BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047N10

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228477.1|  PREDICTED: molybdopterin biosynthesis protei...    320   2e-101   Solanum lycopersicum
ref|XP_009601464.1|  PREDICTED: molybdopterin biosynthesis protei...    319   4e-101   Nicotiana tomentosiformis
ref|XP_006362730.1|  PREDICTED: molybdopterin biosynthesis protei...    314   4e-99    Solanum tuberosum [potatoes]
ref|XP_006362729.1|  PREDICTED: molybdopterin biosynthesis protei...    314   5e-99    
ref|XP_009765762.1|  PREDICTED: molybdopterin biosynthesis protei...    311   3e-98    Nicotiana sylvestris
emb|CDP15575.1|  unnamed protein product                                310   1e-97    Coffea canephora [robusta coffee]
ref|XP_007015554.1|  Molybdopterin biosynthesis CNX1 protein / mo...    306   6e-97    
ref|XP_007015553.1|  Molybdopterin biosynthesis CNX1 protein / mo...    306   1e-96    
ref|XP_007015551.1|  Molybdopterin biosynthesis CNX1 protein / mo...    306   2e-96    
ref|XP_002515854.1|  molybdopterin biosynthesis protein, putative       305   8e-96    Ricinus communis
gb|EYU35987.1|  hypothetical protein MIMGU_mgv1a002507mg                303   7e-95    Erythranthe guttata [common monkey flower]
ref|XP_006446683.1|  hypothetical protein CICLE_v10014503mg             302   8e-95    Citrus clementina [clementine]
gb|KDP42916.1|  hypothetical protein JCGZ_23858                         301   2e-94    Jatropha curcas
gb|KJB55513.1|  hypothetical protein B456_009G080100                    300   3e-94    Gossypium raimondii
ref|XP_006470155.1|  PREDICTED: molybdopterin biosynthesis protei...    301   4e-94    Citrus sinensis [apfelsine]
gb|KHG12135.1|  Molybdopterin biosynthesis CNX1 -like protein           299   2e-93    Gossypium arboreum [tree cotton]
ref|XP_008231326.1|  PREDICTED: molybdopterin biosynthesis protei...    296   7e-93    
ref|XP_009350884.1|  PREDICTED: molybdopterin biosynthesis protei...    293   4e-92    
ref|XP_008349828.1|  PREDICTED: molybdopterin biosynthesis protei...    291   4e-92    
ref|XP_007204973.1|  hypothetical protein PRUPE_ppa002426mg             295   6e-92    Prunus persica
gb|EPS66354.1|  hypothetical protein M569_08423                         289   7e-92    Genlisea aurea
ref|XP_010926611.1|  PREDICTED: molybdopterin biosynthesis protei...    293   2e-91    
ref|XP_010926610.1|  PREDICTED: molybdopterin biosynthesis protei...    293   2e-91    Elaeis guineensis
emb|CBI24388.3|  unnamed protein product                                293   3e-91    Vitis vinifera
ref|XP_011043834.1|  PREDICTED: molybdopterin biosynthesis protei...    292   4e-91    Populus euphratica
ref|XP_002276536.1|  PREDICTED: molybdopterin biosynthesis protei...    293   4e-91    Vitis vinifera
ref|XP_009131833.1|  PREDICTED: molybdopterin biosynthesis protei...    292   6e-91    Brassica rapa
ref|XP_010420950.1|  PREDICTED: molybdopterin biosynthesis protei...    292   7e-91    Camelina sativa [gold-of-pleasure]
gb|KCW50986.1|  hypothetical protein EUGRSUZ_J00614                     287   9e-91    Eucalyptus grandis [rose gum]
ref|XP_006400671.1|  hypothetical protein EUTSA_v10012894mg             292   9e-91    Eutrema salsugineum [saltwater cress]
gb|KHN38452.1|  Molybdopterin biosynthesis protein CNX1                 291   1e-90    Glycine soja [wild soybean]
ref|NP_001242529.1|  molybdopterin biosynthesis protein CNX1-like       291   1e-90    Glycine max [soybeans]
ref|XP_002874027.1|  hypothetical protein ARALYDRAFT_489011             291   2e-90    
ref|XP_010031621.1|  PREDICTED: molybdopterin biosynthesis protei...    288   6e-90    
emb|CDX88829.1|  BnaA03g08200D                                          290   7e-90    
ref|XP_011090256.1|  PREDICTED: molybdopterin biosynthesis protei...    289   8e-90    Sesamum indicum [beniseed]
ref|XP_006286370.1|  hypothetical protein CARUB_v10000376mg             289   1e-89    
ref|XP_002312858.1|  hypothetical protein POPTR_0009s15810g             288   1e-89    
ref|XP_008787719.1|  PREDICTED: molybdopterin biosynthesis protei...    288   2e-89    Phoenix dactylifera
ref|XP_010031620.1|  PREDICTED: molybdopterin biosynthesis protei...    288   2e-89    Eucalyptus grandis [rose gum]
emb|CDX70956.1|  BnaC03g10400D                                          287   5e-89    
ref|NP_197599.1|  molybdenum cofactor biosynthesis enzyme CNX1          286   1e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KEH28337.1|  molybdenum cofactor biosynthesis protein CNX1           280   2e-88    Medicago truncatula
ref|XP_007141599.1|  hypothetical protein PHAVU_008G209600g             285   3e-88    Phaseolus vulgaris [French bean]
ref|XP_010093278.1|  Molybdopterin biosynthesis protein CNX1            285   3e-88    Morus notabilis
ref|XP_010454418.1|  PREDICTED: molybdopterin biosynthesis protei...    285   5e-88    Camelina sativa [gold-of-pleasure]
gb|KFK26315.1|  hypothetical protein AALP_AA8G231600                    285   5e-88    Arabis alpina [alpine rockcress]
ref|XP_007141600.1|  hypothetical protein PHAVU_008G209600g             285   6e-88    Phaseolus vulgaris [French bean]
ref|XP_004291534.1|  PREDICTED: molybdopterin biosynthesis protei...    284   9e-88    Fragaria vesca subsp. vesca
gb|KEH28338.1|  molybdenum cofactor biosynthesis protein CNX1           281   1e-87    Medicago truncatula
ref|XP_010493217.1|  PREDICTED: molybdopterin biosynthesis protei...    281   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010240846.1|  PREDICTED: molybdopterin biosynthesis protei...    279   1e-86    Nelumbo nucifera [Indian lotus]
gb|AAA97413.1|  molybdenum cofactor biosynthesis enzyme                 281   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003617060.1|  Molybdopterin biosynthesis CNX1 protein            281   1e-86    Medicago truncatula
ref|XP_010685502.1|  PREDICTED: molybdopterin biosynthesis protei...    278   1e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004159365.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    278   2e-85    
ref|XP_004144145.1|  PREDICTED: molybdopterin biosynthesis protei...    278   2e-85    
ref|XP_008451034.1|  PREDICTED: molybdopterin biosynthesis protei...    275   2e-84    Cucumis melo [Oriental melon]
ref|XP_011043840.1|  PREDICTED: molybdopterin biosynthesis protei...    271   6e-83    Populus euphratica
ref|XP_006379351.1|  hypothetical protein POPTR_0009s15810g             266   3e-81    
ref|XP_009383824.1|  PREDICTED: molybdopterin biosynthesis protei...    266   8e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010520491.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    265   2e-80    Tarenaya hassleriana [spider flower]
gb|ABR17730.1|  unknown                                                 262   2e-79    Picea sitchensis
ref|XP_006847466.1|  hypothetical protein AMTR_s00163p00018060          261   4e-79    Amborella trichopoda
emb|CAE04830.1|  OSJNBa0084K01.2                                        254   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447271.1|  hypothetical protein SORBIDRAFT_06g031680          254   2e-76    
ref|XP_009376133.1|  PREDICTED: molybdopterin biosynthesis protei...    253   3e-76    
ref|NP_001168286.1|  viviparous10                                       252   1e-75    Zea mays [maize]
ref|XP_004960170.1|  PREDICTED: molybdopterin biosynthesis protei...    249   1e-74    Setaria italica
gb|ABB30174.1|  molybdenum cofactor biosynthesis protein                248   3e-74    Zea mays [maize]
ref|XP_002973522.1|  hypothetical protein SELMODRAFT_149120             242   5e-72    
ref|XP_001770478.1|  predicted protein                                  240   4e-71    
ref|XP_003580744.1|  PREDICTED: molybdopterin biosynthesis protei...    238   2e-70    Brachypodium distachyon [annual false brome]
dbj|BAJ88077.1|  predicted protein                                      238   3e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02586.1|  predicted protein                                      238   3e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF73075.1|AF268595_1  molybdenum cofactor biosynthesis protei...    238   4e-70    Hordeum vulgare [barley]
ref|XP_002975554.1|  hypothetical protein SELMODRAFT_150666             237   5e-70    
gb|KDO47645.1|  hypothetical protein CISIN_1g0059001mg                  212   5e-66    Citrus sinensis [apfelsine]
gb|ABC42492.1|  molybdenum cofactor biosynthesis protein Cnx1E          210   2e-61    Chlamydomonas reinhardtii
ref|XP_002950060.1|  hypothetical protein VOLCADRAFT_90518              208   2e-60    Volvox carteri f. nagariensis
ref|XP_001698334.1|  molybdenum cofactor biosynthesis protein           206   3e-60    Chlamydomonas reinhardtii
ref|XP_006653844.1|  PREDICTED: molybdopterin biosynthesis protei...    209   2e-59    
gb|KGN66382.1|  hypothetical protein Csa_1G600220                       194   1e-58    Cucumis sativus [cucumbers]
ref|XP_005646314.1|  molybdopterin biosynthesis protein                 194   9e-56    Coccomyxa subellipsoidea C-169
gb|EMT03164.1|  Molybdopterin biosynthesis protein CNX1                 195   3e-54    
gb|KIZ01003.1|  Molybdopterin biosynthesis protein CNX1                 188   7e-53    Monoraphidium neglectum
ref|WP_014434007.1|  molybdopterin biosynthesis protein MoeA            185   2e-52    Caldilinea aerophila
ref|XP_009820960.1|  hypothetical protein, variant 3                    183   3e-51    Aphanomyces astaci
ref|XP_009820959.1|  hypothetical protein, variant 2                    183   1e-50    Aphanomyces astaci
ref|XP_010774817.1|  PREDICTED: gephyrin isoform X6                     180   4e-50    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010774813.1|  PREDICTED: gephyrin isoform X2                     181   4e-50    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010774812.1|  PREDICTED: gephyrin isoform X1                     181   4e-50    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010774816.1|  PREDICTED: gephyrin isoform X5                     181   5e-50    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010774814.1|  PREDICTED: gephyrin isoform X3                     181   5e-50    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009820957.1|  hypothetical protein H257_00123                    182   5e-50    Aphanomyces astaci
ref|XP_010133790.1|  PREDICTED: gephyrin-like                           177   6e-50    Buceros rhinoceros silvestris
ref|XP_010774815.1|  PREDICTED: gephyrin isoform X4                     181   6e-50    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009210028.1|  PREDICTED: gephyrin isoform X19                    179   1e-49    
ref|XP_003971788.1|  PREDICTED: gephyrin-like isoform 2                 182   1e-49    
gb|EPY79735.1|  hypothetical protein CB1_000898039                      176   1e-49    Camelus ferus
ref|XP_009210026.1|  PREDICTED: gephyrin isoform X17                    179   1e-49    
ref|XP_010880833.1|  PREDICTED: gephyrin isoform X4                     182   1e-49    Esox lucius
ref|XP_010880832.1|  PREDICTED: gephyrin isoform X3                     182   1e-49    
ref|XP_003971787.1|  PREDICTED: gephyrin-like isoform 1                 182   1e-49    
ref|XP_007255542.1|  PREDICTED: gephyrin isoform X3                     182   1e-49    Astyanax mexicanus [blind cave fish]
ref|XP_010880834.1|  PREDICTED: gephyrin isoform X5                     182   2e-49    Esox lucius
ref|XP_009210027.1|  PREDICTED: gephyrin isoform X18                    179   2e-49    
ref|XP_010880830.1|  PREDICTED: gephyrin isoform X1                     182   2e-49    
emb|CDQ81339.1|  unnamed protein product                                177   2e-49    Oncorhynchus mykiss
ref|XP_010880831.1|  PREDICTED: gephyrin isoform X2                     182   2e-49    
ref|XP_007255541.1|  PREDICTED: gephyrin isoform X2                     182   2e-49    Astyanax mexicanus [blind cave fish]
ref|XP_007255543.1|  PREDICTED: gephyrin isoform X4                     182   2e-49    Astyanax mexicanus [blind cave fish]
ref|NP_001165871.1|  gephyrin b                                         182   2e-49    Danio rerio [leopard danio]
ref|XP_007255540.1|  PREDICTED: gephyrin isoform X1                     182   2e-49    Astyanax mexicanus [blind cave fish]
ref|XP_011489844.1|  PREDICTED: gephyrin                                181   2e-49    
ref|XP_005991532.1|  PREDICTED: gephyrin isoform X3                     182   2e-49    
ref|XP_005991530.1|  PREDICTED: gephyrin isoform X1                     182   2e-49    
ref|XP_009210016.1|  PREDICTED: gephyrin isoform X7                     179   2e-49    
ref|XP_005991535.1|  PREDICTED: gephyrin isoform X6                     181   2e-49    
ref|XP_005991533.1|  PREDICTED: gephyrin isoform X4                     182   2e-49    
ref|XP_007255544.1|  PREDICTED: gephyrin isoform X5                     181   2e-49    Astyanax mexicanus [blind cave fish]
ref|XP_005991531.1|  PREDICTED: gephyrin isoform X2                     182   2e-49    
ref|XP_010880835.1|  PREDICTED: gephyrin isoform X6                     181   3e-49    Esox lucius
ref|XP_007255546.1|  PREDICTED: gephyrin isoform X7                     181   3e-49    Astyanax mexicanus [blind cave fish]
ref|XP_007244719.1|  PREDICTED: gephyrin-like isoform X3                182   3e-49    
ref|XP_007255545.1|  PREDICTED: gephyrin isoform X6                     181   3e-49    Astyanax mexicanus [blind cave fish]
ref|XP_007244723.1|  PREDICTED: gephyrin-like isoform X7                181   3e-49    
dbj|BAI68425.1|  gephyrin2                                              181   3e-49    Danio rerio [leopard danio]
ref|XP_009210021.1|  PREDICTED: gephyrin isoform X12                    178   3e-49    
ref|XP_009210024.1|  PREDICTED: gephyrin isoform X15                    178   3e-49    
ref|XP_009210020.1|  PREDICTED: gephyrin isoform X11                    179   3e-49    
ref|XP_007545562.1|  PREDICTED: gephyrin isoform X6                     181   3e-49    
ref|XP_009210025.1|  PREDICTED: gephyrin isoform X16                    178   4e-49    
ref|XP_005731179.1|  PREDICTED: gephyrin-like isoform X5                181   4e-49    Pundamilia nyererei
ref|XP_005991534.1|  PREDICTED: gephyrin isoform X5                     181   4e-49    Latimeria chalumnae
ref|XP_009210023.1|  PREDICTED: gephyrin isoform X14                    178   4e-49    
ref|XP_009210022.1|  PREDICTED: gephyrin isoform X13                    178   4e-49    
ref|XP_007244720.1|  PREDICTED: gephyrin-like isoform X4                181   4e-49    
ref|XP_009210018.1|  PREDICTED: gephyrin isoform X9                     179   4e-49    
ref|XP_007119741.1|  PREDICTED: gephyrin-like                           177   4e-49    
ref|XP_009210015.1|  PREDICTED: gephyrin isoform X6                     179   4e-49    
ref|XP_009210012.1|  PREDICTED: gephyrin isoform X3                     179   4e-49    
ref|XP_009210014.1|  PREDICTED: gephyrin isoform X5                     179   4e-49    
ref|XP_010736720.1|  PREDICTED: gephyrin                                181   4e-49    
ref|XP_007244722.1|  PREDICTED: gephyrin-like isoform X6                181   4e-49    
ref|XP_008311621.1|  PREDICTED: gephyrin isoform X3                     181   4e-49    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004550512.1|  PREDICTED: gephyrin-like isoform X1                181   4e-49    Maylandia zebra
ref|XP_004550514.1|  PREDICTED: gephyrin-like isoform X3                181   4e-49    Maylandia zebra
