DKREH+Y
Sbjct  294  TQAVDTFLEEMIVRRELSDNFCYYQPQYDSLLGAWEWARKTLMEHASDKREHIY  347



>ref|XP_006363727.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Solanum tuberosum]
Length=488

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAA EVLMGSK GFLTTRLK+YSTDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  225  WCEPGEDAAFEVLMGSKKGFLTTRLKTYSTDRNNPLKPQALSGLSPYLHFGQISAQRCAL  284

Query  471  QAQQIQKSH  445
            +A +++K++
Sbjct  285  EANKVRKNY  293


 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            TQAVDTFLEE+IVRREL+DNFCYY+PQYDSL GAWEWARKTLMEH++DKREH+Y
Sbjct  294  TQAVDTFLEEMIVRRELSDNFCYYEPQYDSLLGAWEWARKTLMEHASDKREHIY  347



>emb|CDP09879.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAAMEVLMGSKNGFLT RLK+YS DRNNPLKPKALSGLSPYLHFGQI+AQRC L
Sbjct  232  WCEPGEDAAMEVLMGSKNGFLTARLKNYSMDRNNPLKPKALSGLSPYLHFGQIAAQRCAL  291

Query  471  QAQQIQKSHPK  439
            +A++++   P+
Sbjct  292  EARKVRTLSPQ  302


 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q VDTFLEELIVRRELADNFC+YQP YDSLQGAWEWARKTLM+H++DKREH Y
Sbjct  302  QGVDTFLEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLMDHASDKREHTY  354



>ref|XP_010918316.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X3 [Elaeis 
guineensis]
Length=499

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAAMEVLMGSK+GFLT RLK+Y TDRN+PLKPK LSGLSPYLHFGQISAQRC L
Sbjct  232  WCEPGEDAAMEVLMGSKDGFLTRRLKNYETDRNDPLKPKGLSGLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQKSHPK  439
            +AQ  +KS PK
Sbjct  292  EAQAWRKSCPK  302


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD FLEELIVRRELADNFCYYQP YDSLQGAWEWAR+TLM+HS D+REH+Y
Sbjct  302  KSVDAFLEELIVRRELADNFCYYQPLYDSLQGAWEWARRTLMDHSADEREHLY  354



>ref|XP_009599696.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Nicotiana tomentosiformis]
Length=488

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAA+EVLMGSKNGFLT RLK+YSTDRNNPLKP+ALSGLSPYLHFGQ+SAQRC L
Sbjct  225  WCEPGEDAALEVLMGSKNGFLTVRLKNYSTDRNNPLKPQALSGLSPYLHFGQMSAQRCAL  284

Query  471  QAQQIQK  451
            +A +++K
Sbjct  285  EASKVRK  291


 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            TQAVDTFLEELIVRRELADNFCYYQP+YDSL GAWEWARKTLMEH++DKREH+Y
Sbjct  294  TQAVDTFLEELIVRRELADNFCYYQPRYDSLLGAWEWARKTLMEHASDKREHIY  347



>ref|XP_010918315.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X2 [Elaeis 
guineensis]
Length=505

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAAMEVLMGSK+GFLT RLK+Y TDRN+PLKPK LSGLSPYLHFGQISAQRC L
Sbjct  238  WCEPGEDAAMEVLMGSKDGFLTRRLKNYETDRNDPLKPKGLSGLSPYLHFGQISAQRCAL  297

Query  471  QAQQIQKSHPK  439
            +AQ  +KS PK
Sbjct  298  EAQAWRKSCPK  308


 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEELIVRRELADNFCYYQP YDSLQGAWEWAR+TLM+HS D+REH+Y
Sbjct  307  PKSVDAFLEELIVRRELADNFCYYQPLYDSLQGAWEWARRTLMDHSADEREHLY  360



>ref|XP_010918314.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X1 [Elaeis 
guineensis]
Length=506

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAAMEVLMGSK+GFLT RLK+Y TDRN+PLKPK LSGLSPYLHFGQISAQRC L
Sbjct  239  WCEPGEDAAMEVLMGSKDGFLTRRLKNYETDRNDPLKPKGLSGLSPYLHFGQISAQRCAL  298

Query  471  QAQQIQKSHPK  439
            +AQ  +KS PK
Sbjct  299  EAQAWRKSCPK  309


 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEELIVRRELADNFCYYQP YDSLQGAWEWAR+TLM+HS D+REH+Y
Sbjct  308  PKSVDAFLEELIVRRELADNFCYYQPLYDSLQGAWEWARRTLMDHSADEREHLY  361



>ref|XP_006368713.1| hypothetical protein POPTR_0001s08030g [Populus trichocarpa]
 gb|ERP65282.1| hypothetical protein POPTR_0001s08030g [Populus trichocarpa]
Length=497

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAAMEVLMGSK+GFLT RLK+YSTDRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  234  WCEPGEDAAMEVLMGSKDGFLTQRLKNYSTDRNNPLKPKGLSGLSPYLHFGQISAQRCAL  293

Query  471  QAQQIQKSHPK  439
            +A++++   P+
Sbjct  294  EARKVRNLSPQ  304


 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+ D FLEELIVRRELADNFC+YQP YDS+ GAWEWARKTL +H++DKREH+Y
Sbjct  304  QSADAFLEELIVRRELADNFCFYQPNYDSIHGAWEWARKTLADHASDKREHIY  356



>ref|XP_010276572.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Nelumbo nucifera]
Length=533

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+EVL+GSK+GFL+ RLK+YSTDRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  265  WCEPGENAALEVLLGSKDGFLSNRLKNYSTDRNNPLKPKGLSGLSPYLHFGQISAQRCAL  324

Query  471  QAQQIQKSHPK  439
            +A+ I+K HP+
Sbjct  325  EARSIRKLHPQ  335


 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+VD FLEELIVRRELADNFC+YQP YDSLQGAWEWARKTLM+H+ DKREH+Y
Sbjct  335  QSVDAFLEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLMDHAPDKREHIY  387



>ref|XP_006368714.1| CPD photolyase family protein [Populus trichocarpa]
 gb|ERP65283.1| CPD photolyase family protein [Populus trichocarpa]
Length=503

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAAMEVLMGSK+GFLT RLK+YSTDRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  234  WCEPGEDAAMEVLMGSKDGFLTQRLKNYSTDRNNPLKPKGLSGLSPYLHFGQISAQRCAL  293

Query  471  QAQQIQKSHPK  439
            +A++++   P+
Sbjct  294  EARKVRNLSPQ  304


 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+ D FLEELIVRRELADNFC+YQP YDS+ GAWEWARKTL +H++DKREH+Y
Sbjct  304  QSADAFLEELIVRRELADNFCFYQPNYDSIHGAWEWARKTLADHASDKREHIY  356



>ref|XP_009764740.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Nicotiana sylvestris]
Length=488

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGEDAA+EVLMGSKNGFLT RLK+YST+RNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  225  WCEPGEDAALEVLMGSKNGFLTARLKNYSTERNNPLKPQALSGLSPYLHFGQISAQRCAL  284

Query  471  QAQQIQK  451
            +A +++K
Sbjct  285  EAHKVRK  291


 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            TQAVDTFLEELIVRRELADNFCYYQP+YDSL GAWEWARKTLMEH++DKREH+Y
Sbjct  294  TQAVDTFLEELIVRRELADNFCYYQPRYDSLLGAWEWARKTLMEHASDKREHIY  347



>ref|XP_003611237.1| CPD photolyase [Medicago truncatula]
Length=517

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RL++YSTDRNNP KP ALSGLSPYLHFGQISAQRC L
Sbjct  231  WCEPGEIAAMEVLMGSKNGFLTKRLRNYSTDRNNPCKPTALSGLSPYLHFGQISAQRCAL  290

Query  471  QAQQIQKSHPKVRSK*LFI  415
            +A++++ S+P+V    LF+
Sbjct  291  EARKLRASYPQVCFTMLFM  309


 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AVDTFLEELIVRRELADNFCYYQP YDS+QGAWEWARKTL++H++DKR+HVY
Sbjct  320  AVDTFLEELIVRRELADNFCYYQPHYDSIQGAWEWARKTLLDHASDKRQHVY  371



>emb|CDY31262.1| BnaC08g15570D [Brassica napus]
Length=490

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDAAMEVLMGS++GFLT RL++YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  229  WCVPGEDAAMEVLMGSQDGFLTKRLRNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ ++P+
Sbjct  289  EARKVRSTYPQ  299


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLEGAWEWARKSLMDHASDKREHTY  351



>emb|CAN79335.1| hypothetical protein VITISV_026088 [Vitis vinifera]
Length=514

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GE+AA+E+LMGSKNGFLT RLK+YSTDRNNPLKP ALSGLSPYLHFGQISAQRC L
Sbjct  239  WCESGENAAVEILMGSKNGFLTKRLKNYSTDRNNPLKPGALSGLSPYLHFGQISAQRCAL  298

Query  471  QAQQIQKSHPK  439
            +A++IQK+ P+
Sbjct  299  EAKKIQKNCPQ  309


 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELIVRRELADNFC+YQP+Y+SLQGAWEWARKTLM+H++DKREH+Y
Sbjct  309  QAVDVFLEELIVRRELADNFCFYQPRYNSLQGAWEWARKTLMDHASDKREHIY  361



>ref|XP_011029095.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Populus euphratica]
Length=497

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGEDAAMEVLMGSK+GFLT RLK+YSTDRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  234  WCKPGEDAAMEVLMGSKDGFLTQRLKNYSTDRNNPLKPKGLSGLSPYLHFGQISAQRCAL  293

Query  471  QAQQIQKSHPK  439
            +A++++   P+
Sbjct  294  EARKVRNLSPQ  304


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+ D FLEELIVRRELADNFC+YQP YDS+ GAWEWARKTL  H++DKREH+Y
Sbjct  304  QSADAFLEELIVRRELADNFCFYQPNYDSIHGAWEWARKTLAYHASDKREHIY  356



>gb|KEH27453.1| CPD photolyase [Medicago truncatula]
Length=418

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RL++YSTDRNNP KP ALSGLSPYLHFGQISAQRC L
Sbjct  231  WCEPGEIAAMEVLMGSKNGFLTKRLRNYSTDRNNPCKPTALSGLSPYLHFGQISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A++++ S+P+
Sbjct  291  EARKLRASYPQ  301


 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRRELADNFCYYQP YDS+QGAWEWARKTL++H++DKR+HVY
Sbjct  301  QAVDTFLEELIVRRELADNFCYYQPHYDSIQGAWEWARKTLLDHASDKRQHVY  353



>gb|KFK43499.1| hypothetical protein AALP_AA1G133300 [Arabis alpina]
Length=496

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA MEVLMG K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  229  WCVPGEDAGMEVLMGIKDGFLTKRLKNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ ++P+
Sbjct  289  EARKVRSTYPQ  299


 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  351



>ref|XP_010494107.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Camelina sativa]
Length=494

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA MEVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  227  WCVPGEDAGMEVLMGTKDGFLTKRLKNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  286

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  287  EARKVRTTSPQ  297


 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEE+IVRREL+DNFCYYQP YDSL+GAWEWA+K+LM+H++DKREH+Y
Sbjct  297  QAVDTFLEEMIVRRELSDNFCYYQPHYDSLKGAWEWAQKSLMDHASDKREHIY  349



>gb|KEH27451.1| CPD photolyase [Medicago truncatula]
Length=440

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RL++YSTDRNNP KP ALSGLSPYLHFGQISAQRC L
Sbjct  231  WCEPGEIAAMEVLMGSKNGFLTKRLRNYSTDRNNPCKPTALSGLSPYLHFGQISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A++++ S+P+
Sbjct  291  EARKLRASYPQ  301


 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRRELADNFCYYQP YDS+QGAWEWARKTL++H++DKR+HVY
Sbjct  301  QAVDTFLEELIVRRELADNFCYYQPHYDSIQGAWEWARKTLLDHASDKRQHVY  353



>ref|XP_002509621.1| DNA photolyase, putative [Ricinus communis]
 gb|EEF51008.1| DNA photolyase, putative [Ricinus communis]
Length=489

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDAAMEVLMG+KNGFLT RLK+YSTDRNNPLKP+ LSGLSPYLHFGQISAQRC L
Sbjct  226  WCMPGEDAAMEVLMGTKNGFLTKRLKNYSTDRNNPLKPQGLSGLSPYLHFGQISAQRCAL  285

Query  471  QAQQIQKSHPK  439
            +A++ QK  P+
Sbjct  286  EARKAQKLCPQ  296


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+VD+FLEELIVRRELADNFC+YQP YDSLQGAWEWAR TL++H++DKREH+Y
Sbjct  296  QSVDSFLEELIVRRELADNFCFYQPHYDSLQGAWEWARNTLLDHASDKREHIY  348



>ref|XP_007209950.1| hypothetical protein PRUPE_ppa004792mg [Prunus persica]
 gb|EMJ11149.1| hypothetical protein PRUPE_ppa004792mg [Prunus persica]
Length=491

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RLK YS+DRNNPLKP+ LSGLSPYLHFGQISAQRC L
Sbjct  228  WCEPGEKAAMEVLMGSKNGFLTKRLKGYSSDRNNPLKPRGLSGLSPYLHFGQISAQRCAL  287

Query  471  QAQQIQKSHPK  439
            +A+ I+K  P+
Sbjct  288  EARSIRKLCPE  298


 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +AVD F+EELIVRRELADNFC+YQP YDSLQGAWEWARKTLM+H+ D+REH+Y
Sbjct  298  EAVDAFVEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLMDHAFDQREHIY  350



>ref|XP_004511645.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Cicer arietinum]
Length=496

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RLK+YSTDRNNP KP ALSGLSPYLHFG ISAQRC L
Sbjct  228  WCEPGEIAAMEVLMGSKNGFLTKRLKNYSTDRNNPCKPTALSGLSPYLHFGLISAQRCAL  287

Query  471  QAQQIQKSHPK  439
            +A++++ SHP+
Sbjct  288  EARKLRVSHPQ  298


 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELIVRRELADNFC+YQP YDSLQGAWEWARKTL++H++DKR+H Y
Sbjct  298  QAVDAFLEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLLDHASDKRQHNY  350



>ref|XP_008238652.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Prunus mume]
Length=499

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RLK YS+DRNNPLKP+ LSGLSPYLHFGQISAQRC L
Sbjct  228  WCEPGEKAAMEVLMGSKNGFLTKRLKGYSSDRNNPLKPRGLSGLSPYLHFGQISAQRCAL  287

Query  471  QAQQIQKSHPK  439
            +A+ I+K  P+
Sbjct  288  EARSIRKLCPE  298


 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +AVD F+EELIVRRELADNFC+YQP YDSLQGAWEWARKTLM+H+ DKREH+Y
Sbjct  298  EAVDAFVEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLMDHAFDKREHIY  350



>gb|KEH27452.1| CPD photolyase [Medicago truncatula]
Length=450

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RL++YSTDRNNP KP ALSGLSPYLHFGQISAQRC L
Sbjct  231  WCEPGEIAAMEVLMGSKNGFLTKRLRNYSTDRNNPCKPTALSGLSPYLHFGQISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A++++ S+P+
Sbjct  291  EARKLRASYPQ  301


 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRRELADNFCYYQP YDS+QGAWEWARKTL++H++DKR+HVY
Sbjct  301  QAVDTFLEELIVRRELADNFCYYQPHYDSIQGAWEWARKTLLDHASDKRQHVY  353



>ref|XP_010476208.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Camelina sativa]
Length=494

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA MEVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  227  WCLPGEDAGMEVLMGAKDGFLTKRLKNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  286

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  287  EARKVRTTSPQ  297


 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEE+IVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREHVY
Sbjct  297  QAVDTFLEEMIVRRELSDNFCYYQPHYDSLEGAWEWARKSLMDHASDKREHVY  349



>ref|XP_009110652.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Brassica rapa]
Length=495

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGED+ MEVLMG + GFLT RL++YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  229  WCVPGEDSGMEVLMGRQEGFLTKRLRNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A+++QK++P+
Sbjct  289  EARKVQKTYPQ  299


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLEGAWEWARKSLMDHASDKREHTY  351



>gb|AES94195.2| CPD photolyase [Medicago truncatula]
Length=499

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RL++YSTDRNNP KP ALSGLSPYLHFGQISAQRC L
Sbjct  231  WCEPGEIAAMEVLMGSKNGFLTKRLRNYSTDRNNPCKPTALSGLSPYLHFGQISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A++++ S+P+
Sbjct  291  EARKLRASYPQ  301


 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRRELADNFCYYQP YDS+QGAWEWARKTL++H++DKR+HVY
Sbjct  301  QAVDTFLEELIVRRELADNFCYYQPHYDSIQGAWEWARKTLLDHASDKRQHVY  353



>ref|XP_006306132.1| hypothetical protein CARUB_v10011602mg [Capsella rubella]
 gb|EOA39030.1| hypothetical protein CARUB_v10011602mg [Capsella rubella]
Length=488

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA M+VLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  227  WCMPGEDAGMDVLMGTKDGFLTKRLKNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  286

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  287  EARKVRNTSPQ  297


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEE+IVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  297  QAVDTFLEEMIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  349



>ref|XP_006417242.1| hypothetical protein EUTSA_v10007458mg [Eutrema salsugineum]
 gb|ESQ35595.1| hypothetical protein EUTSA_v10007458mg [Eutrema salsugineum]
Length=495

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGE+A MEVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  228  WCVPGEEAGMEVLMGNKDGFLTKRLKNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  287

Query  471  QAQQIQKSHPK  439
            +A++++ ++P+
Sbjct  288  EARKVRSTYPQ  298


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL GAWEWARK+LM+H++DKREH+Y
Sbjct  298  QAVDTFLEELIVRRELSDNFCYYQPHYDSLMGAWEWARKSLMDHASDKREHIY  350



>ref|XP_010458666.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Camelina sativa]
Length=494

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA +EVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  227  WCVPGEDAGIEVLMGTKDGFLTKRLKNYSTDRNNPVKPKALSGLSPYLHFGQISAQRCAL  286

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  287  EARKVRTTSPQ  297


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEE+IVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  297  QAVDTFLEEMIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  349



>ref|XP_010053402.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Eucalyptus grandis]
 gb|KCW77684.1| hypothetical protein EUGRSUZ_D01985 [Eucalyptus grandis]
Length=494

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGE AA+EVLMG++NGFLT RL++YS DRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  231  WCKPGESAALEVLMGNENGFLTKRLRNYSADRNNPLKPKGLSGLSPYLHFGQISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A +++KS+P+
Sbjct  291  EAHKVRKSYPQ  301


 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELIVRRELADNFC+YQP YDSL+GAWEWARKTLM+H++DKREH+Y
Sbjct  301  QAVDAFLEELIVRRELADNFCFYQPHYDSLKGAWEWARKTLMDHASDKREHIY  353



>gb|AAF79657.1|AC025416_31 F5O11.9 [Arabidopsis thaliana]
Length=505

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA +EVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQ+SAQRC L
Sbjct  229  WCVPGEDAGIEVLMGNKDGFLTKRLKNYSTDRNNPIKPKALSGLSPYLHFGQVSAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  289  EARKVRSTSPQ  299


 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  351



>ref|NP_849651.1| photolyase 1 [Arabidopsis thaliana]
 sp|Q9SB00.1|PHR_ARATH RecName: Full=Deoxyribodipyrimidine photo-lyase; AltName: Full=AtCPDII; 
AltName: Full=DNA photolyase; AltName: Full=Photoreactivating 
enzyme 1; AltName: Full=Protein UV RESISTANCE 2 
[Arabidopsis thaliana]
 dbj|BAA74701.1| PHR1 [Arabidopsis thaliana]
 gb|AEE28871.1| photolyase 1 [Arabidopsis thaliana]
Length=496