ref|XP_009210019.1|  PREDICTED: gephyrin isoform X10                    178   4e-49    
ref|XP_007244717.1|  PREDICTED: gephyrin-like isoform X1                181   4e-49    
ref|XP_003446336.1|  PREDICTED: gephyrin-like isoformX2                 181   4e-49    Oreochromis niloticus
ref|XP_005803169.1|  PREDICTED: gephyrin-like isoform X3                181   4e-49    
ref|XP_009210017.1|  PREDICTED: gephyrin isoform X8                     178   4e-49    
ref|XP_004550515.1|  PREDICTED: gephyrin-like isoform X4                181   4e-49    Maylandia zebra
gb|KFO14003.1|  Gephyrin                                                177   4e-49    Balearica regulorum gibbericeps
ref|XP_007244718.1|  PREDICTED: gephyrin-like isoform X2                181   4e-49    
ref|XP_005803167.1|  PREDICTED: gephyrin-like isoform X1                181   4e-49    
ref|XP_009210013.1|  PREDICTED: gephyrin isoform X4                     179   4e-49    
ref|XP_008311619.1|  PREDICTED: gephyrin isoform X1                     181   4e-49    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008311620.1|  PREDICTED: gephyrin isoform X2                     181   5e-49    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005803168.1|  PREDICTED: gephyrin-like isoform X2                181   5e-49    
ref|XP_007244721.1|  PREDICTED: gephyrin-like isoform X5                181   5e-49    
ref|XP_009877102.1|  PREDICTED: gephyrin                                177   5e-49    Apaloderma vittatum
pdb|2FTS|A  Chain A, Crystal Structure Of The Glycine Receptor-Ge...    176   5e-49    Rattus norvegicus [brown rat]
ref|XP_006792666.1|  PREDICTED: gephyrin-like isoform X5                181   5e-49    Neolamprologus brichardi [lyretail cichlid]
pdb|1T3E|A  Chain A, Structural Basis Of Dynamic Glycine Receptor...    176   5e-49    Rattus norvegicus [brown rat]
ref|XP_004908029.1|  PREDICTED: gephyrin                                177   5e-49    
ref|XP_009210010.1|  PREDICTED: gephyrin isoform X1                     179   5e-49    
ref|XP_008274970.1|  PREDICTED: gephyrin                                181   5e-49    Stegastes partitus
ref|XP_005803171.1|  PREDICTED: gephyrin-like isoform X5                180   5e-49    
ref|XP_003446335.1|  PREDICTED: gephyrin-like isoformX1                 180   5e-49    Oreochromis niloticus
gb|KFQ75480.1|  Gephyrin                                                178   5e-49    Phaethon lepturus
ref|XP_005803170.1|  PREDICTED: gephyrin-like isoform X4                181   6e-49    
ref|XP_009210011.1|  PREDICTED: gephyrin isoform X2                     179   6e-49    
ref|XP_010285902.1|  PREDICTED: gephyrin                                178   6e-49    Phaethon lepturus
ref|XP_008311622.1|  PREDICTED: gephyrin isoform X4                     180   6e-49    
ref|XP_007545537.1|  PREDICTED: gephyrin isoform X3                     180   6e-49    
ref|XP_007545531.1|  PREDICTED: gephyrin isoform X2                     181   6e-49    Poecilia formosa
emb|CAG03546.1|  unnamed protein product                                181   7e-49    Tetraodon nigroviridis
ref|XP_008395695.1|  PREDICTED: gephyrin isoform X2                     181   7e-49    
ref|XP_008395694.1|  PREDICTED: gephyrin isoform X1                     181   7e-49    
ref|XP_008395696.1|  PREDICTED: gephyrin isoform X3                     181   7e-49    
ref|XP_008395697.1|  PREDICTED: gephyrin isoform X4                     181   7e-49    
ref|XP_008395699.1|  PREDICTED: gephyrin isoform X6                     181   7e-49    
ref|XP_008395703.1|  PREDICTED: gephyrin isoform X10                    181   7e-49    
ref|XP_008395701.1|  PREDICTED: gephyrin isoform X8                     181   7e-49    
ref|XP_008395698.1|  PREDICTED: gephyrin isoform X5                     181   7e-49    
ref|XP_007886279.1|  PREDICTED: gephyrin isoform X1                     181   8e-49    Callorhinchus milii [Australian ghost shark]
dbj|BAI68423.1|  gephyrin1 isoform                                      180   8e-49    Danio rerio [leopard danio]
ref|XP_007886280.1|  PREDICTED: gephyrin isoform X2                     180   8e-49    Callorhinchus milii [Australian ghost shark]
ref|XP_008395704.1|  PREDICTED: gephyrin isoform X11                    180   8e-49    
ref|XP_008395702.1|  PREDICTED: gephyrin isoform X9                     181   8e-49    
ref|XP_007545524.1|  PREDICTED: gephyrin isoform X1                     180   8e-49    Poecilia formosa
ref|XP_008395700.1|  PREDICTED: gephyrin isoform X7                     181   9e-49    
ref|XP_007545554.1|  PREDICTED: gephyrin isoform X5                     180   1e-48    Poecilia formosa
dbj|BAI68421.1|  gephyrin1                                              180   1e-48    Danio rerio [leopard danio]
ref|XP_010895559.1|  PREDICTED: gephyrin-like                           180   1e-48    
ref|XP_007545546.1|  PREDICTED: gephyrin isoform X4                     179   1e-48    
emb|CDQ60441.1|  unnamed protein product                                176   1e-48    Oncorhynchus mykiss
ref|NP_001170915.1|  gephyrin                                           180   1e-48    Danio rerio [leopard danio]
ref|XP_009910881.1|  PREDICTED: gephyrin                                175   1e-48    Haliaeetus albicilla
dbj|BAI68422.1|  gephyrin1 isoform                                      180   1e-48    Danio rerio [leopard danio]
ref|XP_006632748.1|  PREDICTED: gephyrin-like                           179   1e-48    Lepisosteus oculatus
ref|XP_008863031.1|  hypothetical protein, variant 18                   176   1e-48    Aphanomyces invadans
ref|XP_005812094.1|  PREDICTED: gephyrin-like                           179   1e-48    
gb|KFP96091.1|  Gephyrin                                                175   1e-48    Haliaeetus albicilla
ref|NP_001085376.1|  MGC83148 protein                                   180   1e-48    Xenopus laevis [clawed frog]
ref|XP_008574539.1|  PREDICTED: gephyrin                                174   1e-48    Galeopterus variegatus [Malayan flying lemur]
ref|XP_006760165.1|  PREDICTED: gephyrin-like                           179   1e-48    Myotis davidii
ref|XP_008863027.1|  hypothetical protein, variant 14                   177   1e-48    Aphanomyces invadans
ref|XP_011489073.1|  PREDICTED: gephyrin-like                           179   1e-48    
ref|XP_008863025.1|  hypothetical protein, variant 12                   177   1e-48    Aphanomyces invadans
ref|XP_010795752.1|  PREDICTED: gephyrin-like                           179   1e-48    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007575455.1|  PREDICTED: gephyrin-like isoform X2                179   2e-48    
ref|XP_007640584.1|  PREDICTED: gephyrin isoform X2                     178   2e-48    
ref|XP_006891897.1|  PREDICTED: gephyrin-like                           179   2e-48    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008863024.1|  hypothetical protein, variant 11                   177   2e-48    Aphanomyces invadans
ref|XP_006873126.1|  PREDICTED: gephyrin-like                           177   2e-48    Chrysochloris asiatica
ref|XP_008863018.1|  hypothetical protein, variant 9                    177   2e-48    Aphanomyces invadans
ref|XP_005461955.1|  PREDICTED: gephyrin-like isoform X3                179   2e-48    Oreochromis niloticus
ref|XP_010743432.1|  PREDICTED: gephyrin-like isoform X1                179   2e-48    
ref|XP_010743433.1|  PREDICTED: gephyrin-like isoform X2                179   2e-48    
ref|XP_008301210.1|  PREDICTED: gephyrin-like                           179   2e-48    Stegastes partitus
ref|XP_007985214.1|  PREDICTED: gephyrin isoform X25                    179   2e-48    Chlorocebus sabaeus
ref|XP_008314898.1|  PREDICTED: gephyrin-like isoform X3                179   2e-48    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005751787.1|  PREDICTED: gephyrin-like isoform X2                179   2e-48    Pundamilia nyererei
gb|KFQ07278.1|  Gephyrin                                                178   2e-48    Leptosomus discolor
ref|XP_008314882.1|  PREDICTED: gephyrin-like isoform X1                178   2e-48    
ref|XP_007575454.1|  PREDICTED: gephyrin-like isoform X1                179   2e-48    
ref|XP_008863015.1|  hypothetical protein, variant 6                    177   2e-48    Aphanomyces invadans
ref|XP_004055367.1|  PREDICTED: gephyrin                                178   2e-48    
ref|XP_005942199.1|  PREDICTED: gephyrin-like isoform X2                179   3e-48    Haplochromis burtoni
ref|XP_004649707.1|  PREDICTED: gephyrin                                179   3e-48    
ref|XP_008863019.1|  hypothetical protein, variant 4                    177   3e-48    Aphanomyces invadans
gb|KFV15625.1|  Gephyrin                                                178   3e-48    Pterocles gutturalis
ref|XP_010219094.1|  PREDICTED: gephyrin isoform X9                     179   3e-48    Tinamus guttatus
ref|XP_004569994.1|  PREDICTED: gephyrin-like                           179   3e-48    
ref|XP_005751786.1|  PREDICTED: gephyrin-like isoform X1                179   3e-48    Pundamilia nyererei
ref|XP_005461956.1|  PREDICTED: gephyrin-like isoform X4                179   3e-48    
ref|XP_009004421.1|  PREDICTED: gephyrin isoform X8                     179   3e-48    Callithrix jacchus [common marmoset]
ref|XP_010389401.1|  PREDICTED: gephyrin isoform X22                    178   3e-48    
ref|XP_007985213.1|  PREDICTED: gephyrin isoform X24                    178   3e-48    Chlorocebus sabaeus
gb|KFP67249.1|  Gephyrin                                                178   3e-48    Cariama cristata
ref|XP_008698917.1|  PREDICTED: gephyrin isoform X4                     178   3e-48    Ursus maritimus [white bear]
ref|XP_008137162.1|  PREDICTED: gephyrin isoform X5                     178   3e-48    Eptesicus fuscus
ref|XP_007054326.1|  PREDICTED: gephyrin                                178   3e-48    
gb|KFM10386.1|  Gephyrin                                                178   3e-48    Aptenodytes forsteri
gb|EMC83799.1|  Gephyrin                                                178   3e-48    
dbj|BAH12583.1|  unnamed protein product                                178   3e-48    Homo sapiens [man]
gb|ACE06970.1|  gephyrin isoform                                        178   3e-48    Rattus norvegicus [brown rat]
ref|NP_074056.2|  gephyrin                                              178   3e-48    Rattus norvegicus [brown rat]
ref|XP_009667153.1|  PREDICTED: gephyrin isoform X5                     179   3e-48    Struthio camelus australis
ref|XP_010219102.1|  PREDICTED: gephyrin isoform X16                    178   3e-48    Tinamus guttatus
ref|XP_009945537.1|  PREDICTED: gephyrin                                178   3e-48    Leptosomus discolor
gb|KFO96184.1|  Gephyrin                                                178   3e-48    Calypte anna
ref|XP_010709863.1|  PREDICTED: gephyrin isoform X7                     178   3e-48    
ref|XP_008137161.1|  PREDICTED: gephyrin isoform X4                     178   3e-48    Eptesicus fuscus
ref|XP_006515969.1|  PREDICTED: gephyrin isoform X8                     178   3e-48    Mus musculus [mouse]
ref|XP_004624968.1|  PREDICTED: gephyrin                                178   3e-48    
ref|XP_005149323.1|  PREDICTED: gephyrin isoform X2                     178   3e-48    Melopsittacus undulatus
ref|XP_006515966.1|  PREDICTED: gephyrin isoform X5                     179   3e-48    Mus musculus [mouse]
ref|XP_006113471.1|  PREDICTED: gephyrin isoform X2                     178   3e-48    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010219091.1|  PREDICTED: gephyrin isoform X6                     179   3e-48    Tinamus guttatus
ref|NP_001019389.1|  gephyrin isoform 2                                 178   3e-48    Homo sapiens [man]
ref|XP_008314890.1|  PREDICTED: gephyrin-like isoform X2                178   3e-48    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010389322.1|  PREDICTED: gephyrin isoform X13                    179   3e-48    
gb|EDM03692.1|  rCG61772, isoform CRA_b                                 178   3e-48    Rattus norvegicus [brown rat]
ref|XP_010960579.1|  PREDICTED: gephyrin isoform X4                     178   3e-48    Camelus bactrianus [camel]
ref|XP_008698909.1|  PREDICTED: gephyrin isoform X3                     178   3e-48    Ursus maritimus [white bear]
emb|CAC81240.1|  gephyrin                                               178   3e-48    Homo sapiens [man]
ref|XP_008137160.1|  PREDICTED: gephyrin isoform X3                     178   3e-48    
ref|XP_005306754.1|  PREDICTED: gephyrin isoform X7                     178   3e-48    Chrysemys picta bellii
ref|XP_006515967.1|  PREDICTED: gephyrin isoform X6                     179   3e-48    Mus musculus [mouse]
ref|XP_004087213.1|  PREDICTED: gephyrin isoform 4                      178   3e-48    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006207019.1|  PREDICTED: gephyrin isoform X4                     178   3e-48    
ref|XP_003797435.1|  PREDICTED: gephyrin isoform 2                      178   3e-48    
ref|XP_007184373.1|  PREDICTED: gephyrin isoform X5                     178   3e-48    Balaenoptera acutorostrata scammoni
ref|XP_004397630.1|  PREDICTED: gephyrin isoform 3                      178   3e-48    Odobenus rosmarus divergens
ref|XP_010389350.1|  PREDICTED: gephyrin isoform X16                    178   3e-48    
gb|ELK32980.1|  Gephyrin                                                177   3e-48    
ref|XP_006207018.1|  PREDICTED: gephyrin isoform X3                     178   3e-48    
ref|XP_004584525.1|  PREDICTED: gephyrin isoform X3                     178   3e-48    
ref|XP_006186514.1|  PREDICTED: gephyrin isoform X1                     178   3e-48    
ref|XP_010219100.1|  PREDICTED: gephyrin isoform X14                    178   3e-48    
ref|XP_007634980.1|  PREDICTED: gephyrin isoform X4                     177   3e-48    
ref|XP_010082145.1|  PREDICTED: gephyrin                                178   3e-48    
ref|XP_007525883.1|  PREDICTED: gephyrin isoform X3                     178   3e-48    
gb|EHH53971.1|  hypothetical protein EGM_14695                          177   3e-48    
ref|XP_004739019.1|  PREDICTED: gephyrin isoform X3                     178   3e-48    
ref|NP_766540.2|  gephyrin isoform 2                                    178   3e-48    
ref|XP_009667158.1|  PREDICTED: gephyrin isoform X10                    178   3e-48    
ref|XP_003962333.1|  PREDICTED: gephyrin-like isoform 1                 178   3e-48    
ref|XP_005942198.1|  PREDICTED: gephyrin-like isoform X1                179   3e-48    
ref|XP_005961619.1|  PREDICTED: gephyrin isoform X4                     178   3e-48    
ref|XP_010389367.1|  PREDICTED: gephyrin isoform X18                    178   3e-48    
ref|XP_010709861.1|  PREDICTED: gephyrin isoform X5                     178   3e-48    
ref|XP_009426249.1|  PREDICTED: gephyrin isoform X11                    179   3e-48    
ref|XP_005461953.1|  PREDICTED: gephyrin-like isoform X1                179   4e-48    
ref|XP_005343305.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_007449084.1|  PREDICTED: gephyrin isoform X3                     178   4e-48    
ref|XP_006207020.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_010389386.1|  PREDICTED: gephyrin isoform X20                    178   4e-48    
ref|XP_010219099.1|  PREDICTED: gephyrin isoform X13                    178   4e-48    
ref|XP_010389309.1|  PREDICTED: gephyrin isoform X11                    179   4e-48    
ref|XP_007424562.1|  PREDICTED: gephyrin isoform X2                     177   4e-48    
ref|XP_010960581.1|  PREDICTED: gephyrin isoform X6                     178   4e-48    
ref|XP_005267311.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_010389409.1|  PREDICTED: gephyrin isoform X23                    178   4e-48    
ref|XP_007184377.1|  PREDICTED: gephyrin isoform X9                     178   4e-48    
ref|XP_006973191.1|  PREDICTED: gephyrin isoform X2                     178   4e-48    
ref|XP_004087214.1|  PREDICTED: gephyrin isoform 5                      177   4e-48    
ref|XP_008976026.1|  PREDICTED: gephyrin isoform X4                     178   4e-48    
gb|ERE72900.1|  gephyrin-like protein                                   179   4e-48    
ref|XP_010219088.1|  PREDICTED: gephyrin isoform X4                     179   4e-48    
ref|XP_009667150.1|  PREDICTED: gephyrin isoform X2                     178   4e-48    
ref|XP_009667151.1|  PREDICTED: gephyrin isoform X3                     178   4e-48    
ref|XP_010709859.1|  PREDICTED: gephyrin isoform X3                     178   4e-48    
ref|XP_008270111.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_005306750.1|  PREDICTED: gephyrin isoform X2                     179   4e-48    
ref|XP_010219086.1|  PREDICTED: gephyrin isoform X2                     179   4e-48    
ref|XP_005149322.1|  PREDICTED: gephyrin isoform X1                     178   4e-48    
ref|XP_005047272.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_010389393.1|  PREDICTED: gephyrin isoform X21                    178   4e-48    
ref|XP_008171028.1|  PREDICTED: gephyrin isoform X8                     178   4e-48    
ref|XP_007184371.1|  PREDICTED: gephyrin isoform X3                     178   4e-48    
ref|XP_010219097.1|  PREDICTED: gephyrin isoform X11                    178   4e-48    
ref|XP_010219101.1|  PREDICTED: gephyrin isoform X15                    178   4e-48    
ref|XP_007095240.1|  PREDICTED: gephyrin                                177   4e-48    
ref|XP_008137159.1|  PREDICTED: gephyrin isoform X2                     178   4e-48    
ref|XP_003435079.1|  PREDICTED: gephyrin isoformX1                      178   4e-48    
ref|XP_004584528.1|  PREDICTED: gephyrin isoform X6                     177   4e-48    
ref|XP_008532960.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_002199469.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_004797268.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_006113470.1|  PREDICTED: gephyrin isoform X1                     178   4e-48    
ref|XP_005399155.1|  PREDICTED: gephyrin-like isoform X6                178   4e-48    
gb|KFV54837.1|  Gephyrin                                                177   4e-48    
ref|XP_010389378.1|  PREDICTED: gephyrin isoform X19                    178   4e-48    
ref|XP_005686046.1|  PREDICTED: gephyrin isoform X2                     177   4e-48    
ref|XP_004426312.1|  PREDICTED: gephyrin isoform 1                      178   4e-48    
ref|XP_006158860.1|  PREDICTED: gephyrin-like                           177   4e-48    
ref|XP_005877967.1|  PREDICTED: gephyrin isoform X3                     178   4e-48    
ref|XP_005561586.1|  PREDICTED: gephyrin isoform X13                    178   4e-48    
ref|XP_010586998.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin           178   4e-48    
ref|XP_010709857.1|  PREDICTED: gephyrin isoform X2                     178   4e-48    
ref|XP_009967833.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_009004417.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
gb|EDL02616.1|  gephyrin                                                178   4e-48    
sp|Q03555.3|GEPH_RAT  RecName: Full=Gephyrin; AltName: Full=Putat...    178   4e-48    
ref|XP_004837433.1|  PREDICTED: gephyrin isoform X2                     178   4e-48    
gb|EFB27446.1|  hypothetical protein PANDA_014591                       178   4e-48    
ref|XP_002925155.2|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_011399951.1|  Molybdopterin biosynthesis protein CNX1            179   4e-48    
ref|XP_008934372.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_006734710.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_005502495.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_010960580.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_004739021.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_006063370.1|  PREDICTED: gephyrin                                177   4e-48    
ref|XP_008863014.1|  hypothetical protein, variant 5                    177   4e-48    
ref|XP_002754063.1|  PREDICTED: gephyrin isoform X9                     178   4e-48    
ref|XP_009702991.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_004371016.1|  PREDICTED: gephyrin isoform 1                      178   4e-48    
ref|XP_009806789.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin           178   4e-48    
ref|XP_005230781.1|  PREDICTED: gephyrin isoform X1                     178   4e-48    
ref|XP_004681826.1|  PREDICTED: gephyrin isoform X2                     178   4e-48    
ref|XP_004397629.1|  PREDICTED: gephyrin isoform 2                      178   4e-48    
ref|XP_005267307.1|  PREDICTED: gephyrin isoform X1                     178   4e-48    
ref|XP_005561578.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_005441200.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_009881803.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_005306753.1|  PREDICTED: gephyrin isoform X6                     178   4e-48    
ref|XP_005479964.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_010219103.1|  PREDICTED: gephyrin isoform X17                    178   4e-48    
ref|XP_010572580.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_001369816.1|  PREDICTED: gephyrin isoform X1                     178   4e-48    
ref|XP_009576425.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_005009845.1|  PREDICTED: gephyrin                                178   4e-48    
ref|XP_008863017.1|  hypothetical protein, variant 8                    176   4e-48    
ref|XP_010219093.1|  PREDICTED: gephyrin isoform X8                     178   4e-48    
ref|XP_005561587.1|  PREDICTED: gephyrin isoform X14                    178   4e-48    
gb|EOB08497.1|  Gephyrin                                                178   4e-48    
ref|XP_010643623.1|  PREDICTED: gephyrin isoform X1                     178   4e-48    
ref|XP_006207017.1|  PREDICTED: gephyrin isoform X2                     178   4e-48    
ref|XP_005520407.1|  PREDICTED: gephyrin isoform X1                     178   4e-48    
dbj|BAH12110.1|  unnamed protein product                                177   4e-48    
ref|XP_009281820.1|  PREDICTED: gephyrin                                178   4e-48    
ref|NP_065857.1|  gephyrin isoform 1                                    178   4e-48    
ref|XP_010219092.1|  PREDICTED: gephyrin isoform X7                     178   4e-48    
ref|XP_010389417.1|  PREDICTED: gephyrin isoform X24                    178   4e-48    
ref|XP_003797434.1|  PREDICTED: gephyrin isoform 1                      178   4e-48    
ref|XP_010219090.1|  PREDICTED: gephyrin isoform X5                     178   4e-48    
ref|XP_007940487.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_007473123.1|  PREDICTED: gephyrin isoform X5                     178   5e-48    
ref|XP_005399153.1|  PREDICTED: gephyrin-like isoform X4                178   5e-48    
ref|XP_008137157.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_006207016.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_005306752.1|  PREDICTED: gephyrin isoform X5                     178   5e-48    
dbj|BAA92623.1|  KIAA1385 protein                                       178   5e-48    
ref|XP_005417698.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_011281583.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_005343303.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
ref|XP_004612402.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|NP_666077.2|  gephyrin isoform 1                                    178   5e-48    
ref|XP_010960577.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_008976023.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_007424561.1|  PREDICTED: gephyrin isoform X1                     177   5e-48    
gb|EAW80923.1|  gephyrin, isoform CRA_a                                 178   5e-48    
ref|XP_003962334.1|  PREDICTED: gephyrin-like isoform 2                 178   5e-48    
ref|XP_009319275.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_001135362.2|  PREDICTED: gephyrin isoform X15                    178   5e-48    
dbj|BAH11801.1|  unnamed protein product                                178   5e-48    
ref|XP_004584523.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_010709862.1|  PREDICTED: gephyrin isoform X6                     178   5e-48    
ref|XP_010709860.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_005561591.1|  PREDICTED: gephyrin isoform X18                    178   5e-48    
ref|XP_009930116.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_008698894.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_009004414.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_005561580.1|  PREDICTED: gephyrin isoform X7                     178   5e-48    
ref|XP_006720066.1|  PREDICTED: gephyrin isoform X6                     178   5e-48    
ref|XP_009667156.1|  PREDICTED: gephyrin isoform X8                     178   5e-48    
ref|XP_005686045.1|  PREDICTED: gephyrin isoform X1                     177   5e-48    
ref|XP_010389246.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
ref|XP_010389300.1|  PREDICTED: gephyrin isoform X9                     178   5e-48    
ref|XP_004739017.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_008698901.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_006515968.1|  PREDICTED: gephyrin isoform X7                     178   5e-48    
ref|XP_010157436.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_010389313.1|  PREDICTED: gephyrin isoform X12                    178   5e-48    
ref|XP_010960582.1|  PREDICTED: gephyrin isoform X7                     178   5e-48    
ref|XP_009667154.1|  PREDICTED: gephyrin isoform X6                     178   5e-48    
ref|XP_006973190.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_009004415.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
ref|XP_009667148.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_009667152.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_007525881.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_007985198.1|  PREDICTED: gephyrin isoform X10                    178   5e-48    
ref|XP_007985215.1|  PREDICTED: gephyrin isoform X26                    178   5e-48    
ref|XP_007940486.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_005961616.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_009667157.1|  PREDICTED: gephyrin isoform X9                     178   5e-48    
ref|XP_006515965.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
gb|ELK09870.1|  Gephyrin                                                178   5e-48    
ref|XP_005399151.1|  PREDICTED: gephyrin-like isoform X2                178   5e-48    
ref|XP_005877970.1|  PREDICTED: gephyrin isoform X6                     178   5e-48    
ref|XP_005399152.1|  PREDICTED: gephyrin-like isoform X3                178   5e-48    
ref|XP_005961617.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_005561579.1|  PREDICTED: gephyrin isoform X6                     178   5e-48    
ref|XP_006515962.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_010389358.1|  PREDICTED: gephyrin isoform X17                    178   5e-48    
ref|XP_010960578.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
ref|XP_010219085.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_007985197.1|  PREDICTED: gephyrin isoform X9                     178   5e-48    
ref|XP_004739022.1|  PREDICTED: gephyrin isoform X6                     178   5e-48    
ref|XP_010219096.1|  PREDICTED: gephyrin isoform X10                    178   5e-48    
ref|XP_011281582.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
ref|XP_008171027.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
gb|EDM03691.1|  rCG61772, isoform CRA_a                                 178   5e-48    
gb|ELR59365.1|  Gephyrin                                                177   5e-48    
ref|XP_010807862.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
ref|XP_010709856.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_010006035.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_010219098.1|  PREDICTED: gephyrin isoform X12                    178   5e-48    
ref|XP_005322860.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_009004413.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_004837432.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_010219087.1|  PREDICTED: gephyrin isoform X3                     178   5e-48    
ref|XP_009100662.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_007985194.1|  PREDICTED: gephyrin isoform X6                     178   5e-48    
ref|XP_005561577.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_009667155.1|  PREDICTED: gephyrin isoform X7                     178   5e-48    
ref|XP_008497366.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_005306751.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_009004416.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_008637951.1|  PREDICTED: gephyrin                                178   5e-48    
ref|XP_004797265.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_007184370.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_005623588.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_010389307.1|  PREDICTED: gephyrin isoform X10                    178   5e-48    
ref|XP_003586638.1|  PREDICTED: gephyrin isoform X8                     178   5e-48    
ref|NP_001230231.1|  gephyrin                                           178   5e-48    
ref|XP_005561574.1|  PREDICTED: gephyrin isoform X1                     179   5e-48    
ref|XP_005306749.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_009426250.1|  PREDICTED: gephyrin isoform X12                    178   5e-48    
ref|XP_010389341.1|  PREDICTED: gephyrin isoform X15                    178   5e-48    
ref|XP_005322862.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_007985188.1|  PREDICTED: gephyrin isoform X1                     179   5e-48    
ref|XP_004739020.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_007985201.1|  PREDICTED: gephyrin isoform X13                    178   5e-48    
ref|XP_005877971.1|  PREDICTED: gephyrin isoform X7                     178   5e-48    
ref|XP_007473122.1|  PREDICTED: gephyrin isoform X4                     178   5e-48    
ref|XP_003797436.1|  PREDICTED: gephyrin isoform 3                      178   5e-48    
ref|XP_007449082.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_006515963.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_005877969.1|  PREDICTED: gephyrin isoform X5                     178   5e-48    
ref|XP_005343301.1|  PREDICTED: gephyrin isoform X1                     178   5e-48    
ref|XP_005877966.1|  PREDICTED: gephyrin isoform X2                     178   5e-48    
ref|XP_009004420.1|  PREDICTED: gephyrin isoform X7                     178   5e-48    
ref|NP_001090459.1|  gephyrin                                           178   6e-48    