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA +EVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQ+SAQRC L
Sbjct  229  WCVPGEDAGIEVLMGNKDGFLTKRLKNYSTDRNNPIKPKALSGLSPYLHFGQVSAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  289  EARKVRSTSPQ  299


 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  351



>ref|NP_563906.1| photolyase 1 [Arabidopsis thaliana]
 gb|AAK59467.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44957.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28872.1| photolyase 1 [Arabidopsis thaliana]
Length=490

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA +EVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQ+SAQRC L
Sbjct  229  WCVPGEDAGIEVLMGNKDGFLTKRLKNYSTDRNNPIKPKALSGLSPYLHFGQVSAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  289  EARKVRSTSPQ  299


 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  351



>emb|CAA67683.1| CPD photolyase [Arabidopsis thaliana]
 gb|AAC08008.1| type II CPD photolyase PHR1 [Arabidopsis thaliana]
Length=496

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA +EVLMG+K+GFLT RLK+YSTDRNNP+KPKALSGLSPYLHFGQ+SAQRC L
Sbjct  229  WCVPGEDAGIEVLMGNKDGFLTKRLKNYSTDRNNPIKPKALSGLSPYLHFGQVSAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  289  EARKVRSTSPQ  299


 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  299  QAVDIFLEELIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  351



>ref|XP_002892684.1| hypothetical protein ARALYDRAFT_471385 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68943.1| hypothetical protein ARALYDRAFT_471385 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDA MEVLMG K+GFLT RLK+YS DRNNP+KPKALSGLSPYLHFGQISAQRC L
Sbjct  229  WCVPGEDAGMEVLMGKKDGFLTKRLKNYSADRNNPVKPKALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ + P+
Sbjct  289  EARKVRNTSPQ  299


 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH+Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLKGAWEWARKSLMDHASDKREHIY  351



>ref|XP_010533748.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Tarenaya hassleriana]
Length=490

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGED A EVLMG ++GFL  RLKSYSTDRNNPLKPKALS LSPYLHFGQISAQRC L
Sbjct  228  WCEPGEDGAREVLMGGQDGFLMKRLKSYSTDRNNPLKPKALSCLSPYLHFGQISAQRCAL  287

Query  471  QAQQIQKSHPK  439
            +A++++K++P+
Sbjct  288  EARKVRKTYPQ  298


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD+FLEELIVRRELADNFCYYQP YDSL+GAWEWARKTLM+H++DKR+H+Y
Sbjct  298  QAVDSFLEELIVRRELADNFCYYQPHYDSLKGAWEWARKTLMDHASDKRDHIY  350



>ref|NP_001267582.1| deoxyribodipyrimidine photo-lyase-like [Cucumis sativus]
 dbj|BAB39480.1| CPD photolyase [Cucumis sativus]
 dbj|BAB91322.1| CPD photolyase [Cucumis sativus]
 gb|KGN50193.1| hypothetical protein Csa_5G158490 [Cucumis sativus]
Length=489

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGE AAMEVLMGSK+GFLT RLK Y+ DRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  225  WCKPGEKAAMEVLMGSKDGFLTKRLKGYAIDRNNPLKPKGLSGLSPYLHFGQISAQRCAL  284

Query  471  QAQQIQKSHPK  439
            +A+ I+K +P+
Sbjct  285  EARSIRKLNPQ  295


 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             QAVD FLEELIVRRELADN+CYYQP YDSL GAWEWARKTLM+H++DKRE++Y
Sbjct  294  PQAVDVFLEELIVRRELADNYCYYQPHYDSLLGAWEWARKTLMDHASDKREYIY  347



>ref|XP_008437155.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Cucumis melo]
Length=489

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGE AAMEVLMGSK+GFLT RLK Y+ DRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  225  WCKPGEKAAMEVLMGSKDGFLTKRLKGYAIDRNNPLKPKGLSGLSPYLHFGQISAQRCAL  284

Query  471  QAQQIQKSHPK  439
            +A+ ++K +P+
Sbjct  285  EARNVRKLNPQ  295


 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELIVRRELADN+CYYQPQYDSL GAWEWARKTLM+H++DKRE++Y
Sbjct  295  QAVDVFLEELIVRRELADNYCYYQPQYDSLLGAWEWARKTLMDHASDKREYIY  347



>ref|XP_010676658.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Beta vulgaris subsp. 
vulgaris]
Length=492

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA+EVL GS+NGFLT RLK+YSTDRNNPLKP+ALSGLSPYLHFGQISAQRC  
Sbjct  227  WCEPGETAALEVLKGSQNGFLTKRLKNYSTDRNNPLKPRALSGLSPYLHFGQISAQRCAF  286

Query  471  QAQQIQKSHPK  439
            +A+ ++K  P+
Sbjct  287  EARNVRKVAPE  297


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             +AVD F EELIVRRELADNFCYYQP YDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  296  PEAVDAFWEELIVRRELADNFCYYQPHYDSLMGAWEWARKTLMDHAADKREHLY  349



>ref|XP_011463773.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Fragaria vesca 
subsp. vesca]
Length=491

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMGSKNGFLT RLK YS+DRNNPLKP+ +SGLSPYLHFGQISAQRC L
Sbjct  228  WCEPGETAAMEVLMGSKNGFLTKRLKGYSSDRNNPLKPRGVSGLSPYLHFGQISAQRCAL  287

Query  471  QAQQIQKSHP  442
            +A+ ++   P
Sbjct  288  EARSVRNLSP  297


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AVD FLEELIVRRELADN+C+YQP YDSLQGAWEWARKTLM+H++DKREH+Y
Sbjct  299  AVDAFLEELIVRRELADNYCFYQPHYDSLQGAWEWARKTLMDHASDKREHIY  350



>ref|XP_002266483.2| PREDICTED: deoxyribodipyrimidine photo-lyase [Vitis vinifera]
Length=497

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GE+AA+E+LMGSKNGFLT RLK+YSTDRNNPLKP ALSGLSPYLHFGQISAQRC L
Sbjct  234  WCESGENAAVEILMGSKNGFLTKRLKNYSTDRNNPLKPGALSGLSPYLHFGQISAQRCAL  293

Query  471  QAQQIQKSHPK  439
            +A++ +K+ P+
Sbjct  294  EAKKNRKNCPQ  304


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELIVRRELADNFC+YQP+Y+SLQGAWEWARKTLM+H++DKREH+Y
Sbjct  304  QAVDVFLEELIVRRELADNFCFYQPRYNSLQGAWEWARKTLMDHASDKREHIY  356



>ref|XP_008798542.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Phoenix dactylifera]
Length=505

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGED AMEVLMG+K+GFLT RLK+Y TDRN+PLKPK  SGLSPYLHFGQISAQRC L
Sbjct  238  WCEPGEDPAMEVLMGNKDGFLTRRLKNYETDRNDPLKPKGSSGLSPYLHFGQISAQRCAL  297

Query  471  QAQQIQKSHPK  439
            +AQ  +KS PK
Sbjct  298  EAQAHRKSCPK  308


 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSLQGAWEWARKTLM+HS D+REH+Y
Sbjct  307  PKSVDAFLEELLVRRELADNFCYYQPQYDSLQGAWEWARKTLMDHSADEREHLY  360



>gb|KDO63751.1| hypothetical protein CISIN_1g010783mg [Citrus sinensis]
Length=375

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GEDAAMEVL GSK+GFLT RLK+Y TDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  229  WCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++ +K  P+
Sbjct  289  EARKARKLCPE  299


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +A+DTFLEELIVRRELADNFC+YQP YDSL+GAWEWARK+L +H++DKREH+Y
Sbjct  299  EAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIY  351



>gb|AAQ10672.1| type II CPD photolyase [Stellaria longipes]
Length=499

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA+EVLMG K+GFLT RLK Y TDRN PLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  229  WCEPGETAALEVLMGEKDGFLTKRLKKYGTDRNIPLKPRALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A+Q++K  P+
Sbjct  289  EARQVRKLSPE  299


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTFLEELIVRRELADNFCYYQP YDS++GAW+WARKTLM+H++DKREH+Y
Sbjct  299  ESVDTFLEELIVRRELADNFCYYQPHYDSIKGAWDWARKTLMDHASDKREHLY  351



>ref|XP_006440418.1| hypothetical protein CICLE_v10019819mg [Citrus clementina]
 gb|ESR53658.1| hypothetical protein CICLE_v10019819mg [Citrus clementina]
 gb|KDO63748.1| hypothetical protein CISIN_1g010783mg [Citrus sinensis]
Length=501

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GEDAAMEVL GSK+GFLT RLK+Y TDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  229  WCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPKV  436
            +A++ +K  P++
Sbjct  289  EARKARKLCPEL  300


 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = -2

Query  175  YLRLT-QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            YL  T +A+DTFLEELIVRRELADNFC+YQP YDSL+GAWEWARK+L +H++DKREH+Y
Sbjct  302  YLPATLKAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIY  360



>ref|XP_006477285.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X1 
[Citrus sinensis]
Length=501

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GEDAAMEVL GSK+GFLT RLK+Y TDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  229  WCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPKV  436
            +A++ +K  P++
Sbjct  289  EARKARKLCPEL  300


 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = -2

Query  175  YLRLT-QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            YL  T +A+DTFLEELIVRRELADNFC+YQP YDSL+GAWEWARK+L +H++DKREH+Y
Sbjct  302  YLPATLKAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIY  360



>emb|CBI22143.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GE+AA+E+LMGSKNGFLT RLK+YSTDRNNPLKP ALSGLSPYLHFGQISAQRC L
Sbjct  223  WCESGENAAVEILMGSKNGFLTKRLKNYSTDRNNPLKPGALSGLSPYLHFGQISAQRCAL  282

Query  471  QAQQIQKSHPK  439
            +A++ +K+ P+
Sbjct  283  EAKKNRKNCPQ  293


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELIVRRELADNFC+YQP+Y+SLQGAWEWARKTLM+H++DKREH+Y
Sbjct  293  QAVDVFLEELIVRRELADNFCFYQPRYNSLQGAWEWARKTLMDHASDKREHIY  345



>emb|CDY21047.1| BnaA08g24780D [Brassica napus]
Length=498

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGED+ ME+LMG + GFLT RL++YSTDRNNP+KPKALSGLSPYLHFGQ+SAQRC L
Sbjct  229  WCVPGEDSGMEILMGRQEGFLTKRLRNYSTDRNNPVKPKALSGLSPYLHFGQVSAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++++ ++P+
Sbjct  289  EARKVRSAYPQ  299


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVDTFLEELIVRREL+DNFCYYQP YDSL+GAWEWARK+LM+H++DKREH Y
Sbjct  299  QAVDTFLEELIVRRELSDNFCYYQPHYDSLEGAWEWARKSLMDHASDKREHTY  351



>gb|EYU30458.1| hypothetical protein MIMGU_mgv1a005220mg [Erythranthe guttata]
Length=493

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA++VL G KNGFL TRLK+YS++RNNPLKPK+LSGLSPYLHFGQISAQRC L
Sbjct  230  WCEPGEGAALDVLTGVKNGFLKTRLKNYSSERNNPLKPKSLSGLSPYLHFGQISAQRCAL  289

Query  471  QAQQIQKSHPK  439
            +A++++K +P+
Sbjct  290  EARKVRKLYPE  300


 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +A+D FLEEL+VRRELADNFC+YQP YDS+QGAWEWARKTLM+H++DKREH+Y
Sbjct  300  EAIDGFLEELVVRRELADNFCFYQPHYDSIQGAWEWARKTLMDHASDKREHLY  352



>ref|XP_011081112.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Sesamum indicum]
Length=490

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGE AA++VLMG KNGFL  R+K+Y +DRNNPLKPKALSGLSPYLHFGQISAQRC L
Sbjct  226  WCQPGEQAALDVLMGDKNGFLKVRVKNYFSDRNNPLKPKALSGLSPYLHFGQISAQRCAL  285

Query  471  QAQQIQKSHPK  439
            +A++++K +P+
Sbjct  286  EARKVRKLYPQ  296


 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             QA+D FLEELIVRRELADNFC+YQP YDSLQGAWEWARKTLM+H++DKREH+Y
Sbjct  295  PQAIDAFLEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLMDHASDKREHIY  348



>ref|XP_006477286.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X2 
[Citrus sinensis]
Length=492

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GEDAAMEVL GSK+GFLT RLK+Y TDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  229  WCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++ +K  P+
Sbjct  289  EARKARKLCPE  299


 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +A+DTFLEELIVRRELADNFC+YQP YDSL+GAWEWARK+L +H++DKREH+Y
Sbjct  299  EAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIY  351



>ref|XP_006440419.1| hypothetical protein CICLE_v10019819mg [Citrus clementina]
 gb|ESR53659.1| hypothetical protein CICLE_v10019819mg [Citrus clementina]
 gb|KDO63749.1| hypothetical protein CISIN_1g010783mg [Citrus sinensis]
Length=492

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GEDAAMEVL GSK+GFLT RLK+Y TDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  229  WCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++ +K  P+
Sbjct  289  EARKARKLCPE  299


 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +A+DTFLEELIVRRELADNFC+YQP YDSL+GAWEWARK+L +H++DKREH+Y
Sbjct  299  EAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIY  351



>gb|KDO63750.1| hypothetical protein CISIN_1g010783mg [Citrus sinensis]
Length=464

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GEDAAMEVL GSK+GFLT RLK+Y TDRNNPLKP+ALSGLSPYLHFGQISAQRC L
Sbjct  229  WCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCAL  288

Query  471  QAQQIQKSHPK  439
            +A++ +K  P+
Sbjct  289  EARKARKLCPE  299


 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +A+DTFLEELIVRRELADNFC+YQP YDSL+GAWEWARK+L +H++DKREH+Y
Sbjct  299  EAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIY  351



>ref|XP_007039991.1| Photolyase 1 isoform 4 [Theobroma cacao]
 gb|EOY24492.1| Photolyase 1 isoform 4 [Theobroma cacao]
Length=369

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMG+K+GFLT RLK+YSTDRN PLKP+ALS LSPYLHFGQISAQRC L
Sbjct  232  WCEPGEIAAMEVLMGTKDGFLTKRLKNYSTDRNIPLKPRALSCLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQKSH  445
            +A + +K H
Sbjct  292  EAHRFRKLH  300


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  97   YYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + QP YDSL+GAWEWARKTLM+H++DKREHVY
Sbjct  300  HAQPHYDSLEGAWEWARKTLMDHASDKREHVY  331



>gb|KHN34970.1| Deoxyribodipyrimidine photo-lyase [Glycine soja]
Length=500

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA EVLMGSKNGFLT RLK YS DRNNP  P ALSGLSPYLHFGQISAQRC L
Sbjct  232  WCEPGEIAASEVLMGSKNGFLTKRLKGYSLDRNNPCHPNALSGLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQKSHPK  439
            +A++ + SHP+
Sbjct  292  EARKRRNSHPQ  302


 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QA+D FLEELIVRRELADN+C+YQP YDSL+GAW WA+ TL EH+ DKREH+Y
Sbjct  302  QAIDAFLEELIVRRELADNYCFYQPHYDSLKGAWAWAQNTLTEHATDKREHIY  354



>ref|NP_001238710.1| CPD photolyase [Glycine max]
 dbj|BAG12106.1| CPD photolyase [Glycine max]
Length=500

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA EVLMGSKNGFLT RLK YS DRNNP  P ALSGLSPYLHFGQISAQRC L
Sbjct  232  WCEPGEIAASEVLMGSKNGFLTKRLKGYSLDRNNPCHPNALSGLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQKSHPK  439
            +A++ + SHP+
Sbjct  292  EARKRRNSHPQ  302


 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QA+D FLEELIVRRELADN+C+YQP YDSL+GAW WA+ TL EH+ DKREH+Y
Sbjct  302  QAIDAFLEELIVRRELADNYCFYQPHYDSLKGAWAWAQNTLTEHATDKREHIY  354



>gb|KDP25590.1| hypothetical protein JCGZ_20746 [Jatropha curcas]
Length=539

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGE+ A EVLMGSK+GFLTTRLK+YSTDRNNPLKPK LSGLSPYLHFGQISAQRC L
Sbjct  275  WCMPGEEGASEVLMGSKDGFLTTRLKNYSTDRNNPLKPKGLSGLSPYLHFGQISAQRCAL  334

Query  471  QAQQIQKSHPK  439
            +A +++   P+
Sbjct  335  EACKVRNHSPQ  345


 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+VD FLEELIVRRELADNFC+YQP YD+LQGAWEWAR TL+ H +DKREH+Y
Sbjct  345  QSVDVFLEELIVRRELADNFCFYQPHYDTLQGAWEWARNTLLSHKSDKREHIY  397



>ref|XP_007039990.1| Photolyase 1 isoform 3 [Theobroma cacao]
 gb|EOY24491.1| Photolyase 1 isoform 3 [Theobroma cacao]
Length=450

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMG+K+GFLT RLK+YSTDRN PLKP+ALS LSPYLHFGQISAQRC L
Sbjct  232  WCEPGEIAAMEVLMGTKDGFLTKRLKNYSTDRNIPLKPRALSCLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQKSH  445
            +A + +K H
Sbjct  292  EAHRFRKLH  300


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             QAVDTFLEELI+RRELADNFCYYQP YDSL+GAWEWARKTLM+H++DKREHVY
Sbjct  301  AQAVDTFLEELIIRRELADNFCYYQPHYDSLEGAWEWARKTLMDHASDKREHVY  354



>gb|KHG30720.1| Deoxyribodipyrimidine photo-lyase -like protein [Gossypium arboreum]
Length=481

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMG+K+GFLT RLK+YSTDRNNPLKP+ALS LSPYLHFGQISAQRC L
Sbjct  232  WCEPGETAAMEVLMGNKDGFLTKRLKNYSTDRNNPLKPRALSCLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQK  451
            +A+  +K
Sbjct  292  EARGFRK  298


 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 1/60 (2%)
 Frame = -2

Query  178  GYLRL-TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            G+ +L  QAVDTFLEELIVRRELADNFCYYQP YD++QGAWEWARKTLM+H++DKREH Y
Sbjct  295  GFRKLNAQAVDTFLEELIVRRELADNFCYYQPNYDTMQGAWEWARKTLMDHASDKREHTY  354



>ref|XP_007157316.1| hypothetical protein PHAVU_002G059800g [Phaseolus vulgaris]
 gb|ESW29310.1| hypothetical protein PHAVU_002G059800g [Phaseolus vulgaris]
Length=501

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA EVLMGS+NGFLT RLK YS DRNNP  P ALSGLSPYLHFGQISAQRC L
Sbjct  233  WCEPGEIAAREVLMGSENGFLTKRLKGYSLDRNNPCNPNALSGLSPYLHFGQISAQRCAL  292

Query  471  QAQQIQKSHPK  439
            +A++ + SHP+
Sbjct  293  EARKRRNSHPQ  303


 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QA+D FLEELIVRRELADN+C+Y+P YDS++GAW WA+ TL++H+ DKREH+Y
Sbjct  303  QAIDAFLEELIVRRELADNYCFYEPHYDSIKGAWGWAQNTLIQHATDKREHIY  355



>ref|XP_007039988.1| Photolyase 1 isoform 1 [Theobroma cacao]
 ref|XP_007039989.1| Photolyase 1 isoform 1 [Theobroma cacao]
 gb|EOY24489.1| Photolyase 1 isoform 1 [Theobroma cacao]
 gb|EOY24490.1| Photolyase 1 isoform 1 [Theobroma cacao]
Length=495

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMG+K+GFLT RLK+YSTDRN PLKP+ALS LSPYLHFGQISAQRC L
Sbjct  232  WCEPGEIAAMEVLMGTKDGFLTKRLKNYSTDRNIPLKPRALSCLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQKSH  445
            +A + +K H
Sbjct  292  EAHRFRKLH  300