>ref|XP_004228477.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Solanum lycopersicum]
Length=670

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 184/215 (86%), Gaps = 4/215 (2%)
 Frame = +2

Query  29   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  196
            M ENG   IS    KM++  EALEIVL+VAQRLPPV++P+H+ LG+VLAEDITAPDPLPP
Sbjct  1    MGENGGTQISTNTNKMITVEEALEIVLNVAQRLPPVTLPIHEVLGKVLAEDITAPDPLPP  60

Query  197  YPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQ  376
            YPASIKDGYAVV++DGPG YP+ITESRAGND LGV VTPGTVAYVTTGGP+PDGADAVVQ
Sbjct  61   YPASIKDGYAVVAADGPGEYPVITESRAGNDALGVTVTPGTVAYVTTGGPVPDGADAVVQ  120

Query  377  VENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATV  556
            VE+TE +  AS E K+VRILK T PGVDIR VGSDIA+G +VLKSGE LGA EIGLLATV
Sbjct  121  VEDTESISVASAERKRVRILKQTSPGVDIRAVGSDIAQGTIVLKSGERLGAAEIGLLATV  180

Query  557  GVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            GV  V+VYP PTI VLSTGDELVEP VG L+RGQI
Sbjct  181  GVVAVKVYPCPTIGVLSTGDELVEPTVGSLNRGQI  215



>ref|XP_009601464.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
tomentosiformis]
Length=667

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = +2

Query  29   MSENGEAPIS-KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPA  205
            M ENG   IS KM+   EAL+IVLSVAQRLPPV++P+H+ALG++LAEDITAPDPLPPYPA
Sbjct  1    MGENGGTQISNKMIPVEEALDIVLSVAQRLPPVALPIHEALGKILAEDITAPDPLPPYPA  60

Query  206  SIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVEN  385
            SIKDGYAVV++DGPG YP+I ESRAGNDGLGV VT GTVAYVTTGGP+PDGADAVVQVE+
Sbjct  61   SIKDGYAVVAADGPGEYPVIAESRAGNDGLGVTVTSGTVAYVTTGGPVPDGADAVVQVED  120

Query  386  TELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVT  565
            TE +  AS E+K+V+ILK T PGVDIRPVGSDIA+G +VLKSGE LGA EIGLLATVGV 
Sbjct  121  TESISVASAETKRVKILKQTSPGVDIRPVGSDIAQGGIVLKSGERLGAAEIGLLATVGVV  180

Query  566  IVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
             V+VYP+PT+AVLSTGDELVEP VG L RGQI
Sbjct  181  TVKVYPSPTVAVLSTGDELVEPTVGRLDRGQI  212



>ref|XP_006362730.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X2 [Solanum tuberosum]
Length=670

 Score =   314 bits (804),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 182/215 (85%), Gaps = 4/215 (2%)
 Frame = +2

Query  29   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  196
            M E G   IS    KM++  EALEIVL+VAQRLPPVS+P+H+  G+VLAEDITAPDPLPP
Sbjct  1    MGEKGGTQISTNTNKMITVEEALEIVLNVAQRLPPVSLPIHEVSGKVLAEDITAPDPLPP  60

Query  197  YPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQ  376
            YPASIKDGYAVV++DGPG Y +ITESRAGND LGV VTPGTVAYVTTGGP+PDGADAVVQ
Sbjct  61   YPASIKDGYAVVAADGPGEYTVITESRAGNDALGVTVTPGTVAYVTTGGPVPDGADAVVQ  120

Query  377  VENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATV  556
            VE+TE +  AS E KQVRILK T PGVD+R VGSDIA+G +VLKSGE LGA EIGLLATV
Sbjct  121  VEDTESISVASAERKQVRILKQTSPGVDVRAVGSDIAQGTIVLKSGERLGAAEIGLLATV  180

Query  557  GVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            GV  V+VYP+PTI VLSTGDELVEP VG L+RGQI
Sbjct  181  GVVAVKVYPSPTIGVLSTGDELVEPTVGRLNRGQI  215



>ref|XP_006362729.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score =   314 bits (804),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 182/215 (85%), Gaps = 4/215 (2%)
 Frame = +2

Query  29   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  196
            M E G   IS    KM++  EALEIVL+VAQRLPPVS+P+H+  G+VLAEDITAPDPLPP
Sbjct  1    MGEKGGTQISTNTNKMITVEEALEIVLNVAQRLPPVSLPIHEVSGKVLAEDITAPDPLPP  60

Query  197  YPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQ  376
            YPASIKDGYAVV++DGPG Y +ITESRAGND LGV VTPGTVAYVTTGGP+PDGADAVVQ
Sbjct  61   YPASIKDGYAVVAADGPGEYTVITESRAGNDALGVTVTPGTVAYVTTGGPVPDGADAVVQ  120

Query  377  VENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATV  556
            VE+TE +  AS E KQVRILK T PGVD+R VGSDIA+G +VLKSGE LGA EIGLLATV
Sbjct  121  VEDTESISVASAERKQVRILKQTSPGVDVRAVGSDIAQGTIVLKSGERLGAAEIGLLATV  180

Query  557  GVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            GV  V+VYP+PTI VLSTGDELVEP VG L+RGQI
Sbjct  181  GVVAVKVYPSPTIGVLSTGDELVEPTVGRLNRGQI  215



>ref|XP_009765762.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
sylvestris]
Length=667

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 184/212 (87%), Gaps = 1/212 (0%)
 Frame = +2

Query  29   MSENGEAPIS-KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPA  205
            M ENG   IS KM+   EAL++VLSVAQRLPPV++P+H+ALG++LAEDITAPDPLPPYPA
Sbjct  1    MGENGGTQISNKMIPVEEALDMVLSVAQRLPPVTLPIHEALGKILAEDITAPDPLPPYPA  60

Query  206  SIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVEN  385
            SIKDGYAVV++DGPG Y +I ESRAGNDG+GV +TPGTVAYVTTGGP+PDGADAVVQVE+
Sbjct  61   SIKDGYAVVAADGPGEYSVIAESRAGNDGVGVTITPGTVAYVTTGGPVPDGADAVVQVED  120

Query  386  TELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVT  565
            TE +  AS+E K+VRILK T PGVDIR VGSDIA+G +V++SGE LGA EIGLLATVGV 
Sbjct  121  TESISAASSELKRVRILKQTSPGVDIRAVGSDIAQGTIVMQSGERLGAAEIGLLATVGVV  180

Query  566  IVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
             V+VYP+P +AVLSTGDELVEP VG L RGQI
Sbjct  181  TVKVYPSPKVAVLSTGDELVEPTVGRLDRGQI  212



>emb|CDP15575.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 7/207 (3%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S +EAL+IVLS +Q+LPP++VPL  ALG++LAEDI APDPLPPYPAS+KDGYAVV+SD
Sbjct  1    MISVDEALQIVLSQSQKLPPITVPLKDALGKILAEDIHAPDPLPPYPASVKDGYAVVASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGG-------PIPDGADAVVQVENTELLL  400
            GPG YP+ITESRAGNDG GV VT GTVAYVTTGG       PIPDGADAVVQVE+TELL 
Sbjct  61   GPGEYPVITESRAGNDGFGVTVTSGTVAYVTTGGNSLFSLGPIPDGADAVVQVEDTELLE  120

Query  401  DASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVY  580
            +A+ E K+VRILK   PGVDIRPVG DI KGD+VLKSGEHL A EIGLLATVGV +V+VY
Sbjct  121  NAAAEPKRVRILKQINPGVDIRPVGFDITKGDLVLKSGEHLDAAEIGLLATVGVMMVKVY  180

Query  581  PTPTIAVLSTGDELVEPEVGCLSRGQI  661
            P PTIAVLSTGDELVEP V CL+RGQI
Sbjct  181  PAPTIAVLSTGDELVEPTVACLTRGQI  207



>ref|XP_007015554.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
 gb|EOY33173.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
Length=607

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            KM+S++EAL+IVLSVA++LPPV+VPLHQALG+VLA+DI APDPLPPYPASIKDGYAVV+S
Sbjct  10   KMISADEALQIVLSVAKQLPPVTVPLHQALGKVLAQDIRAPDPLPPYPASIKDGYAVVAS  69

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE +  +S ES
Sbjct  70   DGPGEYPVITESRAGNDGVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEQVKASSVES  129

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            K+VR+L  T  GVDIRPVG DI K  +VLKSGE +GA E+GLLATVGVT+V+V P P IA
Sbjct  130  KRVRMLVQTRKGVDIRPVGCDIQKDALVLKSGERIGASEVGLLATVGVTMVKVQPMPAIA  189

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDELVEP  G LSRGQI
Sbjct  190  VLSTGDELVEPTTGFLSRGQI  210



>ref|XP_007015553.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
 gb|EOY33172.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
Length=630

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            KM+S++EAL+IVLSVA++LPPV+VPLHQALG+VLA+DI APDPLPPYPASIKDGYAVV+S
Sbjct  15   KMISADEALQIVLSVAKQLPPVTVPLHQALGKVLAQDIRAPDPLPPYPASIKDGYAVVAS  74

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE +  +S ES
Sbjct  75   DGPGEYPVITESRAGNDGVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEQVKASSVES  134

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            K+VR+L  T  GVDIRPVG DI K  +VLKSGE +GA E+GLLATVGVT+V+V P P IA
Sbjct  135  KRVRMLVQTRKGVDIRPVGCDIQKDALVLKSGERIGASEVGLLATVGVTMVKVQPMPAIA  194

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDELVEP  G LSRGQI
Sbjct  195  VLSTGDELVEPTTGFLSRGQI  215



>ref|XP_007015551.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 ref|XP_007015552.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33170.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33171.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
Length=676

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            KM+S++EAL+IVLSVA++LPPV+VPLHQALG+VLA+DI APDPLPPYPASIKDGYAVV+S
Sbjct  15   KMISADEALQIVLSVAKQLPPVTVPLHQALGKVLAQDIRAPDPLPPYPASIKDGYAVVAS  74

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE +  +S ES
Sbjct  75   DGPGEYPVITESRAGNDGVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEQVKASSVES  134

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            K+VR+L  T  GVDIRPVG DI K  +VLKSGE +GA E+GLLATVGVT+V+V P P IA
Sbjct  135  KRVRMLVQTRKGVDIRPVGCDIQKDALVLKSGERIGASEVGLLATVGVTMVKVQPMPAIA  194

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDELVEP  G LSRGQI
Sbjct  195  VLSTGDELVEPTTGFLSRGQI  215



>ref|XP_002515854.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
 gb|EEF46523.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
Length=668

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            S M+S  +AL  +L VAQRL P++VPLH A G+VLAEDI APDPLPPYPASIKDGYAVV+
Sbjct  12   STMISVEDALSTILKVAQRLQPITVPLHDAFGKVLAEDIRAPDPLPPYPASIKDGYAVVA  71

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV +TPGTVAYVTTGGPIPDGADAVVQVE+TE + D   E
Sbjct  72   SDGPGEYPVITESRAGNDGLGVTITPGTVAYVTTGGPIPDGADAVVQVEDTEKVEDGLVE  131

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
            SK+VRIL     GVDIRPVG DI K  VVLKSGE LGA EIGLLATVGV +V+VYPTPT+
Sbjct  132  SKRVRILVKASKGVDIRPVGCDIEKDAVVLKSGERLGASEIGLLATVGVVMVKVYPTPTV  191

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            AVLSTGDELVEP   CLSRGQI
Sbjct  192  AVLSTGDELVEPITTCLSRGQI  213



>gb|EYU35987.1| hypothetical protein MIMGU_mgv1a002507mg [Erythranthe guttata]
Length=665

 Score =   303 bits (775),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 177/207 (86%), Gaps = 2/207 (1%)
 Frame = +2

Query  41   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDG  220
            GEA  SKMVS  EALEI+L  AQRLPPV+VPLH ALG++LA+D+ APDPLPPYPASIKDG
Sbjct  2    GEA--SKMVSVEEALEILLKAAQRLPPVTVPLHVALGKILAQDVAAPDPLPPYPASIKDG  59

Query  221  YAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLL  400
            YAVV+SDGPG YP+ITESRAG+D + V VTPGT+AYVTTGGPIP+GADAVVQVE+T L+ 
Sbjct  60   YAVVASDGPGEYPVITESRAGDDAIDVTVTPGTIAYVTTGGPIPNGADAVVQVEDTLLVE  119

Query  401  DASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVY  580
             A    K+VR+LK    G+DIRPVGSDIAKGDVVLKSG+HLGA EIGLLATVG+T V+VY
Sbjct  120  SAVGGPKRVRVLKQVAKGLDIRPVGSDIAKGDVVLKSGDHLGAAEIGLLATVGITAVKVY  179

Query  581  PTPTIAVLSTGDELVEPEVGCLSRGQI  661
            PTP IAVLSTGDELVEP    L+RGQI
Sbjct  180  PTPKIAVLSTGDELVEPTNESLNRGQI  206



>ref|XP_006446683.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
 gb|ESR59923.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
Length=671

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 175/201 (87%), Gaps = 0/201 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            K++S+ EAL+ VLSVAQRLPPV+VPL++ALG+VLAEDI APDPLPPYPAS+KDGYAVV+S
Sbjct  15   KIISAEEALQKVLSVAQRLPPVTVPLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVAS  74

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+ITESRAGNDG+GV+VTPGTVAYVTTGGPIPDGADAVVQVE+TE +   + ES
Sbjct  75   DGPGEYPVITESRAGNDGIGVIVTPGTVAYVTTGGPIPDGADAVVQVEDTEEVNHTAAES  134

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            K+V+IL  T  GVDIRPVG DI K  ++LKSGE +GA EIGLLAT G+ +V+VY TPTIA
Sbjct  135  KRVKILVQTNKGVDIRPVGYDIEKDAIILKSGERIGASEIGLLATSGIMMVKVYRTPTIA  194

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDELVEP   CL RGQI
Sbjct  195  VLSTGDELVEPTTQCLDRGQI  215



>gb|KDP42916.1| hypothetical protein JCGZ_23858 [Jatropha curcas]
Length=674

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 176/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  23   LRMSENGEAPIS-----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDP  187
            +  +E    PI+      M+S+ EAL+ VL VAQ+L P++V LH ALG+VLAEDI APDP
Sbjct  1    MEHNEQSHRPINGGTKPTMISAVEALQTVLKVAQQLRPITVSLHDALGKVLAEDIRAPDP  60

Query  188  LPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADA  367
            LPPY AS+KDGYAVV+SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADA
Sbjct  61   LPPYRASVKDGYAVVASDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADA  120

Query  368  VVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLL  547
            VVQVE+TE + D   ESK+VRIL  T  GVDIRPVG DI K  VVLK GE LGA EIGLL
Sbjct  121  VVQVEDTEKVEDGLAESKRVRILVKTRKGVDIRPVGCDIEKDAVVLKCGERLGASEIGLL  180

Query  548  ATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            ATVGV +V+VYPTPTIAVLSTGDELVEP   CLSRGQI
Sbjct  181  ATVGVLMVKVYPTPTIAVLSTGDELVEPTTFCLSRGQI  218



>gb|KJB55513.1| hypothetical protein B456_009G080100 [Gossypium raimondii]
Length=657

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 175/200 (88%), Gaps = 1/200 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+  +EAL+IVLSVAQ+LPPV+VPLHQALG+VLA+DI APDPLPPYPASIKDGYAV++SD
Sbjct  1    MIPVDEALQIVLSVAQKLPPVTVPLHQALGKVLAQDIVAPDPLPPYPASIKDGYAVIASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I ESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+TE  + A +E+K
Sbjct  61   GPGEYPVIVESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTE-QVKAPSETK  119

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
             V+IL  T  GVDIR VG DI K  VVLKSGE LGA E+GLLATVGVT+V+V PTPTIAV
Sbjct  120  HVKILVQTSKGVDIRQVGCDIQKDAVVLKSGERLGASEVGLLATVGVTMVKVQPTPTIAV  179

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP +G LSRG+I
Sbjct  180  LSTGDELVEPTIGSLSRGKI  199



>ref|XP_006470155.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Citrus 
sinensis]
Length=671

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            KM+S+ EAL+ VLSVAQRLPPV+VPL++ALG+VLAEDI APDPLPPYPAS+KDGYAVV+S
Sbjct  15   KMISAEEALQKVLSVAQRLPPVTVPLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVAS  74

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+ITESRAGNDG+GV+VT GTVAYVTTGGPIPDGADAVVQVE+T+ +   + ES
Sbjct  75   DGPGEYPVITESRAGNDGIGVIVTSGTVAYVTTGGPIPDGADAVVQVEDTDEVNHTAAES  134