 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             QAVDTFLEELI+RRELADNFCYYQP YDSL+GAWEWARKTLM+H++DKREHVY
Sbjct  301  AQAVDTFLEELIIRRELADNFCYYQPHYDSLEGAWEWARKTLMDHASDKREHVY  354



>gb|KJB20820.1| hypothetical protein B456_003G166800 [Gossypium raimondii]
Length=498

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAMEVLMG+K+GFLT RLKSYS DRNNPLKP+ALS LSPYLHFGQISAQRC L
Sbjct  232  WCEPGEIAAMEVLMGNKDGFLTKRLKSYSMDRNNPLKPRALSCLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQK  451
            +A+  +K
Sbjct  292  EARSFRK  298


 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             QAVDTFLEELIVRRELADNFCYYQP YD++QGAWEWARKTLM+H++DKREH Y
Sbjct  301  AQAVDTFLEELIVRRELADNFCYYQPNYDTMQGAWEWARKTLMDHASDKREHTY  354



>gb|EPS68392.1| hypothetical protein M569_06376, partial [Genlisea aurea]
Length=484

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGE+AA EVL+G K+GFLT +LK+Y TDRNNP+K KALSGLSPYLHFGQISAQRC L
Sbjct  225  WCKPGEEAAAEVLLGKKDGFLTMKLKNYFTDRNNPVKSKALSGLSPYLHFGQISAQRCAL  284

Query  471  QAQQIQKSHPK  439
            +AQ+++K +P+
Sbjct  285  EAQKLRKQYPQ  295


 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            QAVD FLEELI+RRELADNFCYYQP YDSLQGAWEWARKTL +H+ DKREH+Y
Sbjct  295  QAVDAFLEELIIRRELADNFCYYQPHYDSLQGAWEWARKTLKDHAADKREHIY  347



>ref|XP_011463777.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=467

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  648  CEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCLQ  469
            CEPGE AAMEVLMGS++GFLT RLK YS+DRNNPLKP+ +SGLSPYLHFGQISAQRC L+
Sbjct  229  CEPGEKAAMEVLMGSQSGFLTKRLKGYSSDRNNPLKPRGVSGLSPYLHFGQISAQRCALE  288

Query  468  AQQIQKSHP  442
            A+ +Q   P
Sbjct  289  ARSVQNLSP  297


 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AVD FLEELIVRRELADN+C+YQP YDSLQGAWEWARKTL +H+ DKREH+Y
Sbjct  299  AVDAFLEELIVRRELADNYCFYQPHYDSLQGAWEWARKTLRDHALDKREHIY  350



>ref|XP_008369510.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Malus domestica]
Length=493

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GE AAMEVLMGSKNGFLT RLK YS+DRNNPLKP  LSGLSPYLHFGQ+SAQRC L
Sbjct  230  WCESGEKAAMEVLMGSKNGFLTKRLKGYSSDRNNPLKPGGLSGLSPYLHFGQLSAQRCAL  289

Query  471  QAQQIQKSHPK  439
            +A+  +K  P+
Sbjct  290  EARSRRKLCPE  300


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +AVD FLEELIVRRELADNFC+YQP YDSLQGAWEWARKTL +H++DKREH+Y
Sbjct  300  EAVDAFLEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLADHASDKREHIY  352



>ref|XP_011463776.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=491

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  648  CEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCLQ  469
            CEPGE AAMEVLMGS++GFLT RLK YS+DRNNPLKP+ +SGLSPYLHFGQISAQRC L+
Sbjct  229  CEPGEKAAMEVLMGSQSGFLTKRLKGYSSDRNNPLKPRGVSGLSPYLHFGQISAQRCALE  288

Query  468  AQQIQKSHP  442
            A+ +Q   P
Sbjct  289  ARSVQNLSP  297


 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AVD FLEELIVRRELADN+C+YQP YDSLQGAWEWARKTL +H+ DKREH+Y
Sbjct  299  AVDAFLEELIVRRELADNYCFYQPHYDSLQGAWEWARKTLRDHALDKREHIY  350



>gb|AAP31406.1| CPD photolyase [Spinacia oleracea]
 gb|AAP31407.1| CPD photolyase [Spinacia oleracea]
Length=491

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGE AA+EVL GS+NGFLT RLKSY+TDRN PLKP ALSGLSPYLHFGQISAQRC  
Sbjct  227  WCKPGETAALEVLKGSQNGFLTKRLKSYATDRNIPLKPGALSGLSPYLHFGQISAQRCAF  286

Query  471  QAQQIQKSHPK  439
            +A+ ++K  P+
Sbjct  287  EARNVRKVAPE  297


 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +AVD F EELIVRRELADNFCYYQP YDSL GAWEWARKTLM+H++DKREH+Y
Sbjct  297  EAVDAFTEELIVRRELADNFCYYQPNYDSLMGAWEWARKTLMDHASDKREHLY  349



>ref|XP_009362139.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Pyrus x bretschneideri]
Length=493

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GE AAMEVLMGSKNGFLT RLK YS DRNNPLKP  LSGLSPYLHFGQ+SAQRC L
Sbjct  230  WCESGEKAAMEVLMGSKNGFLTKRLKGYSLDRNNPLKPGGLSGLSPYLHFGQLSAQRCAL  289

Query  471  QAQQIQKSHPK  439
            +A+  +K  P+
Sbjct  290  EARSRRKLCPE  300


 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +AVD FLEELIVRRELADNFC+YQP YDSLQGAWEWARKTL +H++DKREH+Y
Sbjct  300  EAVDAFLEELIVRRELADNFCFYQPHYDSLQGAWEWARKTLADHASDKREHIY  352



>gb|EEE50627.1| hypothetical protein OsJ_30831 [Oryza sativa Japonica Group]
Length=516

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPKV  436
            +A++ +   PK+
Sbjct  301  EAKKCRHLSPKM  312


 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  166  LTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            L Q+VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  319  LKQSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  373



>sp|Q6F6A2.1|PHR_ORYSJ RecName: Full=Deoxyribodipyrimidine photo-lyase; AltName: Full=DNA 
photolyase; AltName: Full=OsCPDII; AltName: Full=Photoreactivating 
enzyme [Oryza sativa Japonica Group]
 dbj|BAD26607.1| CPD photolyase [Oryza sativa Japonica Group]
 dbj|BAE06248.1| CPD photolyase [Oryza sativa Japonica Group]
 gb|ABB46863.1| Deoxyribodipyrimidine photo-lyase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF97086.1| CPD photolyase [Oryza sativa]
Length=506

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKCRHLSPK  311


 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>ref|XP_009382010.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AAME LMG K+GFLT RLK Y +DRN+P+K +ALSGLSPYLHFGQISAQRC L
Sbjct  232  WCEPGEEAAMEALMGRKDGFLTKRLKHYDSDRNDPVKSRALSGLSPYLHFGQISAQRCAL  291

Query  471  QAQQIQKSH  445
            +A + +KS+
Sbjct  292  EAWKFRKSY  300


 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+VD FLEELIVRRELADNFCYYQP YDSLQGAWEWARKTLM+H+ DKREH+Y
Sbjct  302  QSVDAFLEELIVRRELADNFCYYQPHYDSLQGAWEWARKTLMDHAADKREHIY  354



>pdb|3UMV|A Chain A, Eukaryotic Class Ii Cpd Photolyase Structure Reveals 
A Basis For Improved Uv-Tolerance In Plants
 pdb|3UMV|B Chain B, Eukaryotic Class Ii Cpd Photolyase Structure Reveals 
A Basis For Improved Uv-Tolerance In Plants
 dbj|BAC76449.2| CPD-photolyase [Oryza sativa Japonica Group]
Length=506

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKCRHLSPK  311


 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>dbj|BAF97091.1| CPD photolyase [Oryza meridionalis]
Length=506

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AAME L+GSK+G+LT R+KSY TDRN+P KP+ALSGLSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAMEALLGSKHGYLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKRRHLSPK  311


 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             +++D FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSIDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>gb|AAN04184.1| Putative CPD photolyase [Oryza sativa Japonica Group]
Length=565

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPKV  436
            +A++ +   PK+
Sbjct  301  EAKKCRHLSPKM  312


 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  166  LTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            L Q+VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  319  LKQSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  373



>ref|XP_010234649.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X3 [Brachypodium 
distachyon]
Length=310

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA+E L+GSK+GFLTTR+K+Y  DRN+P KPKALSGLSPYLHFG ISAQRC L
Sbjct  240  WCEPGEAAALETLLGSKDGFLTTRIKNYDMDRNHPTKPKALSGLSPYLHFGHISAQRCAL  299

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  300  EAKKCRHLSPK  310



>dbj|BAF97083.1| CPD photolyase [Oryza meridionalis]
 dbj|BAF97090.1| CPD photolyase [Oryza meridionalis]
Length=506

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AAME L+GSK+G+LT R+KSY TDRN+P KP+ALSGLSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAMEALLGSKHGYLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKRRHLSPK  311


 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             +++D FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSIDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>dbj|BAF97089.1| CPD photolyase [Oryza meridionalis]
Length=506

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AAME L+GSK+G+LT R+KSY TDRN+P KP+ALSGLSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAMEALLGSKHGYLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKRRHLSPK  311


 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             +++D FLEEL+VRRELADNFCYYQPQY SL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSIDAFLEELVVRRELADNFCYYQPQYGSLSGAWEWARKTLMDHAADKREHIY  363



>ref|XP_006662213.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Oryza brachyantha]
Length=474

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AAME L+GSK+GFLT R+KSY TDRN+P KP+ALS LSPYLHFG IS QRC L
Sbjct  209  WCEPGEEAAMEALLGSKDGFLTMRIKSYETDRNDPTKPRALSDLSPYLHFGHISVQRCAL  268

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  269  EAKKRRHLSPK  279


 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD FLEEL+VRRELADNFCYYQPQYDSL GAW+WARKTLM+H+ DKREH Y
Sbjct  279  KSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWDWARKTLMDHAADKREHSY  331



>gb|EEC66611.1| hypothetical protein OsI_32845 [Oryza sativa Indica Group]
Length=516

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISA RC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAHRCAL  300

Query  471  QAQQIQKSHPKV  436
            +A++ +   PK+
Sbjct  301  EAKKCRHLSPKM  312


 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  166  LTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            L Q+VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  319  LKQSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  373



>dbj|BAD52107.1| CPD photolyase [Oryza sativa Indica Group]
 dbj|BAE06247.1| CPD photolyase [Oryza sativa Indica Group]
 dbj|BAF97078.1| CPD photolyase [Oryza rufipogon]
 dbj|BAF97079.1| CPD photolyase [Oryza rufipogon]
 dbj|BAF97080.1| CPD photolyase [Oryza rufipogon]
 dbj|BAF97081.1| CPD photolyase [Oryza rufipogon]
 dbj|BAF97084.1| CPD photolyase [Oryza sativa Indica Group]
 dbj|BAF97085.1| CPD photolyase [Oryza sativa Indica Group]
 dbj|BAF97087.1| CPD photolyase [Oryza sativa]
 dbj|BAF97094.1| CPD photolyase [Oryza rufipogon]
Length=506

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISA RC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAHRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKCRHLSPK  311


 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>dbj|BAF97082.1| CPD photolyase [Oryza rufipogon]
Length=506

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISA RC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAHRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKCRHLSPK  311


 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>ref|XP_010234648.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X2 [Brachypodium 
distachyon]
Length=480

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA+E L+GSK+GFLTTR+K+Y  DRN+P KPKALSGLSPYLHFG ISAQRC L
Sbjct  240  WCEPGEAAALETLLGSKDGFLTTRIKNYDMDRNHPTKPKALSGLSPYLHFGHISAQRCAL  299

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  300  EAKKCRHLSPK  310


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  91   QPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +P YDSL GAWEWARKTL +H+ DKREH+Y
Sbjct  310  KPHYDSLAGAWEWARKTLKDHAGDKREHIY  339



>ref|XP_003573808.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X1 [Brachypodium 
distachyon]
Length=503

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA+E L+GSK+GFLTTR+K+Y  DRN+P KPKALSGLSPYLHFG ISAQRC L
Sbjct  240  WCEPGEAAALETLLGSKDGFLTTRIKNYDMDRNHPTKPKALSGLSPYLHFGHISAQRCAL  299

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  300  EAKKCRHLSPK  310


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEELI+RRELADNFCYYQP YDSL GAWEWARKTL +H+ DKREH+Y
Sbjct  309  PKSVDAFLEELIIRRELADNFCYYQPHYDSLAGAWEWARKTLKDHAGDKREHIY  362



>dbj|BAF97088.1| CPD photolyase [Oryza barthii]
 dbj|BAF97092.1| CPD photolyase [Oryza barthii]
 dbj|BAF97095.1| CPD photolyase [Oryza glaberrima]
 dbj|BAF97096.1| CPD photolyase [Oryza glaberrima]
Length=506

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALS LSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSALSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKCRHLSPK  311


 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>dbj|BAF97093.1| CPD photolyase [Oryza barthii]
Length=506

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+GSK+GFLT R+KSY TDRN+P KP+ALS LSPYLHFG ISAQRC L
Sbjct  241  WCEPGEEAAIEALLGSKDGFLTKRIKSYETDRNDPTKPRALSALSPYLHFGHISAQRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKCRHLSPK  311


 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>ref|XP_006851849.1| hypothetical protein AMTR_s00041p00085460 [Amborella trichopoda]
 gb|ERN13316.1| hypothetical protein AMTR_s00041p00085460 [Amborella trichopoda]
Length=490

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W EPGE AA+++LMGSKNGFL+TRLK+YSTDRNNP +PK LS LSPYLHFGQIS+QRC L
Sbjct  231  WIEPGEQAALDMLMGSKNGFLSTRLKNYSTDRNNPSRPKGLSCLSPYLHFGQISSQRCAL  290

Query  471  QAQQIQK  451
            +A++ +K
Sbjct  291  EARKFRK  297


 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q+VD+FLEELIVRRELADNFC+YQP YDSLQGAWEWARKTL +H+ DKREH+Y
Sbjct  300  SQSVDSFLEELIVRRELADNFCFYQPNYDSLQGAWEWARKTLRDHAGDKREHIY  353



>dbj|BAE45635.1| photolyase [Oryza sativa Japonica Group]
Length=481

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE+AA+E L+ SK+GFLT R+KSY TDRN+P KP+ALSGLSPYLHFG ISA RC L
Sbjct  241  WCEPGEEAAIEALLSSKDGFLTKRIKSYETDRNDPTKPRALSGLSPYLHFGHISAHRCAL  300

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  301  EAKKCRHLSPK  311


 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL+VRRELADNFCYYQPQYDSL GAWEWARKTLM+H+ DKREH+Y
Sbjct  310  PKSVDAFLEELVVRRELADNFCYYQPQYDSLSGAWEWARKTLMDHAADKREHIY  363



>gb|EMS58863.1| Deoxyribodipyrimidine photo-lyase [Triticum urartu]
Length=382

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAME L+G+K+GFLT R+KSY +DRN P KP ALSGLSPYLHFG ISAQRC L
Sbjct  116  WCEPGEAAAMEALLGTKDGFLTKRIKSYDSDRNYPTKPMALSGLSPYLHFGHISAQRCAL  175

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  176  EAKKRRHLSPK  186


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEELI+RRELADNFCYYQP YDS+ GAWEWARKTL +H+ DKREH+Y
Sbjct  185  PKSVDAFLEELIIRRELADNFCYYQPHYDSVAGAWEWARKTLKDHAADKREHIY  238



>dbj|BAK03208.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AGH70333.1| putative CPD photolyase [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AAME L+G+K+GFLT R+KSY +DRN P KP ALSGLSPYLHFG ISAQRC L
Sbjct  242  WCEPGEAAAMEALLGTKDGFLTKRIKSYDSDRNYPTKPTALSGLSPYLHFGHISAQRCAL  301

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  302  EAKKRRHLSPK  312


 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEELI+RRELADNFCYYQP YDS+ GAWEWARKTL +H+ DKREH+Y
Sbjct  311  PKSVDAFLEELIIRRELADNFCYYQPHYDSVAGAWEWARKTLKDHAADKREHIY  364



>gb|ACF85532.1| unknown [Zea mays]
 tpg|DAA46783.1| TPA: hypothetical protein ZEAMMB73_845202 [Zea mays]
 tpg|DAA46784.1| TPA: hypothetical protein ZEAMMB73_845202 [Zea mays]
Length=376

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE +AMEVL+GSK+GFLT R+K+Y T RN+P KP ALS LSPYLHFG ISAQRC L
Sbjct  231  WCEPGESSAMEVLLGSKDGFLTKRIKNYDTGRNDPTKPHALSCLSPYLHFGHISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  291  EAKKRRHLSPK  301


 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VDTFLEELI+RRELADNFCYYQPQYDSL GAWEWARKTL +H+ DKREH+Y
Sbjct  300  PKSVDTFLEELIIRRELADNFCYYQPQYDSLAGAWEWARKTLTDHTGDKREHIY  353



>ref|NP_001130580.1| type II CPD DNA photolyase [Zea mays]
 gb|ACF78855.1| unknown [Zea mays]
 tpg|DAA46785.1| TPA: type II CPD DNA photolyase [Zea mays]
Length=493

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE +AMEVL+GSK+GFLT R+K+Y T RN+P KP ALS LSPYLHFG ISAQRC L
Sbjct  231  WCEPGESSAMEVLLGSKDGFLTKRIKNYDTGRNDPTKPHALSCLSPYLHFGHISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  291  EAKKRRHLSPK  301


 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VDTFLEELI+RRELADNFCYYQPQYDSL GAWEWARKTL +H+ DKREH+Y
Sbjct  300  PKSVDTFLEELIIRRELADNFCYYQPQYDSLAGAWEWARKTLTDHTGDKREHIY  353



>gb|ACG43030.1| hypothetical protein [Zea mays]
Length=376

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE +AMEVL+G+K+GFLT R+K+Y T RN+P KP ALS LSPYLHFG ISAQRC L
Sbjct  231  WCEPGESSAMEVLLGNKDGFLTKRIKNYDTGRNDPTKPHALSCLSPYLHFGHISAQRCAL  290

Query  471  QAQQIQKSHPK  439
            +A++ +   PK
Sbjct  291  EAKKRRHLSPK  301


 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VDTFLEELI+RRELADNFCYYQPQYDSL GAWEWARKTL +H+ DKREH+Y
Sbjct  300  PKSVDTFLEELIIRRELADNFCYYQPQYDSLAGAWEWARKTLTDHTGDKREHIY  353



>ref|XP_004983328.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Setaria italica]
Length=499

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGE AA+EVL+GSK+GFLT R+K+Y   RN+P KP ALS LSPYLHFG ISAQRC L
Sbjct  235  WCEPGEAAALEVLLGSKDGFLTKRIKNYDMGRNDPTKPHALSCLSPYLHFGHISAQRCAL  294

Query  471  QAQQIQKSHPK  439
            +A++ ++  PK
Sbjct  295  EARKRRQLSPK  305


 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++VD FLEEL++RRELADNFCYYQP YDSL GAWEWARKTLM+H++DKREH+Y
Sbjct  304  PKSVDAFLEELLIRRELADNFCYYQPHYDSLAGAWEWARKTLMDHASDKREHIY  357



>ref|XP_002972041.1| hypothetical protein SELMODRAFT_96351 [Selaginella moellendorffii]
 gb|EFJ26958.1| hypothetical protein SELMODRAFT_96351 [Selaginella moellendorffii]
Length=510

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+VD+FLEELI+RREL+DNFCYYQP YD++QGAWEWAR +L+EH+NDKREH+Y
Sbjct  329  QSVDSFLEELIIRRELSDNFCYYQPNYDNIQGAWEWARNSLLEHANDKREHIY  381


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 4/69 (6%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGED A+E L G    FL++RL+ YS +RN+P K + LS LSPY H+GQ+S QRC  
Sbjct  263  WCEPGEDIALERLAG----FLSSRLQRYSAERNDPSKLERLSDLSPYFHYGQLSPQRCAF  318

Query  471  QAQQIQKSH  445
            + ++ +K H
Sbjct  319  EVRKARKLH  327



>ref|XP_002972587.1| hypothetical protein SELMODRAFT_97206 [Selaginella moellendorffii]
 gb|EFJ26673.1| hypothetical protein SELMODRAFT_97206 [Selaginella moellendorffii]
Length=510

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+VD+FLEELI+RREL+DNFCYYQP YD++QGAWEWAR +L+EH+NDKREH+Y
Sbjct  329  QSVDSFLEELIIRRELSDNFCYYQPNYDNIQGAWEWARNSLLEHANDKREHIY  381


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCEPGED A+E L      FL++RL+ YS +RN+P K + LS LSPY H+GQ+S QRC  
Sbjct  263  WCEPGEDIALERLAV----FLSSRLQRYSAERNDPSKLERLSDLSPYFHYGQLSPQRCAF  318

Query  471  QAQQIQKSH  445
            + ++ +K H
Sbjct  319  EVRKARKLH  327



>gb|AAQ18175.1| type II CPD DNA photolyase [Pityrogramma austroamericana]
Length=546

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            T+A+DTFLEEL++RRELADNFCYYQP YDSLQGA+EWAR TL+ H++DKREH+Y
Sbjct  347  TKAIDTFLEELVIRRELADNFCYYQPNYDSLQGAYEWARSTLLAHASDKREHLY  400


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 59/110 (54%), Gaps = 39/110 (35%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPY-------------  511
            WCE  EDAAME+L+G K GFLTTR+++Y+ DRN+P KP  LSGLSPY             
Sbjct  239  WCESREDAAMELLLGKKKGFLTTRIRNYADDRNDPSKPAGLSGLSPYLHYGQVLKKKGFL  298

Query  510  --------------------------LHFGQISAQRCCLQAQQIQKSHPK  439
                                      LH+GQ+ AQRC L+ +++++SH K
Sbjct  299  TTRIRNYADDRNDPSKPAGLSGLSPYLHYGQVLAQRCALEGRKLRRSHTK  348



>ref|XP_001764990.1| PHR1 AtPHR1-like type 2 CPD DNA photolyase [Physcomitrella patens]
 gb|EDQ70206.1| PHR1 AtPHR1-like type 2 CPD DNA photolyase [Physcomitrella patens]
Length=495

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WCE GEDAA+E L G   GF+  R+++Y  +RN+P KP  LSGLSPYLH+G ISAQRC L
Sbjct  227  WCEAGEDAALEALAGKSKGFVNIRIRNY-VNRNDPSKPTGLSGLSPYLHYGHISAQRCAL  285

Query  471  QAQQIQKSHPK  439
            +A++++K H K
Sbjct  286  EARKVRKVHTK  296


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            T++VD FLEELIVR  LA+NFC+YQP YD+L+GAW WA+++L  H+ DKRE VY
Sbjct  295  TKSVDAFLEELIVRGGLAENFCHYQPNYDNLKGAWGWAQESLRIHAKDKREVVY  348



>ref|XP_002489250.1| hypothetical protein SORBIDRAFT_0012s014620 [Sorghum bicolor]
 gb|EES20255.1| hypothetical protein SORBIDRAFT_0012s014620 [Sorghum bicolor]
Length=1445

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEH  29
            ++VD FLEELI+RRELADNFCYYQP YDSL GAWEWARKTLM+H
Sbjct  241  ESVDAFLEELIIRRELADNFCYYQPNYDSLAGAWEWARKTLMDH  284



>gb|AAT39131.1| type II CPD DNA photolyase [Zea mays]
Length=118

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  127  VRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            VRRELADNFCYYQPQYDSL GAWEWARKTL +H+ DKREH+Y
Sbjct  1    VRRELADNFCYYQPQYDSLAGAWEWARKTLTDHTGDKREHIY  42



>dbj|BAO57737.1| cyclobutane pyrimidine dimer photolyase [Marchantia polymorpha]
Length=597

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC PGEDAAME L+GSKNGFLT RL  Y   RN+P K  +LS +SPYLH+GQI+ QR  L
Sbjct  336  WCVPGEDAAMEHLLGSKNGFLTKRLAKYEF-RNDPTKTSSLSNISPYLHYGQIAPQRAAL  394

Query  471  QAQQIQKSHPKV  436
            + +  +K H K+
Sbjct  395  ECRNHRKQHLKM  406


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +  D+F EEL+VRREL++NFCYYQP YD+++GAW+WA+K+L EH++DKRE VY
Sbjct  405  KMADSFFEELVVRRELSENFCYYQPNYDNVKGAWDWAQKSLREHASDKREFVY  457



>ref|XP_005650117.1| CPD photolyase [Coccomyxa subellipsoidea C-169]
 gb|EIE25573.1| CPD photolyase [Coccomyxa subellipsoidea C-169]
Length=447

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 2/67 (3%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTT-RLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            W +PGEDAAME L+G K GFL+  RL  Y+T RNNP  PKALS LSP+LHFG +SAQR  
Sbjct  193  WVKPGEDAAMEALLGEK-GFLSKERLSIYNTKRNNPNFPKALSQLSPFLHFGHLSAQRAA  251

Query  474  LQAQQIQ  454
            L+A +++
Sbjct  252  LEASKLR  258


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +  + V+ F EE +VRREL+DN+C+Y P YD+L   + WAR+TL +H+ DKRE +Y
Sbjct  260  KFKEGVEAFNEECVVRRELSDNYCFYTPNYDTLDACYPWARETLQKHTADKREFIY  315



>gb|AAT39132.1| type II CPD DNA photolyase [Picea glauca]
Length=118

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  127  VRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            VRREL+DNFCYYQP YDSLQGA+EWAR TL+ H++DKREH+Y
Sbjct  1    VRRELSDNFCYYQPNYDSLQGAYEWARSTLLAHASDKREHIY  42



>emb|CAF97542.1| unnamed protein product [Tetraodon nigroviridis]
Length=508

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  193  IYVNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKR  14
            + V  G  +L   V +F+EEL+VRREL DNFC+Y  +YDS++GA+EWARKTL +H+ DKR
Sbjct  325  LQVQRGGRKLGVGVSSFIEELVVRRELTDNFCFYNEKYDSVEGAYEWARKTLKDHAKDKR  384

Query  13   EHVY  2
             ++Y
Sbjct  385  PYIY  388


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + +L      F+  RLK + + RN+P    ALS LSP++ FG +SAQR  L
Sbjct  271  WARPGAAAGLAML----ESFIDVRLKRFDSQRNDP-NAAALSQLSPWIRFGHVSAQRVAL  325

Query  471  QAQQ  460
            Q Q+
Sbjct  326  QVQR  329



>ref|XP_005851091.1| CPD photolyase [Chlorella variabilis]
 gb|EFN58989.1| CPD photolyase [Chlorella variabilis]
Length=444

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +V+ FLEELIVRRELADN+C+Y P YDSL  A++WAR+TL +H  DKREHVY
Sbjct  265  SVEGFLEELIVRRELADNYCFYVPNYDSLDAAYDWARQTLNDHRGDKREHVY  316


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTT--RLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRC  478
            WC PGEDAAME L G K GFL +  RL  Y   RN+P  P ALSGLSPYLHFG +S QR 
Sbjct  193  WCAPGEDAAMEALSGPK-GFLGSKARLARYEEKRNDPTVPDALSGLSPYLHFGHLSPQRA  251

Query  477  CLQAQQIQKSH  445
             ++A + +  H
Sbjct  252  AVEAARNKAVH  262



>gb|KGB42392.1| Deoxyribodipyrimidine photo-lyase, partial [Schistosoma haematobium]
Length=110

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE  +RREL+DNFCYY P+YDS++GAW+WA+ TL +H++DKR   Y
Sbjct  13   SVDAFVEEAFIRRELSDNFCYYNPKYDSIEGAWKWAQDTLAQHAHDKRNPSY  64



>gb|ADE60791.1| CPD photolyase [Trichoplusia ni]
Length=233

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + T++V+ FLEE IVRRELADNFC+Y   YDS++GA +WA+KTL +H  DKR H+Y
Sbjct  131  KYTESVNAFLEEAIVRRELADNFCFYCEHYDSIKGASQWAQKTLDDHRKDKRTHIY  186


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG D A+++L      FL  RLK ++T RN+P K  ALS LSP+ HFGQIS QR  L
Sbjct  69   WARPGYDEAVKML----KSFLDNRLKVFATKRNDPTK-DALSNLSPWFHFGQISVQRVAL  123

Query  471  QAQQ  460
              Q+
Sbjct  124  SVQE  127



>gb|ADE60793.1| CPD photolyase [Chrysodeixis chalcites]
Length=237

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + T++V+ FLEE IVRRELADNFC+Y   YDS++GA +WA+KTL +H  DKR H+Y
Sbjct  135  KYTESVNAFLEEAIVRRELADNFCFYCEHYDSIKGASQWAQKTLDDHRKDKRTHIY  190


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG D A+++L      FL  RLK ++T RN+P K  ALS LSP+ HFGQIS QR  L
Sbjct  73   WARPGYDEAVKML----KSFLENRLKVFATKRNDPTK-DALSNLSPWFHFGQISVQRVAL  127

Query  471  QAQQ  460
              Q+
Sbjct  128  CVQE  131



>gb|KFM75819.1| Deoxyribodipyrimidine photo-lyase, partial [Stegodyphus mimosarum]
Length=299

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +   +VD F+EE ++RRELADNFCYY  +YD + GA++WA+KTL +HS DKRE++Y
Sbjct  127  KYAASVDAFVEEAVIRRELADNFCYYNSKYDEVDGAYDWAKKTLKDHSKDKREYLY  182



>ref|XP_005763851.1| hypothetical protein EMIHUDRAFT_67418, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005769818.1| hypothetical protein EMIHUDRAFT_65967, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD11422.1| hypothetical protein EMIHUDRAFT_67418, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD17389.1| hypothetical protein EMIHUDRAFT_65967, partial [Emiliania huxleyi 
CCMP1516]
Length=509

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + +V +FLEE IVRREL+DNFC+Y+P YDSL GA  WAR++L  H++DKREHVY
Sbjct  278  SDSVASFLEESIVRRELSDNFCHYEPAYDSLDGAAGWARESLELHASDKREHVY  331



>ref|XP_009060728.1| hypothetical protein LOTGIDRAFT_125833 [Lottia gigantea]
 gb|ESO88680.1| hypothetical protein LOTGIDRAFT_125833 [Lottia gigantea]
Length=551

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  193  IYVNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKR  14
            I V +   +  ++V+ FLEE IVRRELADNFC+Y   YD+++GA+EWAR TL +H NDKR
Sbjct  359  IMVKEVKSKYKESVEGFLEEAIVRRELADNFCFYNKNYDNIEGAYEWARNTLKDHWNDKR  418

Query  13   EHVY  2
            E++Y
Sbjct  419  EYLY  422


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PG +  +E L      FL  R+K ++++RN P K + LS LSP+ HFGQ+S QR  +
Sbjct  305  WCKPGTNGGLETL----ESFLKDRIKYFNSERNKPDK-EVLSNLSPWFHFGQVSVQRSII  359

Query  471  QAQQIQKSH  445
              ++++  +
Sbjct  360  MVKEVKSKY  368



>ref|XP_002507183.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68441.1| predicted protein [Micromonas sp. RCC299]
Length=579

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQG-AWEWARKTLMEHSNDKREHVY  2
            +AVD FLEELIVRRELADNFC+Y P+YD+++G  +EWA++T+ EHS DKR ++Y
Sbjct  289  KAVDVFLEELIVRRELADNFCWYSPKYDTIEGQKYEWAKETVREHSKDKRAYLY  342


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PGE AA   L      FLT RLK Y   RN+P KP+ALSGLSPYLHFGQISAQRC L
Sbjct  224  WAVPGEFAAHATL----EHFLTRRLKYYE-HRNDPAKPQALSGLSPYLHFGQISAQRCAL  278

Query  471  QAQQIQKSHPK  439
            +A++  KS  K
Sbjct  279  EARRYAKSSNK  289



>ref|XP_003082644.1| class II DNA photolyase (ISS) [Ostreococcus tauri]
 emb|CAL56501.1| DNA photolyase, class 2 [Ostreococcus tauri]
Length=484

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +A+D++LEELI+RREL+DNFC Y P YDSL+GA +WA+ +L  H++DKRE+VY
Sbjct  308  EAIDSYLEELIIRRELSDNFCLYNPDYDSLRGASQWAQDSLALHASDKREYVY  360


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMG-SKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            W +PGE AA+  L+  S + FL  RL  Y  +RN P  P+A+S LSPYL+ GQ++ +R  
Sbjct  237  WIKPGEKAALASLLDPSVDSFLPDRLALYG-ERNKPTSPRAVSRLSPYLNHGQLAPRRAA  295

Query  474  LQAQQIQ  454
             +A Q++
Sbjct  296  WEAVQLR  302



>gb|EHJ68626.1| DNA photolyase [Danaus plexippus]
Length=487

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + T++V+++LEE IVRRELADNFC+Y   YDS++GA +WA+KTL +H NDKR H+Y
Sbjct  299  KYTESVNSYLEEAIVRRELADNFCFYCEHYDSIKGASQWAQKTLDDHRNDKRTHIY  354


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG D A++ L      FL  RLK ++T RN+P +  ALS LSP+ HFGQISAQR  L
Sbjct  237  WAGPGYDNAVKTL----KSFLDKRLKVFATKRNDPTQD-ALSNLSPWFHFGQISAQRVAL  291

Query  471  QAQQIQKSH  445
              ++ +  +
Sbjct  292  CVKEYKTKY  300



>ref|WP_035274114.1| deoxyribodipyrimidine photolyase [Desulfobulbus japonicus]
Length=437

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + ++ FLEELIVRREL+DNFC Y+PQYD+  G  EWA+KTL EH ND RE+VY
Sbjct  266  EKIEPFLEELIVRRELSDNFCLYEPQYDAFAGFPEWAQKTLNEHRNDPREYVY  318



>sp|P34205.1|PHR_CARAU RecName: Full=Deoxyribodipyrimidine photo-lyase; AltName: Full=DNA 
photolyase; AltName: Full=Photoreactivating enzyme [Carassius 
auratus]
 dbj|BAA01987.1| DNA photolyase [Carassius auratus]
Length=556

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V +F+EEL+VRRELADNFC+Y P YD++ GA++WA+KTL +H+ D R+++Y
Sbjct  369  SESVASFIEELVVRRELADNFCFYNPSYDNISGAYDWAKKTLQDHAKDSRQYLY  422


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M +L      F+  RL+ ++T RNNP    ALS LSP++H GQ+SAQR   
Sbjct  306  WAQPGTSGGMNML----ESFIDQRLRLFATHRNNP-NYDALSHLSPWIHTGQLSAQRVVK  360

Query  471  QAQQIQKSHPKVRS  430
            Q ++ + +   V S
Sbjct  361  QVKREKNASESVAS  374



>ref|XP_001845657.1| deoxyribodipyrimidine photo-lyase [Culex quinquefasciatus]
 gb|EDS41013.1| deoxyribodipyrimidine photo-lyase [Culex quinquefasciatus]
Length=510

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  166  LTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++ V +F EE IVRREL+DNFCYY   YD+L+GA++WARKTL +H  DKR HVY
Sbjct  332  FSEGVASFCEEAIVRRELSDNFCYYNKNYDNLKGAYDWARKTLDDHRKDKRTHVY  386


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    +  L     GF+  RL+ ++  RN+P    ALS LSP+ HFGQIS QR  L
Sbjct  269  WAVPGYTGGVATL----QGFVEKRLRKFNAKRNDPTD-DALSNLSPWFHFGQISVQRAIL  323

Query  471  QAQQIQK  451
              ++  K
Sbjct  324  AVKKYGK  330



>ref|XP_003227011.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Anolis carolinensis]
Length=535

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R  ++V+ F+EE ++RRELADNFC+Y P YD ++GA+EWA+ TL  H+ DKR H+Y
Sbjct  357  RCRESVEAFIEEALIRRELADNFCFYNPNYDKVEGAYEWAKTTLKLHATDKRPHLY  412


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A + VL      F+  RLK +S+DRNNP +  ALS LSP+ HFGQ+S QR  L
Sbjct  295  WAKPGSAAGLLVL----GEFVQERLKFFSSDRNNPNR-AALSNLSPWFHFGQVSVQRAIL  349

Query  471  QAQQ  460
            + ++
Sbjct  350  EVRK  353



>gb|AAD39433.1|AF129458_1 class II DNA photolyase [Chlamydomonas reinhardtii]
Length=612

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLT-TRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            WC PGE+AA+E L G + GFL+  RL  Y T RN+P  P ALSGLSPYLHFGQ++ QR  
Sbjct  267  WCTPGEEAALEALTGPR-GFLSPARLSLYDTKRNDPATPSALSGLSPYLHFGQLAPQRAA  325

Query  474  LQAQQ  460
            L+A +
Sbjct  326  LEAAK  330


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AV+++LEEL+VRRELADNFC+Y P YDSL+ A EWAR +L +H  DKRE +Y
Sbjct  338  AVESYLEELVVRRELADNFCHYCPTYDSLEAAAEWARDSLDKHRTDKREFLY  389



>ref|XP_008211914.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X6 [Nasonia 
vitripennis]
 ref|XP_008211915.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X6 [Nasonia 
vitripennis]
Length=504

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V+ F+EE IVRREL+DNFC+Y   YDSL+GA++WAR+TL +H NDKR+++Y
Sbjct  317  NKSVEAFMEEAIVRRELSDNFCFYNEHYDSLKGAYDWARETLNQHRNDKRDYIY  370


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    +  L    + FL  RL+ Y   RNNP+   ALS LSP+ HFG IS QRC L
Sbjct  253  WAKAGYKGGIAEL----DKFLKIRLRIYDEKRNNPI-FNALSNLSPWFHFGMISVQRCIL  307

Query  471  QAQQIQKSHPK  439
            +A++ +  + K
Sbjct  308  EAKKYKSQYNK  318



>ref|XP_008211911.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X2 [Nasonia 
vitripennis]
Length=562

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V+ F+EE IVRREL+DNFC+Y   YDSL+GA++WAR+TL +H NDKR+++Y
Sbjct  375  NKSVEAFMEEAIVRRELSDNFCFYNEHYDSLKGAYDWARETLNQHRNDKRDYIY  428


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    +  L    + FL  RL+ Y   RNNP+   ALS LSP+ HFG IS QRC L
Sbjct  311  WAKAGYKGGIAEL----DKFLKIRLRIYDEKRNNPI-FNALSNLSPWFHFGMISVQRCIL  365

Query  471  QAQQIQKSHPK  439
            +A++ +  + K
Sbjct  366  EAKKYKSQYNK  376



>ref|XP_008211912.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X3 [Nasonia 
vitripennis]
Length=552

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V+ F+EE IVRREL+DNFC+Y   YDSL+GA++WAR+TL +H NDKR+++Y
Sbjct  365  NKSVEAFMEEAIVRRELSDNFCFYNEHYDSLKGAYDWARETLNQHRNDKRDYIY  418


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    +  L    + FL  RL+ Y   RNNP+   ALS LSP+ HFG IS QRC L
Sbjct  301  WAKAGYKGGIAEL----DKFLKIRLRIYDEKRNNPI-FNALSNLSPWFHFGMISVQRCIL  355