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            K+V+IL  T  GVDIRPVG DI K  ++LKSGE +GA EIGLLAT G+ +V+VY TPTIA
Sbjct  135  KRVKILVQTNKGVDIRPVGYDIEKDAIILKSGERIGASEIGLLATAGIMMVKVYCTPTIA  194

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDELVEP   CL RGQI
Sbjct  195  VLSTGDELVEPSTQCLDRGQI  215



>gb|KHG12135.1| Molybdopterin biosynthesis CNX1 -like protein [Gossypium arboreum]
Length=657

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 174/200 (87%), Gaps = 1/200 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+  +EAL+IVLSVAQ+LPP +VPLHQALG+VLA+DI APDPLPPYPASIKDGYAV++SD
Sbjct  1    MIPVDEALQIVLSVAQKLPPATVPLHQALGKVLAQDIVAPDPLPPYPASIKDGYAVIASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I ESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+TE  + AS+E+K
Sbjct  61   GPGEYPVIVESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTE-QVKASSEAK  119

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
             V+IL  T  GVDIR VG DI K  VVL SGE +GA E+GLLATVGVT+V+V PTPTIAV
Sbjct  120  HVKILVQTSKGVDIRQVGCDIQKEAVVLNSGERIGASEVGLLATVGVTMVKVQPTPTIAV  179

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP VG LSRG+I
Sbjct  180  LSTGDELVEPTVGSLSRGKI  199



>ref|XP_008231326.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Prunus mume]
Length=640

 Score =   296 bits (759),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            ++VS  EALE VL V QRLPPV+VPLH ALG+VLAEDI A DPLPPYPASIKDGYAVV+S
Sbjct  18   EVVSVEEALETVLRVVQRLPPVTVPLHDALGKVLAEDIRARDPLPPYPASIKDGYAVVAS  77

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+I E+RAG+DGLG+ VTPGTVAYV TGG IPDGADAVVQVE+TE +   S ES
Sbjct  78   DGPGEYPVIAEARAGDDGLGIAVTPGTVAYVATGGQIPDGADAVVQVEDTEQIEGLSLES  137

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            ++VRIL  T  GVDIRPVG DI K D+VL SG+ +GA EIGLLATVG T+V+VYPTPTI 
Sbjct  138  RKVRILAQTSKGVDIRPVGCDIEKDDIVLISGQRIGASEIGLLATVGATVVKVYPTPTIG  197

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDELVEP  GCLSRGQI
Sbjct  198  VLSTGDELVEPTTGCLSRGQI  218



>ref|XP_009350884.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like, partial 
[Pyrus x bretschneideri]
Length=588

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 173/213 (81%), Gaps = 2/213 (1%)
 Frame = +2

Query  29   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  202
            M E      SK  ++S  +ALE VL V QRLPPV+VPLH A G+VLAEDI A +PLPPYP
Sbjct  1    MGETAREDSSKGTVISVEDALETVLRVVQRLPPVTVPLHDAAGKVLAEDIRAREPLPPYP  60

Query  203  ASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVE  382
            AS+KDGYAVV+SDGPG YP+I ESRAGNDGLG+ +TPGTVAYVTTGGPIPDGADAVVQVE
Sbjct  61   ASVKDGYAVVASDGPGEYPVIAESRAGNDGLGITITPGTVAYVTTGGPIPDGADAVVQVE  120

Query  383  NTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGV  562
            +TE + + S +S+QVRIL  T  GVDIRPVG DI    VVL SG+ +GA EIGLLATVGV
Sbjct  121  DTEEIEEHSLDSRQVRILIQTSKGVDIRPVGCDIEADAVVLTSGQRIGASEIGLLATVGV  180

Query  563  TIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            T+V+VYPTPTI VLSTGDELVEP  GCL+RGQI
Sbjct  181  TMVKVYPTPTIGVLSTGDELVEPMTGCLNRGQI  213



>ref|XP_008349828.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Malus 
domestica]
Length=507

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            ++S  +ALE VL V QRLPPV+VPLH A G+VLAEDI A +PLPPYPAS+KDGYAVV+SD
Sbjct  14   VISXEDALETVLRVVQRLPPVTVPLHDAAGKVLAEDIRAREPLPPYPASVKDGYAVVASD  73

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I ESRAGNDGLG+ VTPGTVAYVTTGGPIPDGADAVVQVE+TE + + S +S 
Sbjct  74   GPGEYPVIAESRAGNDGLGITVTPGTVAYVTTGGPIPDGADAVVQVEDTEEIEEHSLDSG  133

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            QVRIL  T  GVDIRPVG DI    VVL SG+ +GA EIGLLATVGVT+V+VYPTPTI V
Sbjct  134  QVRILIQTSKGVDIRPVGCDIEADAVVLTSGQRIGASEIGLLATVGVTMVKVYPTPTIGV  193

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  GCL+RGQI
Sbjct  194  LSTGDELVEPMTGCLNRGQI  213



>ref|XP_007204973.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
 gb|EMJ06172.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
Length=674

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            ++VS  EALE VL V QRLPPV+VPLH ALG+VLAEDI A DPLPPYPAS+KDGYAVV+S
Sbjct  18   EVVSVEEALETVLRVVQRLPPVTVPLHDALGKVLAEDIRARDPLPPYPASVKDGYAVVAS  77

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+I E+RAG+DGLG+ VTPGTVAYV+TGG IPDGADAVVQVE+TE +   S ES
Sbjct  78   DGPGEYPVIAEARAGDDGLGITVTPGTVAYVSTGGQIPDGADAVVQVEDTEQIEGLSLES  137

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            ++VRIL  T  GVDIRPVG DI K D+VL SG+ +GA EIGLLATVG T+V+VYP PTI 
Sbjct  138  RKVRILAQTSKGVDIRPVGCDIEKDDIVLISGQRIGASEIGLLATVGATVVKVYPAPTIG  197

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDELVEP  GCLSRGQI
Sbjct  198  VLSTGDELVEPTTGCLSRGQI  218



>gb|EPS66354.1| hypothetical protein M569_08423, partial [Genlisea aurea]
Length=471

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S +EALE+VL VAQRLPPV+VPL QAL +VLA+D++A +PLPPYPAS+KDGYAVV+SD
Sbjct  1    MISVDEALEVVLRVAQRLPPVTVPLDQALCKVLAQDVSADEPLPPYPASVKDGYAVVASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG Y +ITESRAGNDG+ V +TPGTVAYVTTGGPIP GADAVVQVE+T    +A++ +K
Sbjct  61   GPGEYSVITESRAGNDGIDVTITPGTVAYVTTGGPIPHGADAVVQVEDTAPSENATSGTK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            QVR+LK    G+DIRPVG DI KGDVVLK+GEH+GA E+GLLATVGVT V+VYPTP I V
Sbjct  121  QVRVLKQVARGLDIRPVGCDIGKGDVVLKTGEHVGAAEVGLLATVGVTNVKVYPTPRIGV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP+   L+RGQI
Sbjct  181  LSTGDELVEPDTKYLNRGQI  200



>ref|XP_010926611.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Elaeis guineensis]
Length=652

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S+ EAL IVLSVA+RLPPV+VPLH+ALG VLAED+ APDPLPPY ASIKDGYAVV+SD
Sbjct  14   MISAEEALRIVLSVAERLPPVTVPLHEALGLVLAEDVCAPDPLPPYRASIKDGYAVVASD  73

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGAD+VVQVE+TE + DA + SK
Sbjct  74   GPGEYPVITESRAGNDGIGVRVTPGTVAYVTTGGPIPDGADSVVQVEDTEKVTDALDGSK  133

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +V+IL    PG DIR VG D+ K   VLKS E +G+PEIGLLATVGVT+V+VYP PT+AV
Sbjct  134  RVKILVQVLPGHDIRNVGFDMEKNATVLKSEEQIGSPEIGLLATVGVTMVKVYPRPTVAV  193

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDEL+EP    LSRGQI
Sbjct  194  LSTGDELIEPATKTLSRGQI  213



>ref|XP_010926610.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Elaeis guineensis]
Length=671

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S+ EAL IVLSVA+RLPPV+VPLH+ALG VLAED+ APDPLPPY ASIKDGYAVV+SD
Sbjct  14   MISAEEALRIVLSVAERLPPVTVPLHEALGLVLAEDVCAPDPLPPYRASIKDGYAVVASD  73

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGAD+VVQVE+TE + DA + SK
Sbjct  74   GPGEYPVITESRAGNDGIGVRVTPGTVAYVTTGGPIPDGADSVVQVEDTEKVTDALDGSK  133

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +V+IL    PG DIR VG D+ K   VLKS E +G+PEIGLLATVGVT+V+VYP PT+AV
Sbjct  134  RVKILVQVLPGHDIRNVGFDMEKNATVLKSEEQIGSPEIGLLATVGVTMVKVYPRPTVAV  193

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDEL+EP    LSRGQI
Sbjct  194  LSTGDELIEPATKTLSRGQI  213



>emb|CBI24388.3| unnamed protein product [Vitis vinifera]
Length=652

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S  +AL+IV +V+Q+L PV VP+H+ALG+VLA+DI APDPLPP+PAS+KDGYAVV+SD
Sbjct  1    MISVEDALQIVKTVSQQLSPVIVPIHEALGKVLAQDIHAPDPLPPFPASVKDGYAVVASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YPIITESRAGNDG+GV+VTPGTVAYVTTGGPIPDGADAVVQVE++EL+ D   +SK
Sbjct  61   GPGEYPIITESRAGNDGVGVIVTPGTVAYVTTGGPIPDGADAVVQVEDSELIKDPLGDSK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  GVDIRPVG DI K   VLKSGE +GA EIGLLATVGV +V+VYPTPTIAV
Sbjct  121  RVRILTQTCKGVDIRPVGCDIQKDARVLKSGELVGASEIGLLATVGVMMVKVYPTPTIAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP    L+RGQI
Sbjct  181  LSTGDELVEPTTEHLNRGQI  200



>ref|XP_011043834.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Populus euphratica]
Length=653

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S+ EAL+ +L VAQRLPPVSVPLH ALG+VLAEDI APDPLPPYPAS+KDGYAV++SD
Sbjct  1    MISAEEALQTILKVAQRLPPVSVPLHDALGKVLAEDIRAPDPLPPYPASVKDGYAVIASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDGLGV +TPGTVAYVTTGGPIPDGADAVVQVE+T  + D   E  
Sbjct  61   GPGEYPVITESRAGNDGLGVTLTPGTVAYVTTGGPIPDGADAVVQVEDTRKVKDPLVE--  118

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +V+IL  T  GVDIRPVG DI K  VVLK GE LG  EIGLLATVGV +V+VYP PTIAV
Sbjct  119  RVKILVKTRKGVDIRPVGCDIEKDVVVLKCGERLGVSEIGLLATVGVMMVKVYPMPTIAV  178

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G L+RGQI
Sbjct  179  LSTGDELVEPTTGVLNRGQI  198



>ref|XP_002276536.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
 ref|XP_010651618.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
Length=658

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 176/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  29   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPAS  208
            M E G      M+S  +AL+IV +V+Q+L PV VP+H+ALG+VLA+DI APDPLPP+PAS
Sbjct  1    MCEKG-----AMISVEDALQIVKTVSQQLSPVIVPIHEALGKVLAQDIHAPDPLPPFPAS  55

Query  209  IKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENT  388
            +KDGYAVV+SDGPG YPIITESRAGNDG+GV+VTPGTVAYVTTGGPIPDGADAVVQVE++
Sbjct  56   VKDGYAVVASDGPGEYPIITESRAGNDGVGVIVTPGTVAYVTTGGPIPDGADAVVQVEDS  115

Query  389  ELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTI  568
            EL+ D   +SK+VRIL  T  GVDIRPVG DI K   VLKSGE +GA EIGLLATVGV +
Sbjct  116  ELIKDPLGDSKRVRILTQTCKGVDIRPVGCDIQKDARVLKSGELVGASEIGLLATVGVMM  175

Query  569  VQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            V+VYPTPTIAVLSTGDELVEP    L+RGQI
Sbjct  176  VKVYPTPTIAVLSTGDELVEPTTEHLNRGQI  206



>ref|XP_009131833.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Brassica 
rapa]
Length=672

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IVLSV++RLPPV V L +ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   TEMIPTEEALRIVLSVSERLPPVVVSLQEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+TE++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEVIGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
             ++V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  134  PRRVKILIQTKKGTDIRRVGCDIEKDATVLKTGERIGASEIGLLATAGVTLVKVYPMPTV  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            AVLSTGDELVEP  G L RGQI
Sbjct  194  AVLSTGDELVEPTAGTLGRGQI  215



>ref|XP_010420950.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Camelina 
sativa]
Length=670

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IVL V++RLPPVSV L +ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   TEMIPTEEALRIVLGVSKRLPPVSVSLLEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV+VTPGTVAYVTTGGPIPDGADAVVQVE+TE++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVIVTPGTVAYVTTGGPIPDGADAVVQVEDTEVIGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
             ++V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  134  VRRVKILIQTKKGTDIRRVGCDIEKDTTVLKTGERIGASEIGLLATAGVTMVKVYPMPTV  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            A+LSTGDELVEP  G L RGQI
Sbjct  194  AILSTGDELVEPSAGTLGRGQI  215



>gb|KCW50986.1| hypothetical protein EUGRSUZ_J00614 [Eucalyptus grandis]
Length=502

 Score =   287 bits (735),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = +2

Query  29   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  202
            M+EN     +K  ++   EAL IVL  A+RLPPV+VPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MAENAGTAAAKPALIPPEEALRIVLGAARRLPPVAVPLHDALGKVLAEDIRAPDPLPPYP  60

Query  203  ASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVE  382
            AS+KDGYAVV+SDGPG YP+ITESRAGNDG+GV+VTPGTVAYVTTGGPIPDGADAVVQVE
Sbjct  61   ASVKDGYAVVASDGPGEYPVITESRAGNDGVGVIVTPGTVAYVTTGGPIPDGADAVVQVE  120

Query  383  NTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGV  562
            +TEL+  +  + K+V+IL  T  GVDIRPVG DI +  +VL +GE +G  E+GLLATVGV
Sbjct  121  DTELVKGSLTDQKRVKILVQTSKGVDIRPVGYDIERDSMVLTAGERIGPSEVGLLATVGV  180

Query  563  TIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            T V+VYP PT+AVLSTGDELV+    CL+RGQI
Sbjct  181  TNVKVYPYPTVAVLSTGDELVDSSTKCLNRGQI  213



>ref|XP_006400671.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
 gb|ESQ42124.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
Length=669

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            S+M+ + EAL IVLSV++RLPPV V L +ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   SEMIPTEEALRIVLSVSERLPPVVVSLQEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+T+ + D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTKAIGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
            SK+V+IL  T  G DIR VG DI K   VLK GE +GA EIGLLAT GVT V+VYP PTI
Sbjct  134  SKRVKILIQTKKGTDIRRVGCDIEKDATVLKIGERIGASEIGLLATAGVTSVKVYPMPTI  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            AVLSTGDELVEP  G L RGQI
Sbjct  194  AVLSTGDELVEPTAGTLGRGQI  215



>gb|KHN38452.1| Molybdopterin biosynthesis protein CNX1 [Glycine soja]
Length=652