Query  471  QAQQIQKSHPK  439
            +A++ +  + K
Sbjct  356  EAKKYKSQYNK  366



>ref|XP_010732065.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Larimichthys 
crocea]
Length=545

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Q+V +F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  372  QSVSSFIEELVVRRELTDNFCFYNKKYDSIEGAYEWAQKTLKDHAKDERPYIY  424


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A + +L      F+  RLK + T RN+P    ALS LSP++ FG +SAQR  L
Sbjct  307  WAKPGTKAGVVML----ESFIDVRLKLFETQRNDP-NAAALSQLSPWIRFGHLSAQRVAL  361

Query  471  QAQQ  460
            Q Q+
Sbjct  362  QVQR  365



>ref|XP_008211910.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X1 [Nasonia 
vitripennis]
Length=568

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V+ F+EE IVRREL+DNFC+Y   YDSL+GA++WAR+TL +H NDKR+++Y
Sbjct  381  NKSVEAFMEEAIVRRELSDNFCFYNEHYDSLKGAYDWARETLNQHRNDKRDYIY  434


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    +  L    + FL  RL+ Y   RNNP+   ALS LSP+ HFG IS QRC L
Sbjct  317  WAKAGYKGGIAEL----DKFLKIRLRIYDEKRNNPI-FNALSNLSPWFHFGMISVQRCIL  371

Query  471  QAQQIQKSHPK  439
            +A++ +  + K
Sbjct  372  EAKKYKSQYNK  382



>ref|XP_001603285.2| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X4 [Nasonia 
vitripennis]
Length=546

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V+ F+EE IVRREL+DNFC+Y   YDSL+GA++WAR+TL +H NDKR+++Y
Sbjct  359  NKSVEAFMEEAIVRRELSDNFCFYNEHYDSLKGAYDWARETLNQHRNDKRDYIY  412


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    +  L    + FL  RL+ Y   RNNP+   ALS LSP+ HFG IS QRC L
Sbjct  295  WAKAGYKGGIAEL----DKFLKIRLRIYDEKRNNPI-FNALSNLSPWFHFGMISVQRCIL  349

Query  471  QAQQIQKSHPK  439
            +A++ +  + K
Sbjct  350  EAKKYKSQYNK  360



>ref|XP_007511873.1| CPD photolyase [Bathycoccus prasinos]
 emb|CCO65961.1| CPD photolyase [Bathycoccus prasinos]
Length=645

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQG-AWEWARKTLMEHSNDKREHVY  2
            +AVD F EEL+VRRELADNFCYY PQYD+++G  ++WA+ TL  H+ DKRE+ Y
Sbjct  426  KAVDVFFEELVVRRELADNFCYYSPQYDTIEGQKYDWAKDTLRMHAGDKREYTY  479


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PGE AAM VL    + FLT R+  Y   RN+P KP+ALSGLSPYLHFGQIS QRC +
Sbjct  360  WAVPGEKAAMAVL----DNFLTKRMSLYGL-RNDPAKPQALSGLSPYLHFGQISGQRCAM  414

Query  471  QAQQIQK  451
            +A + +K
Sbjct  415  KALEAKK  421



>ref|XP_008211913.1| PREDICTED: deoxyribodipyrimidine photo-lyase isoform X5 [Nasonia 
vitripennis]
Length=529

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V+ F+EE IVRREL+DNFC+Y   YDSL+GA++WAR+TL +H NDKR+++Y
Sbjct  342  NKSVEAFMEEAIVRRELSDNFCFYNEHYDSLKGAYDWARETLNQHRNDKRDYIY  395


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    +  L    + FL  RL+ Y   RNNP+   ALS LSP+ HFG IS QRC L
Sbjct  278  WAKAGYKGGIAEL----DKFLKIRLRIYDEKRNNPI-FNALSNLSPWFHFGMISVQRCIL  332

Query  471  QAQQIQKSHPK  439
            +A++ +  + K
Sbjct  333  EAKKYKSQYNK  343



>ref|XP_003975844.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Takifugu rubripes]
Length=538

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AV +F+EEL+VRREL DNFC+Y   YDS++GA EWARKTL +H+ DKR ++Y
Sbjct  365  AVSSFIEELVVRRELTDNFCFYNENYDSVEGAHEWARKTLKDHAKDKRPYIY  416


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A + +L      F+  RLK + + RN+P    ALS +SP++ FG +SAQR  L
Sbjct  299  WAKPGAGAGLAML----ESFIDERLKLFDSQRNDP-NAAALSQMSPWIRFGHVSAQRVAL  353

Query  471  QAQQ  460
            Q Q+
Sbjct  354  QVQR  357



>ref|WP_014559387.1| deoxyribodipyrimidine photo-lyase [Ignavibacterium album]
 gb|AFH48229.1| Deoxyribodipyrimidine photolyase [Ignavibacterium album JCM 16511]
Length=447

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +  +FLEELIVRREL+DNFCY+ P+YDS +G  +WA+KTL EH  DKRE VY
Sbjct  278  SAKSFLEELIVRRELSDNFCYFNPKYDSFEGFPDWAKKTLNEHRKDKREFVY  329


 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 45/74 (61%), Gaps = 5/74 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PGE  A  VL      FL  R  +Y+ DRN+P K  ALS LSPYLHFGQISAQR  L
Sbjct  213  WLKPGEANAQIVL----KDFLENRFDNYAEDRNDPNK-NALSNLSPYLHFGQISAQRVAL  267

Query  471  QAQQIQKSHPKVRS  430
              +Q   +HP  +S
Sbjct  268  TVEQFYGNHPSAKS  281



>ref|WP_043793639.1| deoxyribodipyrimidine photolyase [Desulfovibrio fructosivorans]
Length=446

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R  +  D FLEEL+VRRELADNFC Y+P+YDS +   EWARKTL  H+ D R ++Y
Sbjct  270  RAKEGADAFLEELVVRRELADNFCLYEPEYDSFEALPEWARKTLAAHAADSRPYLY  325


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = -3

Query  642  PGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            PG  AA +VL    + FL  RL+ Y+  RN+P    A SGLSPY HFGQ++ QR  L
Sbjct  211  PGSAAATQVL----DDFLRDRLEGYAARRNDP-NAGATSGLSPYFHFGQLAPQRAAL  262



>ref|NP_001089127.1| CPD photolyase-like [Xenopus laevis]
 dbj|BAE46749.1| CPD photolyase-like [Xenopus laevis]
 gb|AAI33745.1| LOC733427 protein [Xenopus laevis]
Length=557

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +  ++VD+F+EE +VRRELADNFC+Y   YD ++GA++WA+ TL +H+ DKR H+Y
Sbjct  379  KFKESVDSFVEEAVVRRELADNFCFYNKNYDKIEGAYDWAKNTLKDHAKDKRTHLY  434


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG +A   VL      F++ RLK +++DRNNP    ALS LSP+ HFGQ+S QR  L
Sbjct  317  WAKPGTNAGFNVL----QSFISERLKHFNSDRNNP-NQNALSNLSPWFHFGQLSVQRAIL  371

Query  471  QAQQ  460
            + Q+
Sbjct  372  EVQK  375



>gb|EFL52891.1| deoxyribodipyrimidine photolyase [Desulfovibrio fructosivorans 
JJ]
Length=453

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R  +  D FLEEL+VRRELADNFC Y+P+YDS +   EWARKTL  H+ D R ++Y
Sbjct  277  RAKEGADAFLEELVVRRELADNFCLYEPEYDSFEALPEWARKTLAAHAADSRPYLY  332


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = -3

Query  642  PGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            PG  AA +VL    + FL  RL+ Y+  RN+P    A SGLSPY HFGQ++ QR  L
Sbjct  218  PGSAAATQVL----DDFLRDRLEGYAARRNDP-NAGATSGLSPYFHFGQLAPQRAAL  269



>ref|XP_008283888.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Stegastes 
partitus]
Length=548

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +V +F+EEL+VRREL DNFC+Y  +YDS++GA+EWARKTL +H+ DKR ++Y
Sbjct  376  SVASFIEELVVRRELTDNFCFYNEKYDSVEGAYEWARKTLKDHAKDKRPYLY  427


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A M +L      F+  RLK + T RN+P  P ALS LSP++ FG ISAQR  L
Sbjct  310  WAKPGTKAGMAML----ESFIDVRLKLFDTQRNDPNAP-ALSQLSPWIRFGHISAQRVAL  364

Query  471  QAQQ  460
            Q Q+
Sbjct  365  QVQR  368



>gb|ADZ46042.1| CPD photolyase, partial [Dunaliella tertiolecta]
Length=236

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +AVD FLEEL+VRRELADNFC Y P YDSL  A EWA+++L  H  DKRE +Y
Sbjct  154  EAVDGFLEELVVRRELADNFCEYTPNYDSLDCAAEWAKESLNVHRTDKREKLY  206


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLT-TRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            W +PGE A+   L G + GFLT +RL  YS  RN+P   KALS LSPYLHFGQ+ AQR  
Sbjct  85   WVKPGETASKLALEGPE-GFLTPSRLAQYSAKRNDP-SAKALSNLSPYLHFGQLLAQRIA  142

Query  474  LQAQQ  460
            L A +
Sbjct  143  LSASK  147



>ref|XP_002953304.1| class II photolyase [Volvox carteri f. nagariensis]
 gb|EFJ45614.1| class II photolyase [Volvox carteri f. nagariensis]
Length=589

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            WC+PGEDAA++ L G      +TRL  Y + RN+P  P+ALS LSPYLHFGQ++ QR  L
Sbjct  268  WCKPGEDAALQALQGPAGFLSSTRLSLYDSKRNDPATPRALSNLSPYLHFGQLAPQRAAL  327

Query  471  QAQQ  460
            +A +
Sbjct  328  EAAK  331


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +   AV++FLEEL+VRREL+DNFC+Y P YDSL  A EWAR+TL +H  DKRE +Y
Sbjct  335  KFKAAVESFLEELVVRRELSDNFCHYTPNYDSLACAAEWARETLEKHRGDKREFLY  390



>dbj|BAE48230.1| CPD photolyase [Chlorella pyrenoidosa]
Length=448

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLT-TRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            WC+PGEDAAME L G K GFL+  RL  Y   RN+P    ALS LSPYLHFG ++ QR  
Sbjct  194  WCKPGEDAAMEALAGGK-GFLSKARLSKYDAQRNDPTVADALSNLSPYLHFGHLAPQRAA  252

Query  474  LQAQQIQKSH  445
            ++A + + +H
Sbjct  253  IEAAKHKSTH  262


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +V+ FLEEL+VRREL+DN+C+Y   YDSL  A++WAR+TL +H NDKREHVY
Sbjct  265  SVEGFLEELVVRRELSDNYCHYVENYDSLDAAYDWARQTLNDHRNDKREHVY  316



>ref|XP_007441920.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Python 
bivittatus]
Length=424

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R  ++V+ F+EE +VRRELADNFC+Y P YD ++GA++WA+ TL  H+ DKR H+Y
Sbjct  246  RYKESVEGFIEEAVVRRELADNFCFYNPNYDKIEGAYDWAKTTLKIHAKDKRPHLY  301


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  + ++VL      F+  RLK +++ RNNP    ALS LSP+  FGQ++ QR  L
Sbjct  184  WAKPGAASGLKVL----EEFVKERLKHFASGRNNP-NQAALSNLSPWFRFGQVAVQRAIL  238

Query  471  QA  466
            + 
Sbjct  239  EV  240



>emb|CAX73098.1| photorepair [Schistosoma japonicum]
Length=530

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE  +RREL+DNFCYY P+YDS++GAW+WA+ TL +H++DKR   Y
Sbjct  360  SVDAFVEEAFIRRELSDNFCYYNPKYDSMEGAWKWAQDTLTQHAHDKRNPSY  411



>ref|XP_008431493.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Poecilia reticulata]
Length=547

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V  F+EEL+VRREL DNFC+Y  +YD ++GA+EWA+KTL +H+ DKRE++Y
Sbjct  373  SESVAAFIEELVVRRELTDNFCFYNEKYDKVEGAYEWAQKTLKDHAKDKREYIY  426


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG +A M +L      F+  RLK ++T RN+P    ALS LSP++ FGQ+SAQR  L
Sbjct  309  WAKPGSEAGMAML----ESFIDVRLKLFATQRNDP-NMAALSQLSPWIRFGQLSAQRVAL  363

Query  471  QAQQ  460
            Q ++
Sbjct  364  QVRR  367



>ref|XP_002502908.1| DNA photolyase, partial [Micromonas sp. RCC299]
 gb|ACO64166.1| DNA photolyase, partial [Micromonas sp. RCC299]
Length=478

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -3

Query  642  PGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCLQAQ  463
            PGE AA+  L G+   FL  RL  Y + RN+P  P+ALSGLSPYLHFGQ+SAQRC ++A 
Sbjct  239  PGETAALAALFGTSASFLPNRLALYGS-RNDPNVPEALSGLSPYLHFGQLSAQRCAVEAT  297

Query  462  QIQKSHPK  439
            + +  HP+
Sbjct  298  KHRAKHPE  305


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             +AVD+FLEELIVRRELADNFC + P YDS+ GA  WAR++L  H++D RE  Y
Sbjct  304  PEAVDSFLEELIVRRELADNFCLHNPHYDSIAGAPGWARESLALHASDAREFAY  357



>emb|CCD58864.1| DNA photolyase, putative [Schistosoma mansoni]
Length=533

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE  +RREL+DNFCYY P+YDS++GAW+WA+ TL +H++DKR   Y
Sbjct  363  SVDAFVEEAFIRRELSDNFCYYNPKYDSIEGAWKWAQDTLAQHAHDKRNPSY  414



>gb|KIY94077.1| deoxyribodipyrimidine photo-lyase [Monoraphidium neglectum]
Length=328

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLT-TRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            WC PGED A + L+G + GFLT  RL  Y   RN+P +P+ALS LSP+LHFGQ+S QR  
Sbjct  253  WCTPGEDGAHDALLG-EQGFLTPARLALYDAKRNDPGEPQALSNLSPWLHFGQLSTQRAA  311

Query  474  LQAQQIQ  454
            L+A +++
Sbjct  312  LEAAKLR  318



>ref|XP_003390970.2| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Amphimedon 
queenslandica]
Length=332

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V  ++EE +VRRELADNFCYY P YDS+ GA +WA+ TL  H  DKRE++Y
Sbjct  141  SESVSAYIEEAVVRRELADNFCYYNPHYDSISGAAQWAQDTLKAHKKDKREYIY  194


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG +A ++VL    + F T RLK ++  RN+P K  +LS LSP+ HFGQI  QR  L
Sbjct  77   WATPGTNAGLKVL----DEFCTKRLKFFAAQRNDPNK-DSLSNLSPWFHFGQIGVQRTIL  131

Query  471  QAQQIQKSH  445
            + +     H
Sbjct  132  KVKSYSSKH  140



>ref|XP_004930027.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Bombyx mori]
Length=497

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + T++V+ FLEE IVRRELADNFC+Y   YDS++GA  WA+KTL +H  DKR H+Y
Sbjct  315  KFTESVNAFLEEAIVRRELADNFCFYCEHYDSVKGASAWAQKTLDDHRKDKRTHIY  370


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG D A++++      FL  RL  Y++ RN+P +  ALS LSP+ HFGQIS QR  L
Sbjct  253  WAKPGYDEAVKMM----KSFLDKRLNIYASKRNDPTQD-ALSNLSPWFHFGQISVQRVAL  307

Query  471  QAQQIQ  454
              Q+ +
Sbjct  308  CVQEYK  313



>ref|XP_005939131.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X1 
[Haplochromis burtoni]
Length=558

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q+V  F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  384  SQSVPAFIEELVVRRELTDNFCFYNKKYDSVEGAYEWAQKTLKDHAKDQRPYLY  437


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A M++L      F+  RLK + + RN+P  P ALS LSP+L FGQISAQR   
Sbjct  320  WAKPGTKAGMDML----ESFIDVRLKLFGSQRNDPNAP-ALSQLSPWLRFGQISAQRVAW  374

Query  471  QAQQ  460
            Q Q+
Sbjct  375  QVQR  378



>gb|AIE57497.1| CPD photolyase, partial [Platynereis dumerilii]
Length=526

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +  + V+ ++EE I+RRELADNFCYY   YD++ GA+EWARKTL +H  DKR H+Y
Sbjct  350  KYKEGVEGYIEEGIIRRELADNFCYYNENYDNIDGAYEWARKTLNDHKKDKRTHIY  405


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    +  L      F+  RLK ++ DRN+P K  ALS +SP+ HFGQ+S QR  L
Sbjct  288  WVTPGTTGGLRNL----ESFIKQRLKYFNADRNDPNK-NALSHMSPWYHFGQVSVQRGML  342

Query  471  QAQQIQKSH  445
              +Q +  +
Sbjct  343  MVRQYRNKY  351



>ref|XP_011484602.1| PREDICTED: photolyase isoform X2 [Oryzias latipes]
Length=558

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + +V  F+EEL+VRREL DNFC+Y   YDS+ GA+EWA+KTL +H+ DKRE++Y
Sbjct  384  SPSVPAFIEELVVRRELTDNFCFYNKNYDSVTGAYEWAQKTLKDHAKDKREYLY  437


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG +A + +L      F+  RLK + T RN+P    ALS LSP+L FGQ+SAQR  L
Sbjct  323  WAKPGTEAGLAML----ESFIDVRLKLFGTQRNDP-NAAALSQLSPWLRFGQLSAQRVAL  377

Query  471  QAQQ  460
            Q ++
Sbjct  378  QVRK  381



>ref|XP_005939133.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X3 
[Haplochromis burtoni]
Length=511

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q+V  F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  337  SQSVPAFIEELVVRRELTDNFCFYNKKYDSVEGAYEWAQKTLKDHAKDQRPYLY  390


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A M++L      F+  RLK + + RN+P  P ALS LSP+L FGQISAQR   
Sbjct  273  WAKPGTKAGMDML----ESFIDVRLKLFGSQRNDPNAP-ALSQLSPWLRFGQISAQRVAW  327

Query  471  QAQQ  460
            Q Q+
Sbjct  328  QVQR  331



>ref|NP_001098271.1| photolyase [Oryzias latipes]
 dbj|BAA05043.1| photolyase [Oryzias latipes]
Length=504

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + +V  F+EEL+VRREL DNFC+Y   YDS+ GA+EWA+KTL +H+ DKRE++Y
Sbjct  330  SPSVPAFIEELVVRRELTDNFCFYNKNYDSVTGAYEWAQKTLKDHAKDKREYLY  383


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = -3

Query  648  CEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCLQ  469
             +PG +A + +L      F+  RLK + T RN+P    ALS LSP+L FGQ+SAQR  LQ
Sbjct  270  AKPGTEAGLAML----ESFIDVRLKLFGTQRNDP-NAAALSQLSPWLRFGQLSAQRVALQ  324

Query  468  AQQ  460
             ++
Sbjct  325  VRK  327



>ref|XP_011484603.1| PREDICTED: photolyase isoform X3 [Oryzias latipes]
Length=543

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + +V  F+EEL+VRREL DNFC+Y   YDS+ GA+EWA+KTL +H+ DKRE++Y
Sbjct  369  SPSVPAFIEELVVRRELTDNFCFYNKNYDSVTGAYEWAQKTLKDHAKDKREYLY  422


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG +A + +L      F+  RLK + T RN+P    ALS LSP+L FGQ+SAQR  L
Sbjct  308  WAKPGTEAGLAML----ESFIDVRLKLFGTQRNDP-NAAALSQLSPWLRFGQLSAQRVAL  362

Query  471  QAQQ  460
            Q ++
Sbjct  363  QVRK  366



>emb|CDQ80029.1| unnamed protein product [Oncorhynchus mykiss]
Length=466

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++V +F EEL+VRREL DNFCYY P YDS++GA +WA+KTL +H+ D R +VY
Sbjct  340  ESVSSFTEELVVRRELTDNFCYYNPSYDSVKGANDWAQKTLKDHAKDPRPYVY  392


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 5/63 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G  A + +L      F+  RLK+++T RNNP    A+S LSP++ FG +SAQR  L
Sbjct  275  WAKSGTAAGIAML----ESFIDLRLKNFATQRNNP-NSSAVSQLSPWIRFGHLSAQRVVL  329

Query  471  QAQ  463
            Q +
Sbjct  330  QVK  332



>ref|XP_005939132.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X2 
[Haplochromis burtoni]
Length=557

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q+V  F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  383  SQSVPAFIEELVVRRELTDNFCFYNKKYDSVEGAYEWAQKTLKDHAKDQRPYLY  436


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A M++L      F+  RLK + + RN+P  P ALS LSP+L FGQISAQR   
Sbjct  319  WAKPGTKAGMDML----ESFIDVRLKLFGSQRNDPNAP-ALSQLSPWLRFGQISAQRVAW  373

Query  471  QAQQ  460
            Q Q+
Sbjct  374  QVQR  377



>ref|XP_011484604.1| PREDICTED: photolyase isoform X1 [Oryzias latipes]
Length=504

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + +V  F+EEL+VRREL DNFC+Y   YDS+ GA+EWA+KTL +H+ DKRE++Y
Sbjct  330  SPSVPAFIEELVVRRELTDNFCFYNKNYDSVTGAYEWAQKTLKDHAKDKREYLY  383


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG +A + +L      F+  RLK + T RN+P    ALS LSP+L FGQ+SAQR  L
Sbjct  269  WAKPGTEAGLAML----ESFIDVRLKLFGTQRNDP-NAAALSQLSPWLRFGQLSAQRVAL  323

Query  471  QAQQ  460
            Q ++
Sbjct  324  QVRK  327



>emb|CDI97220.1| deoxyribodipyrimidine photo lyase [Echinococcus multilocularis]
Length=537

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++ D F+EE  VRREL+DNFCYY P YDS++GAW WA++TL +H+ND R+  Y
Sbjct  355  ESTDAFMEEAFVRRELSDNFCYYNPNYDSIKGAWSWAQETLRKHANDLRKPSY  407


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G  A +  L      FL  RL++Y+T RN+P K KALS LSP+LHFG ISAQRC  
Sbjct  290  WAKGGAKAGLSQLFS----FLHHRLRAYATHRNDPTK-KALSNLSPWLHFGHISAQRCLW  344

Query  471  QAQQIQKSH  445
            +    +  H
Sbjct  345  EVNLRRSLH  353



>ref|XP_004570537.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Maylandia 
zebra]
Length=557

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q+V  F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  383  SQSVPAFIEELVVRRELTDNFCFYNKKYDSVEGAYEWAQKTLKDHAKDERPYLY  436


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A M++L      F+  RLK + + RN+P  P ALS LSP+L FGQISAQR   
Sbjct  319  WAKPGTKAGMDML----ESFIDVRLKLFGSQRNDPNAP-ALSQLSPWLRFGQISAQRVAW  373

Query  471  QAQQ  460
            Q Q+
Sbjct  374  QVQR  377



>ref|XP_005752546.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Pundamilia 
nyererei]
Length=557

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q+V  F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  383  SQSVPAFIEELVVRRELTDNFCFYNKKYDSVEGAYEWAQKTLKDHAKDERPYLY  436


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  A M++L      F+  RLK + + RN+P  P ALS LSP+L FGQISAQR   
Sbjct  319  WAKPGTKAGMDML----ESFIDVRLKLFGSQRNDPNAP-ALSQLSPWLRFGQISAQRVAW  373

Query  471  QAQQ  460
            Q Q+
Sbjct  374  QVQR  377



>ref|XP_010781206.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X2 
[Notothenia coriiceps]
Length=549

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AV +F+EEL+VRREL DNFC+Y  +YD ++GA+EWA+KTL +H+ DKRE++Y
Sbjct  377  AVASFIEELVVRRELTDNFCFYNEKYDRVEGAYEWAQKTLKDHAEDKREYLY  428


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    + +L      F+  RLK ++T RN+P    ALS LSP++ FGQ+SAQR  L
Sbjct  311  WAKPGTKGGVAML----ESFIDERLKLFATQRNDP-NAAALSQLSPWIRFGQLSAQRVAL  365

Query  471  QAQQ  460
            Q QQ
Sbjct  366  QVQQ  369



>gb|EUB56980.1| Deoxyribodipyrimidine photo-lyase [Echinococcus granulosus]
Length=585

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++ D F+EE  VRREL+DNFCYY P YDS++GAW WA++TL +H+ND R+  Y
Sbjct  355  ESTDAFMEEAFVRRELSDNFCYYNPNYDSIKGAWSWAQETLRKHANDLRKPSY  407


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G  A +  L      FL  RL++Y+T RN+P K KALS LSP+LHFG ISAQRC  
Sbjct  290  WAKGGAKAGLSQLFS----FLHHRLRAYATHRNDPTK-KALSNLSPWLHFGHISAQRCLW  344

Query  471  QAQQIQKSH  445
            +    +  H
Sbjct  345  EVNLRRSLH  353



>ref|XP_007555082.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Poecilia formosa]
Length=667

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V  F+EEL+VRREL DNFC+Y  +YD ++GA+EWA+KTL +H+ DKRE +Y
Sbjct  493  SESVAAFIEELVVRRELTDNFCFYNEKYDKVEGAYEWAQKTLKDHAKDKREFIY  546


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 5/68 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG +A M +L      F+  RLK ++T RN+P    ALS LSP++ FGQ+SAQR  L
Sbjct  429  WAKPGSEAGMAML----ESFIDVRLKLFATQRNDP-NMAALSQLSPWIRFGQLSAQRVAL  483

Query  471  QAQQIQKS  448
            Q ++  K+
Sbjct  484  QVRRCGKN  491



>ref|XP_010781205.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X1 
[Notothenia coriiceps]
Length=549

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            AV +F+EEL+VRREL DNFC+Y  +YD ++GA+EWA+KTL +H+ DKRE++Y
Sbjct  377  AVASFIEELVVRRELTDNFCFYNEKYDRVEGAYEWAQKTLKDHAEDKREYLY  428


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    + +L      F+  RLK ++T RN+P     LS LSP++ FGQ+SAQR  L
Sbjct  311  WAMPGTKGGVAML----ESFIDERLKLFATQRNDP-NIAGLSQLSPWIRFGQLSAQRVAL  365

Query  471  QAQQ  460
            Q QQ
Sbjct  366  QVQQ  369



>emb|CDS21501.1| deoxyribodipyrimidine photo lyase [Echinococcus granulosus]
Length=520

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++ D F+EE  VRREL+DNFCYY P YDS++GAW WA++TL +H+ND R+  Y
Sbjct  355  ESTDAFMEEAFVRRELSDNFCYYNPNYDSIKGAWSWAQETLRKHANDLRKPSY  407


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G  A +  L      FL  RL++Y+T RN+P K KALS LSP+LHFG ISAQRC  
Sbjct  290  WAKGGAKAGLSQLFS----FLHHRLRAYATHRNDPTK-KALSNLSPWLHFGHISAQRCLW  344

Query  471  QAQQIQKSH  445
            +    +  H
Sbjct  345  EVNLRRSLH  353



>gb|ELT97477.1| hypothetical protein CAPTEDRAFT_152478 [Capitella teleta]
Length=504

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  193  IYVNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKR  14
            + VN+   + +++V  ++EE ++RREL DN+C+YQP YD++ GA+EWAR TL  H  DKR
Sbjct  317  LMVNEMKTKYSKSVAAYIEEGVIRRELCDNYCFYQPNYDNIDGAYEWARLTLKAHRKDKR  376

Query  13   EHVY  2
            E+VY
Sbjct  377  EYVY  380


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A ++ L      F+  RL ++  DRNNP K  ALS +SP+ HFG ++ QR  L
Sbjct  263  WATPGTTAGLKNL----ESFIQKRLGNFDADRNNPNK-NALSNMSPWFHFGHVAPQRAML  317

Query  471  QAQQIQKSHPK  439
               +++  + K
Sbjct  318  MVNEMKTKYSK  328



>ref|WP_015850844.1| deoxyribodipyrimidine photo-lyase [Desulfovibrio salexigens]
 gb|ACS79025.1| deoxyribodipyrimidine photolyase [Desulfovibrio salexigens DSM 
2638]
Length=445

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD++LEELI+RREL+DNFC + P YDSL  A EWA+KTL EHS D+R ++Y
Sbjct  276  ESVDSYLEELIIRRELSDNFCLHTPNYDSLDAAPEWAQKTLSEHSADRRAYLY  328



>ref|XP_003438096.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X1 
[Oreochromis niloticus]
Length=511

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q++  F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  337  SQSIPAFIEELVVRRELTDNFCFYNKKYDSVEGAYEWAQKTLKDHAKDERPYLY  390


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M++L      F+  RLK + + RN+P  P ALS LSP+L FGQISAQR   
Sbjct  273  WAKPGTKPGMDML----ESFIDVRLKLFGSQRNDPNAP-ALSQLSPWLRFGQISAQRVAW  327

Query  471  QAQQ  460
            Q Q+
Sbjct  328  QVQR  331



>ref|XP_002190613.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Taeniopygia 
guttata]
Length=697

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  524  SVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPYLY  575


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+ST RN+P K  ALS LSP+LHFGQ+S QR  L
Sbjct  458  WATPGTAAGMAVL----KSFIAERLKSFSTHRNDPNK-AALSNLSPWLHFGQVSTQRAIL  512

Query  471  QAQQIQKSH  445
            + Q+ ++++
Sbjct  513  EVQKQRRNY  521



>ref|NP_957358.1| uncharacterized protein LOC394039 [Danio rerio]
 gb|AAH54710.1| Zgc:66475 [Danio rerio]
Length=516

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V +F+EE++VRRELADNFC+Y   YD++ GA++WA+KTL EH+ D+R+++Y
Sbjct  332  SESVASFIEEIVVRRELADNFCFYNQNYDNISGAYDWAKKTLQEHAKDRRQYLY  385


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 8/83 (10%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M +L      F+  RL  ++T RNNP    A+S LSP++H GQ+SAQR  +
Sbjct  269  WAQPGTTGGMFML----ESFIDQRLHIFATHRNNP-NSDAVSHLSPWIHAGQLSAQRVVM  323

Query  471  QAQQIQKSHPKVRSK*LFIHVIC  403
            Q ++ + +   V S   FI  I 
Sbjct  324  QVKRKKNASESVAS---FIEEIV  343



>ref|XP_003390874.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Amphimedon 
queenslandica]
Length=462

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V  ++EE +VRRELADNFCYY P YDS+ GA +WA+ TL  H  DKRE++Y
Sbjct  311  SESVSAYIEEAVVRRELADNFCYYNPHYDSISGAAQWAQDTLKAHKKDKREYIY  364


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG +A ++VL    + F T RLK ++  RN+P K  +LS LSP+ HFGQ+  QR  L
Sbjct  247  WATPGTNAGLKVL----DDFCTKRLKFFAAQRNDPNK-DSLSNLSPWFHFGQVGVQRAIL  301

Query  471  QAQQIQKSH  445
            + +     H
Sbjct  302  KVKSYSSKH  310



>ref|XP_005168472.1| PREDICTED: uncharacterized protein LOC394039 isoform X2 [Danio 
rerio]
Length=526

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V +F+EE++VRRELADNFC+Y   YD++ GA++WA+KTL EH+ D+R+++Y
Sbjct  342  SESVASFIEEIVVRRELADNFCFYNQNYDNISGAYDWAKKTLQEHAKDRRQYLY  395


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 8/83 (10%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M +L      F+  RL  ++T RNNP    A+S LSP++H GQ+SAQR  +
Sbjct  279  WAQPGTTGGMFML----ESFIDQRLHIFATHRNNP-NSDAVSHLSPWIHAGQLSAQRVVM  333

Query  471  QAQQIQKSHPKVRSK*LFIHVIC  403
            Q ++ + +   V S   FI  I 
Sbjct  334  QVKRKKNASESVAS---FIEEIV  353



>ref|XP_005802444.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Xiphophorus 
maculatus]
Length=506

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V  F+EEL+VRREL DNFC+Y  +YD ++GA+EWA+KTL +H+ DKR+++Y
Sbjct  332  SESVAAFIEELVVRRELTDNFCFYNEKYDKVEGAYEWAQKTLKDHAKDKRDNIY  385


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 5/68 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG +A M +L      F+  RLK ++T RN+P    ALS LSP++ FGQ+SAQR  L
Sbjct  268  WAKPGSEAGMAML----ESFIDVRLKLFATQRNDP-NTAALSQLSPWIRFGQLSAQRVAL  322

Query  471  QAQQIQKS  448
            Q ++  K+
Sbjct  323  QVRRCGKN  330



>ref|XP_005476033.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X2 
[Oreochromis niloticus]
Length=557

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +Q++  F+EEL+VRREL DNFC+Y  +YDS++GA+EWA+KTL +H+ D+R ++Y
Sbjct  383  SQSIPAFIEELVVRRELTDNFCFYNKKYDSVEGAYEWAQKTLKDHAKDERPYLY  436


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M++L      F+  RLK + + RN+P  P ALS LSP+L FGQISAQR   
Sbjct  319  WAKPGTKPGMDML----ESFIDVRLKLFGSQRNDPNAP-ALSQLSPWLRFGQISAQRVAW  373

Query  471  QAQQ  460
            Q Q+
Sbjct  374  QVQR  377



>ref|XP_005168471.1| PREDICTED: uncharacterized protein LOC394039 isoform X1 [Danio 
rerio]
Length=534

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V +F+EE++VRRELADNFC+Y   YD++ GA++WA+KTL EH+ D+R+++Y
Sbjct  350  SESVASFIEEIVVRRELADNFCFYNQNYDNISGAYDWAKKTLQEHAKDRRQYLY  403


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 8/83 (10%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M +L      F+  RL  ++T RNNP    A+S LSP++H GQ+SAQR  +
Sbjct  287  WAQPGTTGGMFML----ESFIDQRLHIFATHRNNP-NSDAVSHLSPWIHAGQLSAQRVVM  341

Query  471  QAQQIQKSHPKVRSK*LFIHVIC  403
            Q ++ + +   V S   FI  I 
Sbjct  342  QVKRKKNASESVAS---FIEEIV  361



>ref|XP_003078467.1| class II DNA photolyase (ISS), partial [Ostreococcus tauri]
Length=297

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 6/71 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PGE AA  VL    + F+  R+K Y   RN+P KP+ALSGLSP+LHFGQISAQRC L
Sbjct  200  WAIPGETAARAVL----DDFVANRMKLYEK-RNDPSKPRALSGLSPWLHFGQISAQRCAL  254

Query  471  QAQQ-IQKSHP  442
            +A++ + K+ P
Sbjct  255  EAKKAVGKASP  265



>ref|XP_004347271.1| deoxyribodipyrimidine photo-lyase [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE93780.1| deoxyribodipyrimidine photo-lyase [Capsaspora owczarzaki ATCC 
30864]
Length=634

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  178  GYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             + R  ++VD F+EE +VRREL+DNFC+Y P YDS+ GA  WA++TL  H+ D RE VY
Sbjct  421  AHARCRESVDVFVEEALVRRELSDNFCFYNPNYDSIAGASAWAQETLQAHAGDAREFVY  479



>ref|XP_003388746.2| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Amphimedon 
queenslandica]
Length=502

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++V  ++EE +VRRELADNFCYY P YDS+ GA +WA+ TL  H  DKRE++Y
Sbjct  311  SESVSAYIEEAVVRRELADNFCYYNPHYDSISGAAQWAQDTLKAHKKDKREYIY  364


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG +A ++VL    + F T RLK ++  RN+P K  +LS LSP+ HFGQ+  QR  L
Sbjct  247  WATPGTNAGLKVL----DDFCTKRLKFFAAQRNDPNK-DSLSNLSPWYHFGQVGVQRAIL  301

Query  471  QAQQIQKSH  445
            + +     H
Sbjct  302  KVKSYSSKH  310



>gb|AGH70335.1| CPD photolyase [Chlamydomonas sp. ICE-L]
Length=579

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +  +AV++FLEE++VRREL+DNFC Y P YDSL+ A EWA+++L  H+ DKRE++Y
Sbjct  307  KFKEAVESFLEEMVVRRELSDNFCEYTPNYDSLECAAEWAKESLRIHTADKREYIY  362


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLT-TRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            WC PG DAA + L      FL+  RL  Y+  RN+P   +ALS LSPY H+GQI+ QR  
Sbjct  244  WCIPGADAAEKALAD----FLSPARLSRYADKRNDPCA-RALSNLSPYFHYGQIAPQRAA  298

Query  474  LQAQQIQ  454
            L+A +++
Sbjct  299  LEAAKLK  305



>ref|WP_014856093.1| deoxyribodipyrimidine photo-lyase [Melioribacter roseus]
 gb|AFN74659.1| deoxyribodipyrimidine photolyase [Melioribacter roseus P3M-2]
Length=445

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +++ ++FLEELIVR+EL+DNFCYY  +YDS +G  EWA+KTL EH  DKRE+VY
Sbjct  274  SKSRESFLEELIVRKELSDNFCYYNKKYDSFEGFPEWAQKTLNEHRRDKREYVY  327


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 6/74 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PGE+AA E+L    + F+ ++L+ YS  +N+P    ALS LS +LHFG ISAQR  L
Sbjct  211  WILPGEEAAFEIL----DSFIESKLEFYSDKKNDP-NENALSNLSIHLHFGHISAQRIAL  265

Query  471  QAQQIQKSHPKVRS  430
            +  + +  H K R 
Sbjct  266  EILR-RTEHSKSRE  278



>ref|XP_003726308.1| PREDICTED: LOW QUALITY PROTEIN: deoxyribodipyrimidine photo-lyase-like 
[Strongylocentrotus purpuratus]
Length=501

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R +++V  F+EE I+RREL+DNFC+Y  +YDS++G  +WA+KTL +H+ DKR++VY
Sbjct  325  RFSESVAAFIEESIIRRELSDNFCFYNDKYDSIEGTNDWAKKTLKDHAKDKRDYVY  380


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 5/60 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M++L    + F+  RL+ +S+ RN+P K    S LSP++HFGQ+S+QR  L
Sbjct  263  WAKPGTSEGMKML----DSFVKERLRYFSSARNDPTKS-VCSNLSPWIHFGQLSSQRAAL  317



>ref|XP_005093310.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Aplysia californica]
Length=553

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + ++ V+ F+EE ++RRELADNFC+Y  +YDS++GA++WA+KTL  HS DKR ++Y
Sbjct  377  KSSEGVNAFIEEAVIRRELADNFCFYNEKYDSVKGAYDWAQKTLKIHSGDKRPYLY  432


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 5/66 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG D  + +L      F   RLKS++T RN+P K +ALS LSP++HFGQIS QRC L
Sbjct  315  WAKPGTDPGLRML----ESFCEKRLKSFATSRNDPNK-QALSNLSPWIHFGQISVQRCIL  369

Query  471  QAQQIQ  454
              ++ +
Sbjct  370  MVKKYR  375



>gb|KFR06048.1| Deoxyribodipyrimidine photo-lyase, partial [Opisthocomus hoazin]
Length=353

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTFLEE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  202  ESVDTFLEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  254


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  137  WATPGMAAGLAVL----RSFIAERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  191

Query  471  QAQQ  460
            + Q+
Sbjct  192  EVQK  195



>emb|CDS28155.1| deoxyribodipyrimidine photo lyase [Hymenolepis microstoma]
Length=521