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S  +AL+ VL+ ++RLPP++VPLH ALG+VLA+D+ APDPLPPYPAS+KDGYAVVS+D
Sbjct  1    MISVIDALQTVLNASKRLPPLTVPLHDALGKVLAQDVRAPDPLPPYPASVKDGYAVVSAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP++ ESRAG+D LG+ ++PGTVAYVTTGGPIPDGADAVVQVENTE++ DAS+ +K
Sbjct  61   GPGEYPVVAESRAGDDALGLTLSPGTVAYVTTGGPIPDGADAVVQVENTEIVNDASDGTK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIRPVG DI K  VVL SGE LGA EIGLLATVGVT+V+VYPTPT+AV
Sbjct  121  RVRILLQTTKGNDIRPVGVDIEKDAVVLTSGERLGASEIGLLATVGVTMVKVYPTPTVAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G L+RGQI
Sbjct  181  LSTGDELVEPTTGHLNRGQI  200



>ref|NP_001242529.1| molybdopterin biosynthesis protein CNX1-like [Glycine max]
 gb|AEO14873.1| rfls1 protein [Glycine max]
Length=652

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S  +AL+ VL+ ++RLPP++VPLH ALG+VLA+D+ APDPLPPYPAS+KDGYAVVS+D
Sbjct  1    MISVIDALQTVLNASKRLPPLTVPLHDALGKVLAQDVRAPDPLPPYPASVKDGYAVVSAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP++ ESRAG+D LG+ ++PGTVAYVTTGGPIPDGADAVVQVENTE++ DAS+ +K
Sbjct  61   GPGEYPVVAESRAGDDALGLTLSPGTVAYVTTGGPIPDGADAVVQVENTEIVNDASDGTK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIRPVG DI K  VVL SGE LGA EIGLLATVGVT+V+VYPTPT+AV
Sbjct  121  RVRILLQTTKGNDIRPVGVDIEKDAVVLTSGERLGASEIGLLATVGVTMVKVYPTPTVAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G L+RGQI
Sbjct  181  LSTGDELVEPTTGHLNRGQI  200



>ref|XP_002874027.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50286.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IVL V++RLPPV V L++ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  15   TEMIPTEEALRIVLGVSKRLPPVIVSLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  74

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+T+++ D S E
Sbjct  75   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTKVIGDVSTE  134

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
            SK+V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  135  SKRVKILIQTKKGTDIRRVGCDIEKDATVLKTGERIGASEIGLLATAGVTMVKVYPMPTV  194

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            A+LSTGDELVEP  G L RGQI
Sbjct  195  AILSTGDELVEPTAGTLGRGQI  216



>ref|XP_010031621.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Eucalyptus grandis]
Length=610

 Score =   288 bits (737),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = +2

Query  29   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  202
            M+EN     +K  ++   EAL IVL  A+RLPPV+VPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MAENAGTAAAKPALIPPEEALRIVLGAARRLPPVAVPLHDALGKVLAEDIRAPDPLPPYP  60

Query  203  ASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVE  382
            AS+KDGYAVV+SDGPG YP+ITESRAGNDG+GV+VTPGTVAYVTTGGPIPDGADAVVQVE
Sbjct  61   ASVKDGYAVVASDGPGEYPVITESRAGNDGVGVIVTPGTVAYVTTGGPIPDGADAVVQVE  120

Query  383  NTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGV  562
            +TEL+  +  + K+V+IL  T  GVDIRPVG DI +  +VL +GE +G  E+GLLATVGV
Sbjct  121  DTELVKGSLTDQKRVKILVQTSKGVDIRPVGYDIERDSMVLTAGERIGPSEVGLLATVGV  180

Query  563  TIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            T V+VYP PT+AVLSTGDELV+    CL+RGQI
Sbjct  181  TNVKVYPYPTVAVLSTGDELVDSSTKCLNRGQI  213



>emb|CDX88829.1| BnaA03g08200D [Brassica napus]
Length=670

 Score =   290 bits (741),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            S+M+ + EAL+IVLSV++RL PV V L +ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   SEMIPTEEALKIVLSVSERLAPVVVSLQEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGP+PDGADAVVQVE+TE++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPVPDGADAVVQVEDTEVVGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
             ++V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  134  PRRVKILIQTKKGTDIRRVGCDIEKDATVLKTGERIGASEIGLLATAGVTLVKVYPMPTV  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            AVLSTGDELVEP  G L RGQI
Sbjct  194  AVLSTGDELVEPTAGTLGRGQI  215



>ref|XP_011090256.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Sesamum indicum]
Length=660

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 173/207 (84%), Gaps = 4/207 (2%)
 Frame = +2

Query  41   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDG  220
            GEA  SKMVS +EAL+ VL VAQRLPPV+VP+HQALG+VLA+D+ APDPLPPYPASIKDG
Sbjct  2    GEA--SKMVSVDEALQTVLRVAQRLPPVTVPIHQALGKVLAQDVAAPDPLPPYPASIKDG  59

Query  221  YAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLL  400
            YAVV+SDGPG YP+ITE+RAG+DG+ V VTPGT+AYVTTGGPIPDGADAVVQVE+T  + 
Sbjct  60   YAVVASDGPGEYPVITEARAGDDGIDVKVTPGTIAYVTTGGPIPDGADAVVQVEDT--IP  117

Query  401  DASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVY  580
              S + K+VRILK    G+DIRPVG DIAK DV+LK GE LGA EIGLLAT G+  V+VY
Sbjct  118  VGSADPKRVRILKQVAQGLDIRPVGCDIAKDDVILKLGERLGAAEIGLLATAGIVAVKVY  177

Query  581  PTPTIAVLSTGDELVEPEVGCLSRGQI  661
            PTP IAVLSTGDELVEP    L RGQI
Sbjct  178  PTPKIAVLSTGDELVEPTNESLKRGQI  204



>ref|XP_006286370.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
 gb|EOA19268.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
Length=684

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IVL V+ RLPPV V L +ALG+VLAEDI APDPLPPYPASIKDGYAVV+
Sbjct  29   TEMIPTEEALRIVLGVSHRLPPVMVSLQEALGKVLAEDIRAPDPLPPYPASIKDGYAVVA  88

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+T+++ D S E
Sbjct  89   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTKVIEDVSTE  148

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
             K+V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  149  VKRVKILIQTKKGTDIRRVGCDIEKDTTVLKTGERIGASEIGLLATAGVTMVKVYPMPTV  208

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            A+LSTGDELV+P  G L RGQI
Sbjct  209  AILSTGDELVDPSAGTLGRGQI  230



>ref|XP_002312858.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|EEE86813.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=653

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 167/200 (84%), Gaps = 2/200 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S+ EAL+ +L VAQRL PVSVPLH ALG+VLAEDI APDPLPPYPAS+KDGYAV++SD
Sbjct  1    MISAEEALQTILKVAQRLLPVSVPLHDALGKVLAEDIRAPDPLPPYPASVKDGYAVIASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDGLGV +TPGTVAYVTTGGPIPDGADAVVQVE+T  + D   E  
Sbjct  61   GPGEYPVITESRAGNDGLGVTLTPGTVAYVTTGGPIPDGADAVVQVEDTRKVKDPLVE--  118

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +V+I+  T  GVDIRPVG DI K  VVLK GE LG  EIGLLATVGV +V+VYP PTIAV
Sbjct  119  RVKIMVQTRKGVDIRPVGCDIEKDVVVLKCGERLGVSEIGLLATVGVMMVKVYPMPTIAV  178

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G L+RGQI
Sbjct  179  LSTGDELVEPTTGVLNRGQI  198



>ref|XP_008787719.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Phoenix dactylifera]
Length=671

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S+ EAL IVLSVA+RLP V+VPLH+A G VLAED+ APDPLPPY ASIKDGYAVV+SD
Sbjct  14   MISAEEALRIVLSVAERLPAVTVPLHEAFGLVLAEDVRAPDPLPPYRASIKDGYAVVASD  73

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGAD+VVQVE+TE + D+++ SK
Sbjct  74   GPGEYPVITESRAGNDGIGVTVTPGTVAYVTTGGPIPDGADSVVQVEDTEKVTDSADGSK  133

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +V+IL     G DIR VG DI K   VLK GE +G+PEIGLLATVGVT+V+VYP PT+AV
Sbjct  134  RVKILVKVPTGHDIRNVGFDIEKNATVLKLGEQIGSPEIGLLATVGVTMVKVYPRPTVAV  193

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDEL+EP    LSRGQI
Sbjct  194  LSTGDELIEPATQTLSRGQI  213



>ref|XP_010031620.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Eucalyptus grandis]
 gb|KCW50985.1| hypothetical protein EUGRSUZ_J00614 [Eucalyptus grandis]
Length=669

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = +2

Query  29   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  202
            M+EN     +K  ++   EAL IVL  A+RLPPV+VPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MAENAGTAAAKPALIPPEEALRIVLGAARRLPPVAVPLHDALGKVLAEDIRAPDPLPPYP  60

Query  203  ASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVE  382
            AS+KDGYAVV+SDGPG YP+ITESRAGNDG+GV+VTPGTVAYVTTGGPIPDGADAVVQVE
Sbjct  61   ASVKDGYAVVASDGPGEYPVITESRAGNDGVGVIVTPGTVAYVTTGGPIPDGADAVVQVE  120

Query  383  NTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGV  562
            +TEL+  +  + K+V+IL  T  GVDIRPVG DI +  +VL +GE +G  E+GLLATVGV
Sbjct  121  DTELVKGSLTDQKRVKILVQTSKGVDIRPVGYDIERDSMVLTAGERIGPSEVGLLATVGV  180

Query  563  TIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            T V+VYP PT+AVLSTGDELV+    CL+RGQI
Sbjct  181  TNVKVYPYPTVAVLSTGDELVDSSTKCLNRGQI  213



>emb|CDX70956.1| BnaC03g10400D [Brassica napus]
Length=672

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            S+M+ + EAL IVLSV++RLPPV V L +ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   SEMIPTEEALRIVLSVSERLPPVVVSLQEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+T ++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTVVIGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
             ++V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  134  PRRVKILIQTKKGTDIRRVGCDIEKDATVLKTGERIGASEIGLLATAGVTLVKVYPMPTV  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            AVLSTGDELVEP    L RGQI
Sbjct  194  AVLSTGDELVEPRAETLGRGQI  215



>ref|NP_197599.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
 sp|Q39054.2|CNX1_ARATH RecName: Full=Molybdopterin biosynthesis protein CNX1; AltName: 
Full=Molybdenum cofactor biosynthesis enzyme CNX1; Includes: 
RecName: Full=Molybdopterin molybdenumtransferase; Short=MPT 
Mo-transferase; AltName: Full=Domain E; Includes: RecName: 
Full=Molybdopterin adenylyltransferase; Short=MPT adenylyltransferase; 
AltName: Full=Domain G [Arabidopsis thaliana]
 gb|AED92917.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
Length=670

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IV  V++RLPPV V L++ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   TEMIPTEEALRIVFGVSKRLPPVIVSLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+T+++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTKVIGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
            SK+V+IL  T  G DIR VG DI K   VL +GE +GA EIGLLAT GVT+V+VYP P +
Sbjct  134  SKRVKILIQTKKGTDIRRVGCDIEKDATVLTTGERIGASEIGLLATAGVTMVKVYPMPIV  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            A+LSTGDELVEP  G L RGQI
Sbjct  194  AILSTGDELVEPTAGTLGRGQI  215



>gb|KEH28337.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=475

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S   ALE VL+ A+RLPP+SV LH+ALG+VLA+++ A DPLPPYPAS+KDGYAVV++D
Sbjct  1    MISVTHALETVLNAAKRLPPISVSLHEALGKVLAQNVHAVDPLPPYPASVKDGYAVVAAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I ESRAG+D +GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE +  AS+E  
Sbjct  61   GPGEYPVIAESRAGDDAVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEKVNSASDEID  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIRPVG DI K  VVL SGE LGA EIGLLA VG T V+VYPTPTIAV
Sbjct  121  RVRILVKTNQGNDIRPVGVDIEKDAVVLTSGEILGASEIGLLAAVGATTVKVYPTPTIAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G LSRGQI
Sbjct  181  LSTGDELVEPSTGHLSRGQI  200



>ref|XP_007141599.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13593.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=650

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S   A++ +L+V++RLPP++VPLH ALG+VLA+D+ APDPLPPY AS+KDGYAV+++D
Sbjct  1    MISVTHAIQTILNVSKRLPPLTVPLHDALGKVLAQDVRAPDPLPPYAASVKDGYAVIAAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP++ ESRAG+D LGV ++PGTVAYVTTGGPIP+GADAVVQVENTE++ DAS+ +K
Sbjct  61   GPGEYPVVAESRAGDDALGVTLSPGTVAYVTTGGPIPEGADAVVQVENTEVVNDASDGTK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIRPVG DI K  +VL SGE LGA EIGLLATVGVT+V+VYP PT+AV
Sbjct  121  RVRILVQTTKGNDIRPVGLDIEKDAMVLTSGERLGASEIGLLATVGVTMVKVYPAPTVAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G LSRGQI
Sbjct  181  LSTGDELVEPSTGHLSRGQI  200



>ref|XP_010093278.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
 gb|EXB53803.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
Length=674

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            MVS +EAL +VL+VAQ LPPV+VPLH ALG VLAED+ APDPLPPYPASIKDGYAVV+ D
Sbjct  19   MVSVDEALRMVLAVAQGLPPVTVPLHNALGMVLAEDVRAPDPLPPYPASIKDGYAVVAED  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP++ E+RAGND LGV VTPGTVAYVTTGGPIPDGADAVVQVE+TE +  +S ESK
Sbjct  79   GPGEYPVVAEARAGNDALGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEKIEGSSLESK  138

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
             +RIL  T  G DIRPVG DI K  VVL+SGE +GA EIGLLATVGV +V+VY TPT+ V
Sbjct  139  CIRILVRTSKGTDIRPVGCDIEKHAVVLRSGETVGASEIGLLATVGVMMVKVYRTPTVTV  198

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP    L+RGQI
Sbjct  199  LSTGDELVEPTTEILNRGQI  218



>ref|XP_010454418.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=666

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IVL V +RL PVSV L +ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   TEMIPTEEALRIVLGVTKRLSPVSVSLPEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+T+++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTKVIGDVSAE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
             ++V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  134  VRRVKILIQTTKGTDIRRVGCDIEKDTTVLKTGERIGASEIGLLATAGVTMVKVYPMPTV  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            A+LSTGDELVEP  G L RGQI
Sbjct  194  AILSTGDELVEPSSGTLGRGQI  215



>gb|KFK26315.1| hypothetical protein AALP_AA8G231600 [Arabis alpina]
Length=670

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  53   ISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVV  232
            +++M+ + EAL IVL  ++RL PV V LH+ALG+VLAEDI APDPLPPYPAS KDGYAVV
Sbjct  14   MTEMIPTEEALRIVLGASERLSPVVVSLHEALGKVLAEDIRAPDPLPPYPASSKDGYAVV  73

Query  233  SSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN  412
            +SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE T+++ D S 
Sbjct  74   ASDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEYTQVIGDIST  133

Query  413  ESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPT  592
            ESK+V IL  T  G DIR VG DI K   VLK+G  +GA EIGLLAT GVT+V+VYP PT
Sbjct  134  ESKRVNILIQTKKGTDIRRVGCDIEKDATVLKTGVRIGASEIGLLATAGVTLVKVYPMPT  193

Query  593  IAVLSTGDELVEPEVGCLSRGQI  661
            +A+LSTGDELVEP VG L RGQI
Sbjct  194  VAILSTGDELVEPTVGTLGRGQI  216



>ref|XP_007141600.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13594.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=669