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE  +RRELADNFC+Y   YDSL+GAW WA++TL +HSND R+  Y
Sbjct  343  SVDAFIEEAFIRRELADNFCFYNKHYDSLKGAWSWAQETLRKHSNDIRQPSY  394


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  594  FLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCLQAQQIQKSH  445
            FL  RL +Y  DRN+P K  +LS LSP+LHFG IS QRC  +A+ +QK H
Sbjct  292  FLHARLPTYEKDRNDPTK-DSLSNLSPWLHFGHISPQRCLWEAEFLQKQH  340



>gb|KFB48037.1| hypothetical protein ZHAS_00016157 [Anopheles sinensis]
Length=518

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R  ++V +F EE IVRREL+DNFC+Y   YD+LQGA++WARKTL +H  DKR + Y
Sbjct  339  RFNESVASFCEEAIVRRELSDNFCFYNKNYDNLQGAYDWARKTLDDHRKDKRVYCY  394


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG +  +  L      F+  RL  +++ RN+P +  ALS LSP+ HFGQ+S QR  L
Sbjct  277  WATPGYEGGVRTLQS----FVEKRLVKFNSKRNDPTQ-NALSNLSPWFHFGQLSVQRAIL  331

Query  471  QAQQIQK  451
              +   K
Sbjct  332  TVKSYGK  338



>ref|WP_013718172.1| deoxyribodipyrimidine photo-lyase [Methanosaeta concilii]
 ref|YP_004382928.1| deoxyribodipyrimidine photo-lyase [Methanosaeta concilii GP6]
 gb|AEB67110.1| deoxyribodipyrimidine photo-lyase (DNA photolyase)(Photoreactivating 
enzyme) [Methanosaeta concilii GP6]
Length=445

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = -2

Query  172  LRLTQAVDT--FLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + L+   D+  FLEEL+VRRELADNFCYY P YDS+QG   WA++TL +H ND RE++Y
Sbjct  268  MALSGMTDSSPFLEELVVRRELADNFCYYNPHYDSVQGFPNWAQETLRQHENDPREYLY  326


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 5/62 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PGE AA + L    N F+   L  Y +DRNNP+K    SGLS YLHFGQISAQR  L
Sbjct  213  WAQPGERAAKKHL----NEFIDQGLVLYDSDRNNPVK-NGQSGLSFYLHFGQISAQRVAL  267

Query  471  QA  466
             A
Sbjct  268  MA  269



>ref|XP_001620432.1| hypothetical protein NEMVEDRAFT_v1g223118 [Nematostella vectensis]
 gb|EDO28332.1| predicted protein [Nematostella vectensis]
Length=366

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  187  VNDGYLRLTQAVDTFLEELIVRRELADNFCYYQ-PQYDSLQGAWEWARKTLMEHSNDKRE  11
            V D   +  ++V++F+EE I+RREL+DNFCYY   +YDS++G  EWARKTL +H+ DKRE
Sbjct  227  VRDFRSKFRESVESFIEECIIRRELSDNFCYYNNEKYDSIEGTNEWARKTLNDHAKDKRE  286

Query  10   HVY  2
            ++Y
Sbjct  287  YLY  289



>ref|XP_009929546.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Opisthocomus 
hoazin]
Length=520

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTFLEE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  337  ESVDTFLEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  389


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  272  WATPGMAAGLAVL----RSFIAERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  326

Query  471  QAQQ  460
            + Q+
Sbjct  327  EVQK  330



>gb|AHA91712.1| cpd photolyase, partial [Astyanax mexicanus]
 gb|AHA91713.1| cpd photolyase, partial [Astyanax mexicanus]
Length=295

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++V +F EEL+VRRELADNFCYY  +YDS+ GA++WA+ TL  H+ DKR ++Y
Sbjct  122  ESVASFTEELVVRRELADNFCYYNKEYDSIAGAYDWAKTTLKIHAKDKRAYLY  174


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 5/68 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    M +L      F+  RL+ ++T+RNNP   +A+S LSP+L  GQ+SAQR   
Sbjct  57   WARPGTSGGMAML----ESFIQQRLRLFATERNNP-NSEAVSHLSPWLRAGQLSAQRVVK  111

Query  471  QAQQIQKS  448
            + Q+  K+
Sbjct  112  EVQRWGKN  119



>ref|WP_033192140.1| deoxyribodipyrimidine photolyase [Fervidobacterium islandicum]
 gb|KHG32255.1| deoxyribodipyrimidine photolyase [Fervidobacterium islandicum]
Length=468

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++V +FLEELIVRRELADNFC+Y   YDS +G  +WA+KTL EH  DKR ++Y
Sbjct  294  ESVASFLEELIVRRELADNFCFYNENYDSFEGFPDWAKKTLNEHRQDKRPYIY  346


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 39/71 (55%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  + M VL      FL  +LK Y   RN+P K  A S LS YLHFGQI+ QR   
Sbjct  229  WLKPGYSSGMSVL----KEFLERKLKWYGEQRNDPTK-DATSNLSAYLHFGQIAPQRVAF  283

Query  471  QAQQIQKSHPK  439
            +  + +  +P+
Sbjct  284  ETLKYEHEYPE  294



>gb|AHA91711.1| cpd photolyase, partial [Astyanax mexicanus]
Length=295

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++V +F EEL+VRRELADNFCYY  +YDS+ GA++WA+ TL  H+ DKR ++Y
Sbjct  122  ESVASFTEELVVRRELADNFCYYNKEYDSIAGAYDWAKTTLKIHAKDKRAYLY  174


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 5/68 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    M +L      F+  RL  ++T+RNNP   +A+S LSP+LH GQ+SAQR   
Sbjct  57   WARPGTSGGMAML----ESFIQQRLCLFATERNNP-NSEAVSHLSPWLHAGQLSAQRVVK  111

Query  471  QAQQIQKS  448
            + Q+  K+
Sbjct  112  EVQRWGKN  119



>ref|XP_010794949.1| PREDICTED: LOW QUALITY PROTEIN: deoxyribodipyrimidine photo-lyase-like 
[Notothenia coriiceps]
Length=241

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +V TF+EEL+VRREL DNFC+Y  +YDS++G  +WA+K+L  H+ DKRE++Y
Sbjct  69   SVATFIEELVVRRELTDNFCFYNEKYDSVEGTHDWAQKSLKAHAKDKREYLY  120



>dbj|GAA56147.1| deoxyribodipyrimidine photo-lyase, partial [Clonorchis sinensis]
Length=893

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE  +RREL+DNFC+Y P YDSL+GA++WA+ TL  HS DKR+  Y
Sbjct  723  KSVDAFIEEAFIRRELSDNFCFYNPNYDSLKGAYQWAQDTLKCHSKDKRDPAY  775


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    M+ L      F+T RLK+Y+T RN+P K  ALS LSP+ HFG I+ QR  L
Sbjct  658  WAKGGTRIGMQTLFD----FITKRLKAYATQRNDPTK-DALSDLSPWFHFGHIAPQRALL  712

Query  471  QAQQIQKSHPK  439
            + Q+++   PK
Sbjct  713  EVQRVRTKDPK  723



>emb|CEF97357.1| DNA photolyase, class 2 [Ostreococcus tauri]
Length=504

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 6/71 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PGE AA  VL    + F+  R+K Y   RN+P KP+ALSGLSP+LHFGQISAQRC L
Sbjct  227  WAIPGETAARAVL----DDFVANRMKLYEK-RNDPSKPRALSGLSPWLHFGQISAQRCAL  281

Query  471  QAQQ-IQKSHP  442
            +A++ + K+ P
Sbjct  282  EAKKAVGKASP  292


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 3/55 (5%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQP--QYDSLQG-AWEWARKTLMEHSNDKREHVY  2
            A D+F EEL+VRRELADNFCYY P  +YD ++G  ++WA+ TL  H+ DKR ++Y
Sbjct  294  AYDSFFEELVVRRELADNFCYYCPGQKYDEMEGQKYDWAKDTLRAHAGDKRPYIY  348



>gb|ETN58118.1| deoxyribodipyrimidine photo-lyase [Anopheles darlingi]
Length=555

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R T++V +F EE IVRRELADNFC+Y   YD+L+GA++WARKTL +H  D+R + Y
Sbjct  376  RHTESVASFCEEAIVRRELADNFCFYNKNYDNLKGAYDWARKTLDDHRKDRRVYCY  431



>ref|XP_001636254.1| predicted protein [Nematostella vectensis]
 gb|EDO44191.1| predicted protein [Nematostella vectensis]
Length=382

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  187  VNDGYLRLTQAVDTFLEELIVRRELADNFCYYQ-PQYDSLQGAWEWARKTLMEHSNDKRE  11
            V D   +  ++V++F+EE I+RREL+DNFCYY   +YDS++G  EWARKTL +H+ DKRE
Sbjct  202  VRDFRSKFRESVESFIEECIIRRELSDNFCYYNNEKYDSIEGTNEWARKTLNDHAKDKRE  261

Query  10   HVY  2
            ++Y
Sbjct  262  YLY  264



>ref|WP_025305602.1| deoxyribodipyrimidine photolyase [Thermocrinis ruber]
 gb|AHE95635.1| deoxyribodipyrimidine photolyase [Thermocrinis ruber]
Length=456

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  YLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            Y R  + VD+F  ELIV RELA NFCYY P Y+  +G  EWA++TL EH NDKRE++Y
Sbjct  281  YGRNDENVDSFFNELIVWRELARNFCYYNPNYNQYEGIPEWAKETLEEHKNDKREYIY  338



>ref|XP_010900290.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Esox lucius]
Length=544

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++V TF+EEL+VRREL DNFC+Y   YDS++GA +WA+KTL +H+ D R +VY
Sbjct  371  ESVPTFIEELVVRRELTDNFCFYNSNYDSVKGASDWAQKTLKDHAKDPRPYVY  423


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + +L      F+  RLK+++T RNNP    ALS LSP++ FG +SAQR  L
Sbjct  306  WARPGTAAGLAML----ESFIDQRLKNFATLRNNP-NSSALSQLSPWIRFGHLSAQRVVL  360

Query  471  QAQQIQK  451
            + +  +K
Sbjct  361  RVKSCEK  367



>ref|XP_001420955.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422939.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99248.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01298.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=477

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +A+D++LEELIVRREL+DN+C + P YDSLQGA +WA+ +L  H+ D RE+VY
Sbjct  299  EAIDSYLEELIVRRELSDNYCLFNPYYDSLQGASQWAQDSLSLHARDVREYVY  351


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMG-SKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCC  475
            W +PGE AA+  L+  + + FL  RL  Y  +RN P  P+A+S LSPYL+ GQ+S +R  
Sbjct  228  WIKPGERAALAALLDPNVDSFLPQRLTLYG-ERNKPTSPRAVSRLSPYLNHGQLSPRRAA  286

Query  474  LQAQQIQ  454
             +A Q++
Sbjct  287  WEAAQLR  293



>ref|XP_009680452.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X2 
[Struthio camelus australis]
Length=458

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  VNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREH  8
            V   + +  ++VD F+EE +VRRELADNFCYY   YDS+QGA++WA+ TL  H+ DKR  
Sbjct  274  VRKHHRKYKESVDIFVEEAVVRRELADNFCYYNKNYDSVQGAYDWAQTTLKLHAKDKRPF  333

Query  7    VY  2
            +Y
Sbjct  334  LY  335


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 8/74 (11%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RL+S+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  218  WATPGTAAGLAVL----QSFIAERLESFGSHRNDPNKA-ALSNLSPWFHFGQVSTQRAIL  272

Query  471  QAQQIQKSHPKVRS  430
               +++K H K + 
Sbjct  273  ---EVRKHHRKYKE  283



>ref|XP_009177023.1| hypothetical protein T265_11930 [Opisthorchis viverrini]
 gb|KER19228.1| hypothetical protein T265_11930 [Opisthorchis viverrini]
Length=511

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++ D F+EE  +RREL+DNFC+Y P YDSL+GA++WA+ TL  HS DKR+  Y
Sbjct  359  KSADAFIEEAFIRRELSDNFCFYNPNYDSLKGAYQWAQDTLKCHSKDKRDPAY  411


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W + G    M++L      F+  RLK+Y T RN+P K  A S LSP+ HFG I+ QR  L
Sbjct  294  WAKGGTRNGMQILFD----FIAKRLKAYGTQRNDPTK-DAQSDLSPWFHFGHIAPQRALL  348

Query  471  QAQQIQKSHPK  439
            +AQ+++   PK
Sbjct  349  EAQRVRPKDPK  359



>ref|NP_039121.1| Photolyase [Fowlpox virus]
 gb|AAF44502.1|AF198100_149 ORF FPV158 Photolyase [Fowlpox virus]
 gb|AAF81696.1|AF246697_1 CPD-photolyase [Fowlpox virus]
Length=464

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + V+TF++E+IVRREL+DNFCYY   YDS+Q    WARKTL +H ND R+++Y
Sbjct  295  KNVETFIDEIIVRRELSDNFCYYNKHYDSIQSTHSWARKTLEDHINDPRKYIY  347


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RL SY  D NNP    ALS LSP+LHFG +SAQR  L
Sbjct  230  WATPGTKAGIIVL----KEFIKNRLPSYDADHNNP-TCDALSNLSPWLHFGHVSAQRVAL  284

Query  471  QA  466
            + 
Sbjct  285  EV  286



>ref|WP_014452083.1| deoxyribodipyrimidine photo-lyase [Fervidobacterium pennivorans]
 gb|AFG35649.1| Deoxyribodipyrimidine photo-lyase type II [Fervidobacterium pennivorans 
DSM 9078]
Length=465

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V  FLEELIVRRELADNFC Y   YDS  G  EWA+K+L  H NDKRE++Y
Sbjct  290  PESVADFLEELIVRRELADNFCLYNENYDSFDGFPEWAKKSLNAHRNDKREYIY  343



>ref|XP_009680451.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like isoform X1 
[Struthio camelus australis]
Length=519

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  VNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREH  8
            V   + +  ++VD F+EE +VRRELADNFCYY   YDS+QGA++WA+ TL  H+ DKR  
Sbjct  335  VRKHHRKYKESVDIFVEEAVVRRELADNFCYYNKNYDSVQGAYDWAQTTLKLHAKDKRPF  394

Query  7    VY  2
            +Y
Sbjct  395  LY  396


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 8/74 (11%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RL+S+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  279  WATPGTAAGLAVL----QSFIAERLESFGSHRNDPNKA-ALSNLSPWFHFGQVSTQRAIL  333

Query  471  QAQQIQKSHPKVRS  430
               +++K H K + 
Sbjct  334  ---EVRKHHRKYKE  344



>gb|KFQ33489.1| Deoxyribodipyrimidine photo-lyase, partial [Merops nubicus]
Length=422

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELADNFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  250  ESVDAFVEEAVVRRELADNFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  302


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      FLT RLKS+S+ RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGLAVL----RSFLTERLKSFSSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  239

Query  471  QAQQ  460
            + Q+
Sbjct  240  EVQK  243



>gb|KFQ08100.1| Deoxyribodipyrimidine photo-lyase, partial [Leptosomus discolor]
Length=422

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTF+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  250  ESVDTFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  302


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGLAVL----QSFIAERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  239

Query  471  QAQQ  460
            + Q+
Sbjct  240  EVQK  243



>gb|KFV85047.1| Deoxyribodipyrimidine photo-lyase, partial [Struthio camelus 
australis]
Length=431

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  VNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREH  8
            V   + +  ++VD F+EE +VRRELADNFCYY   YDS+QGA++WA+ TL  H+ DKR  
Sbjct  241  VRKHHRKYKESVDIFVEEAVVRRELADNFCYYNKNYDSVQGAYDWAQTTLKLHAKDKRPF  300

Query  7    VY  2
            +Y
Sbjct  301  LY  302


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 8/74 (11%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RL+S+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGLAVL----QSFIAERLESFGSHRNDPNKA-ALSNLSPWFHFGQVSTQRAIL  239

Query  471  QAQQIQKSHPKVRS  430
               +++K H K + 
Sbjct  240  ---EVRKHHRKYKE  250



>ref|XP_009946273.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Leptosomus 
discolor]
Length=426

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTF+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  249  ESVDTFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  301


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  184  WATPGTAAGLAVL----QSFIAERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  238

Query  471  QAQQ  460
            + Q+
Sbjct  239  EVQK  242



>gb|KFP42943.1| Deoxyribodipyrimidine photo-lyase, partial [Chlamydotis macqueenii]
Length=417

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTF+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  250  ESVDTFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  302


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGMAVL----QSFIAERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  239

Query  471  QAQQ  460
            + Q+
Sbjct  240  EVQK  243



>gb|KFV09905.1| Deoxyribodipyrimidine photo-lyase, partial [Pterocles gutturalis]
Length=373

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTF+EE +VRRELA+NFCYY   YDS+QGA+ WA+ TL  H+ DKR  +Y
Sbjct  250  ESVDTFVEEAVVRRELAENFCYYNENYDSVQGAYSWAQTTLKLHAKDKRPFLY  302


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLK + + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGMAVL----QSFIAERLKYFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  239

Query  471  QAQQ  460
            + Q+
Sbjct  240  EVQK  243



>ref|XP_010120777.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Chlamydotis 
macqueenii]
Length=464

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTF+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  289  ESVDTFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  341


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  224  WATPGTAAGMAVL----QSFIAERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  278

Query  471  QAQQ  460
            + Q+
Sbjct  279  EVQK  282



>ref|WP_023405803.1| hypothetical protein [uncultured Desulfofustis sp. PB-SRB1]
 gb|ESQ13071.1| hypothetical protein N839_00130 [uncultured Desulfofustis sp. 
PB-SRB1]
Length=455

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  DTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + FLEELIVRREL+DNFCYY+P YD+ +G   WAR++L EH  D+RE+VY
Sbjct  283  EAFLEELIVRRELSDNFCYYEPNYDTSEGFAPWARQSLEEHRGDRREYVY  332



>gb|KFW81474.1| Deoxyribodipyrimidine photo-lyase, partial [Manacus vitellinus]
Length=433

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  250  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPYIY  302


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+T RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGLAVL----KSFITERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRVIL  239

Query  471  QAQQIQKSH  445
            + Q+ ++ +
Sbjct  240  EVQKHRRKY  248



>ref|XP_008942592.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Merops 
nubicus]
Length=481

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELADNFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  306  ESVDAFVEEAVVRRELADNFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  358


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      FLT RLKS+S+ RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  241  WATPGTAAGLAVL----RSFLTERLKSFSSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  295

Query  471  QAQQ  460
            + Q+
Sbjct  296  EVQK  299



>ref|XP_008922818.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Manacus vitellinus]
Length=536

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  362  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPYIY  414


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+T RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  297  WATPGTAAGLAVL----KSFITERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRVIL  351

Query  471  QAQQIQKSH  445
            + Q+ ++ +
Sbjct  352  EVQKHRRKY  360



>ref|XP_010075306.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Pterocles 
gutturalis]
Length=429

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VDTF+EE +VRRELA+NFCYY   YDS+QGA+ WA+ TL  H+ DKR  +Y
Sbjct  307  ESVDTFVEEAVVRRELAENFCYYNENYDSVQGAYSWAQTTLKLHAKDKRPFLY  359


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLK + + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  242  WATPGTAAGMAVL----QSFIAERLKYFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  296

Query  471  QAQQ  460
            + Q+
Sbjct  297  EVQK  300



>gb|ACO51512.1| photolyase [Strongylocentrotus franciscanus]
Length=367

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R +++V  ++EE I RREL+DNFC+Y   YDS++G  +WA+KTL +H+ DKRE+VY
Sbjct  237  RFSESVAGYIEESITRRELSDNFCFYNDNYDSIEGTNDWAKKTLKDHAKDKREYVY  292


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 5/60 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M++L    + F+  RL+ +S+ RN+P K    S LSP++HFGQ+S+QR  L
Sbjct  175  WAQPGTSEGMKML----DSFVKERLRYFSSARNDPTK-SVCSNLSPWIHFGQLSSQRAAL  229



>ref|XP_005142392.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Melopsittacus 
undulatus]
Length=910

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +  ++VD F+EE IVRRELA+NFCYY   YDS+QGA+ WA+ TL  H+ D+R  +Y
Sbjct  732  KYKESVDMFVEEAIVRRELAENFCYYNENYDSVQGAYPWAQTTLKLHAKDERPFLY  787


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLK + + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  670  WATPGTAAGLAVL----QSFIRERLKYFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  724

Query  471  QAQQIQKSH  445
            + Q+ Q  +
Sbjct  725  EVQKHQHKY  733



>gb|KFQ47505.1| Deoxyribodipyrimidine photo-lyase, partial [Pelecanus crispus]
Length=322

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  250  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  302


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+S+ RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGLAVL----QSFIAERLKSFSSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  239

Query  471  QAQQ  460
            + Q+
Sbjct  240  EVQK  243



>ref|XP_006022489.1| PREDICTED: LOW QUALITY PROTEIN: deoxyribodipyrimidine photo-lyase-like 
[Alligator sinensis]
Length=508

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R  ++V++F+EE ++RRELADNFC+Y   YD L+GA +WAR TL+ H+ DKRE++Y
Sbjct  335  RHRESVNSFVEEAVIRRELADNFCFYNKSYDQLEGAHDWARDTLILHARDKREYLY  390


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RL  YS  RNNP K  ALS LSP+ HFGQ+S QR  L
Sbjct  273  WATPGTAAGLAVL----QAFVARRLPGYSEYRNNPNKA-ALSNLSPWFHFGQVSVQRAVL  327

Query  471  QAQQIQKSH  445
            + Q+ +  H
Sbjct  328  EVQKSRDRH  336



>ref|XP_313925.3| AGAP005052-PA [Anopheles gambiae str. PEST]
 gb|EAA09350.3| AGAP005052-PA [Anopheles gambiae str. PEST]
Length=549

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R +++V +F EE IVRREL+DNFC++   YD+LQGA++WARKTL +H  DKR + Y
Sbjct  370  RYSESVASFCEEAIVRRELSDNFCFHNKNYDNLQGAYDWARKTLDDHRKDKRVYCY  425



>ref|XP_001653955.1| AAEL001787-PA [Aedes aegypti]
 gb|EAT47082.1| AAEL001787-PA [Aedes aegypti]
Length=506

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++ V  F EE IVRREL+DNFCYY   YD+L+GA++WA+KTL +H  DKR +VY
Sbjct  330  SEGVAAFCEESIVRRELSDNFCYYNKNYDNLKGAYDWAQKTLDDHRKDKRTYVY  383


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    + VL      F+  RL+ ++  RN+P    ALS LSP+ HFGQIS QRC L
Sbjct  266  WAVPGYTGGIGVL----QSFVEKRLRKFNAKRNDPTDD-ALSNLSPWFHFGQISVQRCVL  320

Query  471  QAQQIQKSH  445
              ++  K +
Sbjct  321  AVKKYGKGY  329



>ref|XP_006264229.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Alligator 
mississippiensis]
Length=550

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R  ++V++F+EE ++RRELADNFC+Y   YD L+GA +WAR TL+ H+ DKRE++Y
Sbjct  377  RHRESVNSFVEEAVIRRELADNFCFYNKSYDQLEGAHDWARDTLILHARDKREYLY  432


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+T RL  YS  RNNP K  ALS LSP+ HFGQ+S QR  L
Sbjct  315  WATPGTAAGLAVL----QAFVTRRLPGYSEYRNNPNK-AALSNLSPWFHFGQVSVQRAVL  369

Query  471  QAQQIQKSH  445
            + Q+ +  H
Sbjct  370  EVQKSRDRH  378



>ref|XP_008331859.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Cynoglossus 
semilaevis]
Length=561

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             ++V +F+EEL+VRRELADNFC+Y  +YD ++GA EWA+KTL +H+ D+R ++Y
Sbjct  381  AESVTSFIEELVVRRELADNFCFYNKKYDRVEGAHEWAQKTLRDHAKDERPYLY  434


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG    M +L      F+  RLK +   RN+P    ALS LSP++HFG +SAQR  L
Sbjct  317  WAQPGTCGGMAML----ESFIDFRLKLFGNQRNDP-NINALSQLSPWIHFGHLSAQRVAL  371

Query  471  QAQQIQKS  448
            Q Q+  KS
Sbjct  372  QVQKNGKS  379



>ref|WP_028895847.1| deoxyribodipyrimidine photolyase [Syntrophorhabdus aromaticivorans]
Length=448

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  TFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             FL+ELIVRREL+DNFC+Y P YDS +G  +WA+KTL EH  D+R ++Y
Sbjct  281  AFLDELIVRRELSDNFCFYTPHYDSFEGFPDWAKKTLTEHRKDRRSYIY  329


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG +AA + L    + F+  RL++YS DRN+P K    S LSPYLHFGQ+SAQR  L
Sbjct  213  WLSPGAEAAKDSL----SRFIEGRLEAYSRDRNDPNK-VGQSNLSPYLHFGQLSAQRVAL  267

Query  471  QA  466
            + 
Sbjct  268  EV  269



>gb|KFQ30198.1| Deoxyribodipyrimidine photo-lyase, partial [Mesitornis unicolor]
Length=424

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  250  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPYLY  302


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+ + RN+P K  ALS LSP+LHFGQ+S QR  L
Sbjct  185  WATPGTAAGMAVL----QSFIVERLKSFGSHRNDPNK-AALSNLSPWLHFGQVSTQRAIL  239

Query  471  QAQQIQKSH  445
            + Q+ +  H
Sbjct  240  EVQKHRGKH  248



>ref|XP_008171965.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Chrysemys 
picta bellii]
Length=546

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE ++RRELADNFCYY   YD ++GA++WA+ +L  H+ DKR H+Y
Sbjct  371  ESVDGFIEEAVIRRELADNFCYYNRNYDKVEGAYDWAKTSLKLHAQDKRSHLY  423


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+ TDRNNP +  ALS LSP+ HFGQ+S QR  L
Sbjct  306  WATPGTAAGLAVL----ESFIGERLKSFGTDRNNPNRA-ALSNLSPWFHFGQVSVQRAIL  360

Query  471  QAQQIQKSH  445
            + Q+ +  +
Sbjct  361  EVQKYRSKY  369



>gb|ACG63558.1| DNA photolyase II [Pseudoplusia includens nucleopolyhedrovirus]
Length=241

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  VDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++T++EE +VRRELADN+C+Y P YD+L GA EWA  TL +H+ DKR + Y
Sbjct  151  IETYVEECVVRRELADNYCFYNPNYDNLAGAPEWAIATLKKHAGDKRSYCY  201



>ref|XP_009083471.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Acanthisitta 
chloris]
Length=461

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  287  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLRLHAKDKRPYLY  339


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+S+ RN+P K  ALS LSP+ HFG+ S QR  L
Sbjct  222  WATPGTTAGLAVL----KSFIAERLKSFSSHRNDPNK-AALSNLSPWFHFGEFSTQRAIL  276

Query  471  QAQQ  460
            + Q+
Sbjct  277  EVQK  280



>gb|KFP74647.1| Deoxyribodipyrimidine photo-lyase, partial [Acanthisitta chloris]
Length=433

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  248  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLRLHAKDKRPYLY  300


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 7/64 (11%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+S+ RN+P K  ALS LSP+ HF  +S QR  L
Sbjct  185  WATPGTTAGLAVL----KSFIAERLKSFSSHRNDPNK-AALSNLSPWFHF--VSTQRAIL  237

Query  471  QAQQ  460
            + Q+
Sbjct  238  EVQK  241



>gb|KFV57896.1| Deoxyribodipyrimidine photo-lyase, partial [Tyto alba]
Length=363

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  239  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  291


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    + VL      F+T RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  174  WATPGTTTGLAVL----QSFITERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  228

Query  471  QAQQ  460
            + Q+
Sbjct  229  EVQK  232



>gb|ACD01432.1| DNA photolyase [Thysanoplusia orichalcea nucleopolyhedrovirus]
Length=241

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  VDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++T++EE +VRRELADN+C+Y P YD+L GA EWA  TL +H+ DKR + Y
Sbjct  151  IETYVEECVVRRELADNYCFYNPNYDNLAGAPEWAIATLKKHAGDKRSYCY  201



>ref|XP_009805516.1| PREDICTED: LOW QUALITY PROTEIN: deoxyribodipyrimidine photo-lyase-like, 
partial [Gavia stellata]
Length=359

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  212  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  264


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F++ RLKS+S+ RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  147  WATPGTAAGLAVL----QSFISERLKSFSSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  201

Query  471  QAQQ  460
            + Q+
Sbjct  202  EVQK  205



>ref|WP_013049221.1| deoxyribodipyrimidine photo-lyase [Aminobacterium colombiense]
 gb|ADE57959.1| deoxyribodipyrimidine photolyase [Aminobacterium colombiense 
DSM 12261]
Length=456

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD+FLEELIVRRELADNFC+Y P YD  +G  +WA+KTL EH  D R+  Y
Sbjct  281  SVDSFLEELIVRRELADNFCFYTPSYDCFEGFPQWAQKTLDEHRWDPRKFTY  332



>ref|XP_009491311.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Pelecanus 
crispus]
Length=374

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  303  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  355


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+S+ RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  238  WATPGTAAGLAVL----QSFIAERLKSFSSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  292

Query  471  QAQQ  460
            + Q+
Sbjct  293  EVQK  296



>ref|XP_010177056.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Mesitornis 
unicolor]
Length=475

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  300  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPYLY  352


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+ + RN+P K  ALS LSP+LHFGQ+S QR  L
Sbjct  235  WATPGTAAGMAVL----QSFIVERLKSFGSHRNDPNK-AALSNLSPWLHFGQVSTQRAIL  289

Query  471  QAQQIQKSH  445
            + Q+ +  H
Sbjct  290  EVQKHRGKH  298



>ref|WP_034621121.1| deoxyribodipyrimidine photolyase [Desulfovermiculus halophilus]
Length=454

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  TQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +QA   FLE+LIVRREL DNFC++ P YDSL G  EWA+KTL  H  D R +VY
Sbjct  280  SQAKSAFLEQLIVRRELTDNFCWHNPGYDSLSGLPEWAQKTLEAHQTDPRPYVY  333



>ref|XP_010210371.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Tinamus guttatus]
Length=486

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  VNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREH  8
            V   + +  ++VD F+EE +VRREL+DNFCYY   YDS+QGA++WA+ TL  H+ DKR  
Sbjct  302  VRKHHRKYQESVDVFVEEAVVRRELSDNFCYYNKNYDSVQGAYDWAQTTLKLHAKDKRPF  361

Query  7    VY  2
            +Y
Sbjct  362  LY  363


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 8/71 (11%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RL+SYS+ RNNP K  ALS LSP+ HFGQIS QR  L
Sbjct  246  WATPGTAAGLAVL----QSFIAERLESYSSHRNNPNK-AALSNLSPWFHFGQISTQRAIL  300

Query  471  QAQQIQKSHPK  439
               +++K H K
Sbjct  301  ---EVRKHHRK  308



>gb|KGL75518.1| Deoxyribodipyrimidine photo-lyase, partial [Tinamus guttatus]
Length=428

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  VNDGYLRLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREH  8
            V   + +  ++VD F+EE +VRREL+DNFCYY   YDS+QGA++WA+ TL  H+ DKR  
Sbjct  241  VRKHHRKYQESVDVFVEEAVVRRELSDNFCYYNKNYDSVQGAYDWAQTTLKLHAKDKRPF  300

Query  7    VY  2
            +Y
Sbjct  301  LY  302


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 8/71 (11%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RL+SYS+ RNNP K  ALS LSP+ HFGQIS QR  L
Sbjct  185  WATPGTAAGLAVL----QSFIAERLESYSSHRNNPNK-AALSNLSPWFHFGQISTQRAIL  239

Query  471  QAQQIQKSHPK  439
               +++K H K
Sbjct  240  ---EVRKHHRK  247



>ref|WP_013513037.1| deoxyribodipyrimidine photo-lyase [Desulfovibrio aespoeensis]
 gb|ADU61100.1| deoxyribodipyrimidine photolyase [Desulfovibrio aespoeensis Aspo-2]
Length=450

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  TFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
             +LEEL+VRRELADNFC + PQYDSL GA  WA KTL EH  D R H Y
Sbjct  283  AYLEELVVRRELADNFCLHNPQYDSLAGAPAWALKTLGEHRADPRAHCY  331



>ref|YP_009046386.1| photolyase [Pigeonpox virus]
 gb|AID46662.1| photolyase [Pigeonpox virus]
Length=464

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            + V+TF++E+IVRREL+DNFCYY   YDS+Q    WAR+TL +H ND R+++Y
Sbjct  295  KNVETFIDEIIVRRELSDNFCYYNKHYDSVQSTHAWARRTLEDHVNDPRKYIY  347


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL    N F+  RL SY  D NNP    ALS LSP+LHFG +S QR  L
Sbjct  230  WAIPGTKAGIIVL----NEFIKNRLTSYDADHNNP-TCDALSNLSPWLHFGHVSPQRVAL  284

Query  471  QA  466
            + 
Sbjct  285  EV  286



>ref|XP_005525231.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Pseudopodoces 
humilis]
Length=673

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  500  SVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPYLY  551


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+ST RN+P K  ALS LSP+LHFGQ+S QR  L
Sbjct  434  WATPGTAAGMAVL----KSFIAERLKSFSTHRNDPNK-AALSNLSPWLHFGQVSTQRAIL  488

Query  471  QAQQIQKSH  445
            + Q+ ++++
Sbjct  489  EVQKHRRNY  497



>ref|XP_005484958.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Zonotrichia 
albicollis]
Length=501

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  328  SVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKVHAKDKRPYLY  379


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+S+ RN+P K  ALS LSP+LHFGQ+S QR  L
Sbjct  262  WATPGTAAGMAVL----KSFIAERLKSFSSHRNDPNKA-ALSNLSPWLHFGQVSTQRAIL  316

Query  471  QAQQIQKSH  445
            + Q+ ++S+
Sbjct  317  EVQKQRRSY  325



>gb|KFZ50447.1| Deoxyribodipyrimidine photo-lyase, partial [Caprimulgus carolinensis]
Length=438

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  250  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  302



>ref|XP_009087372.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Serinus canaria]
Length=502

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  328  SVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKVHAKDKRPYLY  379


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+ST RN+P K  ALS LSP+LHFGQ+S QR  L
Sbjct  262  WATPGTAAGMAVL----KSFIAERLKSFSTHRNDPNK-AALSNLSPWLHFGQVSTQRAIL  316

Query  471  QAQQIQKSH  445
            + Q+ ++S+
Sbjct  317  EVQKHRRSY  325



>ref|XP_005419165.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Geospiza fortis]
Length=474

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR ++Y
Sbjct  300  SVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKVHAKDKRPYLY  351


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A M VL      F+  RLKS+S+ RN+P K  ALS LSP+LHFGQ+S QR  L
Sbjct  234  WATPGTAAGMAVL----KSFIAERLKSFSSHRNDPNK-AALSNLSPWLHFGQVSTQRAIL  288

Query  471  QAQQIQKSH  445
            + Q+ ++S+
Sbjct  289  EVQKHRRSY  297



>ref|XP_009970528.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Tyto 
alba]
Length=419

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  270  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  322


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG    + VL      F+T RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  205  WATPGTTTGLAVL----QSFITERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  259

Query  471  QAQQ  460
            + Q+
Sbjct  260  EVQK  263



>ref|XP_001949151.1| PREDICTED: deoxyribodipyrimidine photo-lyase [Acyrthosiphon pisum]
Length=506

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = -3

Query  642  PGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCLQAQ  463
            PG  A  +  M     FL  RL  YSTDRNNP+K   LS LSP+LHFGQISAQRC L+  
Sbjct  262  PGLKAGFKAGMSELEQFLKKRLPKYSTDRNNPVKD-GLSKLSPWLHFGQISAQRCILEVS  320

Query  462  QIQKSHP  442
            ++ K +P
Sbjct  321  KLSKQYP  327


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  AVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            +V  + EE IVRREL+DNFC+Y P+YD ++GA  WA+ +L EH  DKR  VY
Sbjct  329  SVAAYREEAIVRRELSDNFCFYNPKYDKIEGAPNWAQTSLNEHRKDKRMFVY  380



>gb|KFW08398.1| Deoxyribodipyrimidine photo-lyase, partial [Fulmarus glacialis]
Length=411

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  250  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  302


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+  RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  185  WATPGTAAGLAVL----QSFIVERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  239

Query  471  QAQQ  460
            + Q+
Sbjct  240  EVQK  243



>ref|XP_009513296.1| PREDICTED: LOW QUALITY PROTEIN: deoxyribodipyrimidine photo-lyase-like, 
partial [Phalacrocorax carbo]
Length=436

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  261  ESVDAFVEEAVVRRELAENFCYYNENYDSIQGAYDWAQTTLKLHAKDKRPFLY  313


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+T RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  196  WATPGTAAGLAVL----QSFITERLKSFGSLRNDPNK-AALSNLSPWFHFGQVSTQRAIL  250

Query  471  QAQQ  460
            + Q+
Sbjct  251  EVQK  254



>ref|XP_010166885.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like [Caprimulgus 
carolinensis]
Length=502

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  327  ESVDAFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  379



>sp|Q28811.1|PHR_POTTR RecName: Full=Deoxyribodipyrimidine photo-lyase; AltName: Full=DNA 
photolyase; AltName: Full=Photoreactivating enzyme [Potorous 
tridactylus]
 dbj|BAA05041.1| photolyase [Potorous tridactylus]
Length=532

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  169  RLTQAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            R   +V  F+EE +VRRELADNFC+Y   YD L+GA++WA+ TL  H+ DKR H+Y
Sbjct  357  RYPDSVTNFVEEAVVRRELADNFCFYNKNYDKLEGAYDWAQTTLRLHAKDKRPHLY  412


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W +PG  + + +L      F+  RL  + +DRNNP K  ALS LSP+ HFGQ+S QR  L
Sbjct  295  WAKPGTASGLTML----QSFIAERLPYFGSDRNNPNK-DALSNLSPWFHFGQVSVQRAIL  349

Query  471  QAQQIQKSHP  442
            + Q+ +  +P
Sbjct  350  EVQKHRSRYP  359



>ref|XP_010306667.1| PREDICTED: deoxyribodipyrimidine photo-lyase-like, partial [Balearica 
regulorum gibbericeps]
Length=432

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  QAVDTFLEELIVRRELADNFCYYQPQYDSLQGAWEWARKTLMEHSNDKREHVY  2
            ++VD F+EE +VRRELA+NFCYY   YDS+QGA++WA+ TL  H+ DKR  +Y
Sbjct  257  ESVDVFVEEAVVRRELAENFCYYNENYDSVQGAYDWAQTTLKLHAKDKRPFLY  309


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -3

Query  651  WCEPGEDAAMEVLMGSKNGFLTTRLKSYSTDRNNPLKPKALSGLSPYLHFGQISAQRCCL  472
            W  PG  A + VL      F+T RLKS+ + RN+P K  ALS LSP+ HFGQ+S QR  L
Sbjct  192  WATPGTAAGLAVL----QSFITERLKSFGSHRNDPNK-AALSNLSPWFHFGQVSTQRAIL  246

Query  471  QAQQ  460
            + Q+
Sbjct  247  EVQK  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250