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S   A++ +L+V++RLPP++VPLH ALG+VLA+D+ APDPLPPY AS+KDGYAV+++D
Sbjct  1    MISVTHAIQTILNVSKRLPPLTVPLHDALGKVLAQDVRAPDPLPPYAASVKDGYAVIAAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP++ ESRAG+D LGV ++PGTVAYVTTGGPIP+GADAVVQVENTE++ DAS+ +K
Sbjct  61   GPGEYPVVAESRAGDDALGVTLSPGTVAYVTTGGPIPEGADAVVQVENTEVVNDASDGTK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIRPVG DI K  +VL SGE LGA EIGLLATVGVT+V+VYP PT+AV
Sbjct  121  RVRILVQTTKGNDIRPVGLDIEKDAMVLTSGERLGASEIGLLATVGVTMVKVYPAPTVAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G LSRGQI
Sbjct  181  LSTGDELVEPSTGHLSRGQI  200



>ref|XP_004291534.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Fragaria 
vesca subsp. vesca]
Length=666

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 173/211 (82%), Gaps = 2/211 (1%)
 Frame = +2

Query  29   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPAS  208
            M++    PI  ++S+ EAL+IVL V Q+LP V+VPLH ALG+VLAEDI A +P P +PAS
Sbjct  1    MTDGSTKPI--LLSAEEALQIVLKVVQKLPHVTVPLHDALGKVLAEDIRAGEPFPAFPAS  58

Query  209  IKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENT  388
            IKDGYAVV+SDGPG YP++ E+RAG+DG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+T
Sbjct  59   IKDGYAVVASDGPGEYPVVAEARAGSDGIGVAVTPGTVAYVTTGGPIPDGADAVVQVEDT  118

Query  389  ELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTI  568
            E +   S+ESK+VR+L  T  GVDIRPVG DI K DVVL SG+ +GA E+GLLATVG T+
Sbjct  119  EQVHVNSHESKRVRVLVQTRKGVDIRPVGCDIEKDDVVLTSGQRIGASEVGLLATVGRTM  178

Query  569  VQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            V+VYPTP I VLSTGDELVEP  G LSRGQI
Sbjct  179  VKVYPTPKIGVLSTGDELVEPTTGGLSRGQI  209



>gb|KEH28338.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=582

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S   ALE VL+ A+RLPP+SV LH+ALG+VLA+++ A DPLPPYPAS+KDGYAVV++D
Sbjct  1    MISVTHALETVLNAAKRLPPISVSLHEALGKVLAQNVHAVDPLPPYPASVKDGYAVVAAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I ESRAG+D +GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE +  AS+E  
Sbjct  61   GPGEYPVIAESRAGDDAVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEKVNSASDEID  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIRPVG DI K  VVL SGE LGA EIGLLA VG T V+VYPTPTIAV
Sbjct  121  RVRILVKTNQGNDIRPVGVDIEKDAVVLTSGEILGASEIGLLAAVGATTVKVYPTPTIAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G LSRGQI
Sbjct  181  LSTGDELVEPSTGHLSRGQI  200



>ref|XP_010493217.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=671

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IVL V++RLPPVSV L +ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   TEMIPTEEALRIVLGVSKRLPPVSVSLLEALGKVLAEDICAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV+VTPGTVAYVTTGGPIPDGAD VVQVE+TE++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVIVTPGTVAYVTTGGPIPDGADTVVQVEDTEVIGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
             ++V+IL  T  G DIR VG DI K   VLK+GE +GA EIGLLAT GVT+V+VYP PT+
Sbjct  134  VRRVKILIQTTKGTDIRRVGCDIEKDTTVLKTGERIGASEIGLLATAGVTMVKVYPMPTV  193

Query  596  AVLSTGDELVEPEVGCL  646
            A+LSTGDELVEP  G +
Sbjct  194  AILSTGDELVEPSAGTI  210



>ref|XP_010240846.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nelumbo nucifera]
Length=587

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            S M+S   AL IVLS+AQRL  V++PLH  LG+VLAEDI APDPLPPY AS+KDGYAVV+
Sbjct  21   STMLSMENALRIVLSIAQRLQTVTLPLHDTLGKVLAEDIRAPDPLPPYRASVKDGYAVVA  80

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YPIITESRAGNDG+GV VT G VAYVTTGGPIP+GA+AVVQVE+TEL+  A  E
Sbjct  81   SDGPGEYPIITESRAGNDGIGVTVTSGNVAYVTTGGPIPNGANAVVQVEDTELVEGALGE  140

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
            SK+V+IL     G+DIRPVG DI K  +VL+SGE +G  E+GLLAT+GV +V+V+P PT+
Sbjct  141  SKRVKILVQARQGLDIRPVGCDIEKDAIVLRSGERIGTSEVGLLATMGVMLVKVFPNPTV  200

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            AVLSTGDELVEP   CL RGQI
Sbjct  201  AVLSTGDELVEPTKECLGRGQI  222



>gb|AAA97413.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
 emb|CAB38312.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
Length=670

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  56   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVS  235
            ++M+ + EAL IV  V++RLPPV V L++ALG+VLAEDI APDPLPPYPAS+KDGYAVV+
Sbjct  14   TEMIPTEEALRIVFGVSKRLPPVIVSLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVA  73

Query  236  SDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNE  415
            SDGPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIP GADAVVQVE+T+++ D S E
Sbjct  74   SDGPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPVGADAVVQVEDTKVIGDVSTE  133

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
            +K+V+IL  T  G DIR VG DI K   VL +GE +GA EIGLLAT GVT+V+VYP P +
Sbjct  134  AKRVKILIQTKKGTDIRRVGCDIEKDATVLTTGERIGASEIGLLATAGVTMVKVYPMPIV  193

Query  596  AVLSTGDELVEPEVGCLSRGQI  661
            A+LSTGDELVEP  G L RGQI
Sbjct  194  AILSTGDELVEPTAGTLGRGQI  215



>ref|XP_003617060.1| Molybdopterin biosynthesis CNX1 protein [Medicago truncatula]
 gb|AET00019.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=653

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S   ALE VL+ A+RLPP+SV LH+ALG+VLA+++ A DPLPPYPAS+KDGYAVV++D
Sbjct  1    MISVTHALETVLNAAKRLPPISVSLHEALGKVLAQNVHAVDPLPPYPASVKDGYAVVAAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I ESRAG+D +GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE +  AS+E  
Sbjct  61   GPGEYPVIAESRAGDDAVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEKVNSASDEID  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIRPVG DI K  VVL SGE LGA EIGLLA VG T V+VYPTPTIAV
Sbjct  121  RVRILVKTNQGNDIRPVGVDIEKDAVVLTSGEILGASEIGLLAAVGATTVKVYPTPTIAV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G LSRGQI
Sbjct  181  LSTGDELVEPSTGHLSRGQI  200



>ref|XP_010685502.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Beta vulgaris 
subsp. vulgaris]
Length=649

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S +EAL+I+L VAQRL  V+VP+H+A G+ LA+DI APDPLPPYPASIKDGYAV+++D
Sbjct  1    MISVDEALKIILEVAQRLEEVTVPIHEAQGKTLAQDIHAPDPLPPYPASIKDGYAVIAAD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I+ESRAGND +GV VTPGTVAYVTTGGP+PDGADAVVQVE+TE +    +E K
Sbjct  61   GPGEYPVISESRAGNDAVGVTVTPGTVAYVTTGGPVPDGADAVVQVEDTEQIQSDPSEPK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T PG+DIRPVG DI K  VVLKSG  +GA EIGLLATVGVT+V+V+ TPTI V
Sbjct  121  RVRILVQTKPGLDIRPVGCDIEKDAVVLKSGHLVGASEIGLLATVGVTMVKVFRTPTIGV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP    L  GQI
Sbjct  181  LSTGDELVEPTTRSLGCGQI  200



>ref|XP_004159365.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1-like [Cucumis sativus]
Length=662

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 167/207 (81%), Gaps = 5/207 (2%)
 Frame = +2

Query  41   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDG  220
            G +  + M+SS+EAL+ VL VA+ LPP+ V LH A+G+VLA+DI A DPLPPYPASIKDG
Sbjct  6    GNSMSTAMISSDEALKTVLEVARCLPPIVVSLHDAMGKVLAQDIRASDPLPPYPASIKDG  65

Query  221  YAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLL  400
            YAVV+SDGPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE   
Sbjct  66   YAVVASDGPGEYPVITESRAGNDGVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTE---  122

Query  401  DASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVY  580
                ESK+V+I      G DIRPVG DI K  +VLK+G+ +G+ EIGLLATVGV  V+VY
Sbjct  123  --KXESKRVKIKVKARKGADIRPVGCDIEKDALVLKAGDKIGSSEIGLLATVGVMTVKVY  180

Query  581  PTPTIAVLSTGDELVEPEVGCLSRGQI  661
            PTP +AVLSTGDELVEP+  CL RGQI
Sbjct  181  PTPVVAVLSTGDELVEPQTECLGRGQI  207



>ref|XP_004144145.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Cucumis 
sativus]
Length=662

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 168/207 (81%), Gaps = 5/207 (2%)
 Frame = +2

Query  41   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDG  220
            G +  + M+SS+EAL+ VL VA+ LPP+ V LH A+G+VLA+DI A DPLPPYPASIKDG
Sbjct  6    GNSMSTAMISSDEALKTVLEVARCLPPIVVSLHDAMGKVLAQDIRASDPLPPYPASIKDG  65

Query  221  YAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLL  400
            YAVV+SDGPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+TE + 
Sbjct  66   YAVVASDGPGEYPVITESRAGNDGVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEKI-  124

Query  401  DASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVY  580
                ESK+V+I      G DIRPVG DI K  +VLK+G+ +G+ EIGLLATVGV  V+VY
Sbjct  125  ----ESKRVKIKVKARKGADIRPVGCDIEKDALVLKAGDKIGSSEIGLLATVGVMTVKVY  180

Query  581  PTPTIAVLSTGDELVEPEVGCLSRGQI  661
            PTP +AVLSTGDELVEP+  CL RGQI
Sbjct  181  PTPVVAVLSTGDELVEPQTECLGRGQI  207



>ref|XP_008451034.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Cucumis melo]
Length=661

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 168/211 (80%), Gaps = 5/211 (2%)
 Frame = +2

Query  29   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPAS  208
            M+++     + M+S +EAL+ VL VAQ LPP+ V LH A+G+VLA+DI A DPLPPYPAS
Sbjct  1    MADHSCVKSTAMISPDEALKTVLEVAQCLPPIVVSLHDAIGKVLAQDIRASDPLPPYPAS  60

Query  209  IKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENT  388
            IKDGYAVV+SDGPG YP+I ESRAGNDG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+T
Sbjct  61   IKDGYAVVASDGPGEYPVIIESRAGNDGVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDT  120

Query  389  ELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTI  568
            E +     ESK+V+I      G DIRPVG DI K  +VLK+G+ +G+ EIGLLATVGV  
Sbjct  121  EKI-----ESKRVKIKVKARKGADIRPVGCDIEKDALVLKAGDKIGSSEIGLLATVGVMT  175

Query  569  VQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            V+VYPTP +AVLSTGDELVEP+  CL RGQI
Sbjct  176  VKVYPTPVVAVLSTGDELVEPQTECLGRGQI  206



>ref|XP_011043840.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Populus euphratica]
Length=641

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 160/200 (80%), Gaps = 14/200 (7%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S+ EAL+ +L VAQRLPPVSVPLH ALG+VLAEDI APDPLPPYPAS+KDGYAV++SD
Sbjct  1    MISAEEALQTILKVAQRLPPVSVPLHDALGKVLAEDIRAPDPLPPYPASVKDGYAVIASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDGLGV +TPGTVAYVTTGGPIPDGADAVVQVE+T  + D   E  
Sbjct  61   GPGEYPVITESRAGNDGLGVTLTPGTVAYVTTGGPIPDGADAVVQVEDTRKVKDPLVE--  118

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +V+IL            G DI K  VVLK GE LG  EIGLLATVGV +V+VYP PTIAV
Sbjct  119  RVKIL------------GCDIEKDVVVLKCGERLGVSEIGLLATVGVMMVKVYPMPTIAV  166

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G L+RGQI
Sbjct  167  LSTGDELVEPTTGVLNRGQI  186



>ref|XP_006379351.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|ERP57148.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=641

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 159/200 (80%), Gaps = 14/200 (7%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S+ EAL+ +L VAQRL PVSVPLH ALG+VLAEDI APDPLPPYPAS+KDGYAV++SD
Sbjct  1    MISAEEALQTILKVAQRLLPVSVPLHDALGKVLAEDIRAPDPLPPYPASVKDGYAVIASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDGLGV +TPGTVAYVTTGGPIPDGADAVVQVE+T  + D   E  
Sbjct  61   GPGEYPVITESRAGNDGLGVTLTPGTVAYVTTGGPIPDGADAVVQVEDTRKVKDPLVE--  118

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +V+I+            G DI K  VVLK GE LG  EIGLLATVGV +V+VYP PTIAV
Sbjct  119  RVKIM------------GCDIEKDVVVLKCGERLGVSEIGLLATVGVMMVKVYPMPTIAV  166

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP  G L+RGQI
Sbjct  167  LSTGDELVEPTTGVLNRGQI  186



>ref|XP_009383824.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+  +EAL IVLSVA+RLPPV+VPLH+ALG +LAED+ A DPLPPY ASIKDGYAVV+SD
Sbjct  1    MIPVDEALRIVLSVAERLPPVAVPLHEALGLILAEDVRAADPLPPYRASIKDGYAVVASD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPGVYP+ITESRAG+DG+GVVVTPGTVAYVTTGGPIPDGAD+VVQVE+TE + D  +  K
Sbjct  61   GPGVYPVITESRAGDDGVGVVVTPGTVAYVTTGGPIPDGADSVVQVEDTEEVTDNVDGLK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL G   G DIR VG DI K  +VLK+GE LG+PEIGLLATVGV IV+VYP PT+ V
Sbjct  121  RVRILVGVPLGNDIRNVGCDIEKDTMVLKAGEQLGSPEIGLLATVGVAIVKVYPRPTVGV  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEPE   LSRGQI
Sbjct  181  LSTGDELVEPETKYLSRGQI  200



>ref|XP_010520491.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1 [Tarenaya hassleriana]
Length=672

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+   EAL+IVL VA+RL P         GR   EDI APDPLPPYPAS+KDGYAVV+SD
Sbjct  24   MIPVEEALQIVLGVAERLAPA--------GRPXPEDIRAPDPLPPYPASVKDGYAVVASD  75

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+ITESRAGNDGLGV VTPGTVAYVTTGGPIPDGADAVVQVE+TE + + S ES+
Sbjct  76   GPGEYPVITESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTEEIKEGSTESR  135

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL  T  G DIR VG DI K   +LKSGE +GA EIGLLAT GV  V++YP PT+AV
Sbjct  136  RVRILIQTTKGTDIRQVGCDIEKDTTILKSGERIGASEIGLLATAGVISVKIYPVPTVAV  195

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP VG L RGQI
Sbjct  196  LSTGDELVEPTVGTLGRGQI  215



>gb|ABR17730.1| unknown [Picea sitchensis]
Length=677

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 162/209 (78%), Gaps = 0/209 (0%)
 Frame = +2

Query  35   ENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIK  214
            E    P S M+S  +A  IVLS+ + L PV+V LH+ALG +LA D+ APDPLPPYPAS+K
Sbjct  10   EVAMCPPSTMLSVEDATHIVLSITKCLEPVTVQLHEALGLILAMDLHAPDPLPPYPASVK  69

Query  215  DGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTEL  394
            DG+AVV++DGPG YP+I ESRAGND +GV V  GTVAY+TTGGP+P+GADAVVQVE+T+ 
Sbjct  70   DGFAVVAADGPGDYPVIAESRAGNDAVGVTVYSGTVAYITTGGPVPEGADAVVQVEDTQQ  129

Query  395  LLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQ  574
            + +     K++RIL G   G DIRPVG DI KG VVLKSGE +GA EIGLLAT+GV +V+
Sbjct  130  IEENPEGMKRIRILTGAYKGQDIRPVGYDIQKGAVVLKSGERIGAAEIGLLATIGVVMVK  189

Query  575  VYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            VYP PTIAVLSTGDELV+P    L RGQI
Sbjct  190  VYPIPTIAVLSTGDELVDPASNSLGRGQI  218



>ref|XP_006847466.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
 gb|ERN09047.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
Length=675

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 160/200 (80%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S  +A  IVLS AQ L P++VPL +ALG +LAEDI APDPLPP+ ASIKDG+AVV++D
Sbjct  17   MLSIEDATHIVLSRAQGLEPITVPLPEALGLILAEDIKAPDPLPPFRASIKDGFAVVAAD  76

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP+I E+RAGND  G+++TPGTVAY+TTGGP+PDGADAVVQVE+TE + D  +  K
Sbjct  77   GPGEYPVIAEARAGNDAEGMIITPGTVAYITTGGPVPDGADAVVQVEDTEQIEDTPDGLK  136

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            +VRIL    PG DIRPVG DI KG  +L+ GEH+G  +IGLLA++G+ +V+VYP PT+AV
Sbjct  137  RVRILVAANPGQDIRPVGCDIEKGATILRRGEHIGTAKIGLLASMGMVMVKVYPRPTVAV  196

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELVEP    L RGQI
Sbjct  197  LSTGDELVEPATRVLGRGQI  216



>emb|CAE04830.1| OSJNBa0084K01.2 [Oryza sativa Japonica Group]
 emb|CAE54543.1| OSJNBa0015K02.22 [Oryza sativa Japonica Group]
 emb|CAH67068.1| H0112G12.13 [Oryza sativa Indica Group]
 gb|EEC78184.1| hypothetical protein OsI_17781 [Oryza sativa Indica Group]
Length=661

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +2

Query  131  PLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVT  310
            PLH ALG VLAED+ APDPLPP+ ASIKDGYAVV+SDGPG YP+ITESRAG+D LGVVVT
Sbjct  28   PLHDALGLVLAEDVRAPDPLPPFRASIKDGYAVVASDGPGEYPVITESRAGDDALGVVVT  87

Query  311  PGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIAK  490
            PGTVAYVTTGGPIPDGADAVVQVE+TE L  A + SK+VRIL     G DIR VG DI K
Sbjct  88   PGTVAYVTTGGPIPDGADAVVQVEDTEQLAGAPDGSKRVRILVRPTQGQDIRNVGCDIQK  147

Query  491  GDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
              VVLKS EH+G  EIGLLATVGVT V+VY  PTIAV STGDELVEP    LSRGQI
Sbjct  148  DSVVLKSSEHIGPAEIGLLATVGVTTVKVYRRPTIAVFSTGDELVEPATASLSRGQI  204



>ref|XP_002447271.1| hypothetical protein SORBIDRAFT_06g031680 [Sorghum bicolor]
 gb|EES11599.1| hypothetical protein SORBIDRAFT_06g031680 [Sorghum bicolor]
Length=660

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +2

Query  128  VPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVV  307
            VPLH ALG VLAED+ APDPLPP+ ASIKDGYAVV+SDGPG YP++TESRAG+D LGVVV
Sbjct  24   VPLHDALGLVLAEDVRAPDPLPPFRASIKDGYAVVASDGPGEYPVVTESRAGDDALGVVV  83

Query  308  TPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIA  487
             PGTVAYVTTGGPIPDGADAVVQVE+TE +   ++ +K+VRIL     G DIR VG DI 
Sbjct  84   APGTVAYVTTGGPIPDGADAVVQVEDTEQVTSGADGAKRVRILARAAEGQDIRNVGCDIE  143

Query  488  KGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            K  +VL SGEH+G  EIGLLATVGVT V+VYP PTIA+ STGDELV+P    LSRGQI
Sbjct  144  KDSLVLNSGEHIGPAEIGLLATVGVTTVKVYPRPTIAIFSTGDELVQPATATLSRGQI  201



>ref|XP_009376133.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Pyrus 
x bretschneideri]
Length=647

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  128  VPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVV  307
            + +  AL  VL  DI A +PLPPYPAS+KDGYAVV+SDGPG YP+I ESRAGNDGLG+ V
Sbjct  15   ISVEDALETVLRVDIRAREPLPPYPASVKDGYAVVASDGPGEYPVIAESRAGNDGLGITV  74

Query  308  TPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIA  487
            TPGTVAYVTTGGPIPDGADAVVQVE+TE + + S +S+QVRIL  T  GVDIRPVG DI 
Sbjct  75   TPGTVAYVTTGGPIPDGADAVVQVEDTEEIEEHSLDSRQVRILIQTSKGVDIRPVGCDIE  134

Query  488  KGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
               VVL SG+ +GA EIGLLATVGVT+V+VYPTPTI VLSTGDELVEP  GCL+RGQI
Sbjct  135  ADAVVLTSGQRIGASEIGLLATVGVTMVKVYPTPTIGVLSTGDELVEPMTGCLNRGQI  192



>ref|NP_001168286.1| viviparous10 [Zea mays]
 gb|ACN27697.1| unknown [Zea mays]
 gb|AFW59744.1| viviparous10 [Zea mays]
Length=657

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  119  PVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLG  298
            P +VPL  ALG VLAED+ APDPLPP+ ASIKDGYAVV+SDGPG YP++TESRAG+D LG
Sbjct  21   PHAVPLQGALGLVLAEDVCAPDPLPPFRASIKDGYAVVASDGPGEYPVVTESRAGDDALG  80

Query  299  VVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGS  478
            VVV PGTVAYVTTGGP+PDGADAVVQVE+TE L   ++ SK+VRIL       DIR VG 
Sbjct  81   VVVVPGTVAYVTTGGPVPDGADAVVQVEDTEQLPGGADGSKRVRILARASQRQDIRSVGC  140

Query  479  DIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQ  658
            DI K  +VLKSGEH+G  EIGLLATVGVT V+VYP PTIAV STGDELV+P    LSRGQ
Sbjct  141  DIEKDSIVLKSGEHIGPAEIGLLATVGVTTVKVYPRPTIAVFSTGDELVQPATATLSRGQ  200

Query  659  I  661
            I
Sbjct  201  I  201



>ref|XP_004960170.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Setaria 
italica]
Length=661

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  119  PVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLG  298
            P  VPLH ALG VLAE++ APDPLPP+ ASIKDGYAVVSSDGPG YP+ITESRAGND LG
Sbjct  22   PRGVPLHDALGLVLAEEVRAPDPLPPFRASIKDGYAVVSSDGPGEYPVITESRAGNDALG  81

Query  299  VVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGS  478
            VVV PGTVAYVTTGGPIPDGADAVVQVE+TE +   ++ SK+V+IL     G DIR VG 
Sbjct  82   VVVAPGTVAYVTTGGPIPDGADAVVQVEDTEQIPAGADGSKRVKILVRAAEGQDIRNVGC  141

Query  479  DIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQ  658
            DI K  +VLKSGE +G  EIGLLATVGVT V+VY  PTIAV STGDELV+P    LSRGQ
Sbjct  142  DIEKDSIVLKSGELIGPAEIGLLATVGVTTVKVYLRPTIAVFSTGDELVQPATATLSRGQ  201

Query  659  I  661
            I
Sbjct  202  I  202



>gb|ABB30174.1| molybdenum cofactor biosynthesis protein [Zea mays]
Length=657

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  119  PVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLG  298
            P +VPL  ALG VLAED+ APDPLPP+ ASIKDGYAVV+SDGPG YP++TESRAG+D LG
Sbjct  21   PHAVPLQGALGLVLAEDVCAPDPLPPFRASIKDGYAVVASDGPGEYPVVTESRAGDDALG  80

Query  299  VVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGS  478
            VVV PGTVAYVTTGGP+PDGADAVVQVE+TE L   ++ SK+VRIL       DIR V  
Sbjct  81   VVVVPGTVAYVTTGGPVPDGADAVVQVEDTEQLPGGADGSKRVRILARASQRQDIRSVVC  140

Query  479  DIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQ  658
            DI K  +VLKSGEH+G  EIGLLATVGVT V+VYP PTIAV STGDELV+P    LSRGQ
Sbjct  141  DIEKDSIVLKSGEHIGPAEIGLLATVGVTTVKVYPRPTIAVFSTGDELVQPATATLSRGQ  200

Query  659  I  661
            I
Sbjct  201  I  201



>ref|XP_002973522.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
 gb|EFJ25182.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
Length=641

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 152/200 (76%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            MVS  EA+ + LSVA R  PV + L QALG +LAED+ A DPLPPYPAS+KDGYAVVSSD
Sbjct  1    MVSVAEAVSLALSVAARREPVEIELLQALGLILAEDLQASDPLPPYPASVKDGYAVVSSD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP++ E+RAG D  G+ +  GTVAY+TTGGP+P GADAVVQVENT ++ D  +  K
Sbjct  61   GPGDYPVVAEARAGLDAEGITLESGTVAYITTGGPVPRGADAVVQVENTCIVSDPRDGKK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
            ++R+L G   G DIRPVG D+AKGD VL +G+ LG  EIGLLA+VG T V+V+P PT+A+
Sbjct  121  KIRVLSGASQGQDIRPVGFDVAKGDKVLSAGDKLGPAEIGLLASVGTTKVKVFPRPTVAI  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELV+     L RGQI
Sbjct  181  LSTGDELVDYFEKDLQRGQI  200



>ref|XP_001770478.1| predicted protein [Physcomitrella patens]
 gb|EDQ64647.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            +V+  +A  I+LSVA+RL PV+VPL++A G  LAEDITAP+P+PP+PASIKDGYAVV++D
Sbjct  13   LVTVQQATNIILSVAKRLSPVTVPLYEASGATLAEDITAPEPIPPFPASIKDGYAVVAAD  72

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLD-ASNES  418
            GPG YP++  +RAG+    + + PG+V Y+TTGGPIPDGADAVVQVE+TE++ D ASN+ 
Sbjct  73   GPGEYPVVGAARAGSYSSQLQLQPGSVVYITTGGPIPDGADAVVQVEDTEVVEDGASNDV  132

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            K++RILK    G DIRPVG DIA+G  VLK+GE LGA EIGLLATVGV+ V+V+  P +A
Sbjct  133  KKIRILKTVTKGHDIRPVGFDIAEGASVLKAGERLGAAEIGLLATVGVSHVEVFRRPKVA  192

Query  599  VLSTGDELVEPEVGC-LSRGQI  661
            V STGDELV+P+ G  L +GQI
Sbjct  193  VASTGDELVDPQDGTKLGKGQI  214



>ref|XP_003580744.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Brachypodium 
distachyon]
Length=664

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +2

Query  128  VPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVV  307
            VPL  ALG VLAED+ APDPLPP+ AS+KDGYAVV+SDGPG Y +I E+RAG+D LGVVV
Sbjct  28   VPLLDALGLVLAEDVRAPDPLPPFRASVKDGYAVVASDGPGEYAVIAEARAGDDALGVVV  87

Query  308  TPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIA  487
            TPGTVAYVTTGGPIPDGADAVVQVE+TE +    + +K+VRI      G DIR VG DI 
Sbjct  88   TPGTVAYVTTGGPIPDGADAVVQVEDTEQVAAPPDGTKRVRISVRVAEGHDIRNVGCDIE  147

Query  488  KGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            K  VVLKSGEHLG  EIGLLATVGVT V+ Y  PTIAV STGDELV+P+   LSRGQI
Sbjct  148  KDLVVLKSGEHLGPAEIGLLATVGVTAVKAYRRPTIAVFSTGDELVQPDTATLSRGQI  205



>dbj|BAJ88077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +2

Query  128  VPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVV  307
            VPL  ALG VLAED  APDPLPP+ AS+KDGYAVV++DGPG YP+I E+RAG+D LGVVV
Sbjct  23   VPLLDALGLVLAEDARAPDPLPPFRASVKDGYAVVAADGPGEYPVIAEARAGDDALGVVV  82

Query  308  TPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIA  487
            TPGTVAYVTTGGPIPDGADAVVQVE+TE +  A + SK+VRI      G DIR VG DI 
Sbjct  83   TPGTVAYVTTGGPIPDGADAVVQVEDTEQVAAAPDGSKRVRISARVPEGHDIRSVGCDIE  142

Query  488  KGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            K  +VLKSGE++G  EIGLLATVGVT V+ Y  PTIAV STGDELVEP    L+RGQI
Sbjct  143  KDSIVLKSGENIGPAEIGLLATVGVTTVKAYRRPTIAVFSTGDELVEPATATLNRGQI  200



>dbj|BAK02586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +2

Query  128  VPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVV  307
            VPL  ALG VLAED  APDPLPP+ AS+KDGYAVV++DGPG YP+I E+RAG+D LGVVV
Sbjct  25   VPLLDALGLVLAEDARAPDPLPPFRASVKDGYAVVAADGPGEYPVIAEARAGDDALGVVV  84

Query  308  TPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIA  487
            TPGTVAYVTTGGPIPDGADAVVQVE+TE +  A + SK+VRI      G DIR VG DI 
Sbjct  85   TPGTVAYVTTGGPIPDGADAVVQVEDTEQVAAAPDGSKRVRISARVPEGHDIRSVGCDIE  144

Query  488  KGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            K  +VLKSGE++G  EIGLLATVGVT V+ Y  PTIAV STGDELVEP    L+RGQI
Sbjct  145  KDSIVLKSGENIGPAEIGLLATVGVTTVKAYRRPTIAVFSTGDELVEPATATLNRGQI  202



>gb|AAF73075.1|AF268595_1 molybdenum cofactor biosynthesis protein Cnx1 [Hordeum vulgare]
Length=659

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +2

Query  128  VPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVV  307
            VPL  ALG VLAED  APDPLPP+ AS+KDGYAVV++DGPG YP+I E+RAG+D LGVVV
Sbjct  25   VPLLDALGLVLAEDARAPDPLPPFRASVKDGYAVVAADGPGEYPVIAEARAGDDALGVVV  84

Query  308  TPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESKQVRILKGTGPGVDIRPVGSDIA  487
            TPGTVAYVTTGGPIPDGADAVVQVE+TE +  A + SK+VRI      G DIR VG DI 
Sbjct  85   TPGTVAYVTTGGPIPDGADAVVQVEDTEQVAAAPDGSKRVRISARVPEGHDIRSVGCDIE  144

Query  488  KGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            K  +VLKSGE++G  EIGLLATVGVT V+ Y  PTIAV STGDELVEP    L+RGQI
Sbjct  145  KDSIVLKSGENIGPAEIGLLATVGVTTVKAYRRPTIAVFSTGDELVEPATATLNRGQI  202



>ref|XP_002975554.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
 gb|EFJ23183.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
Length=641

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            MVS  EA+ + LSVA R  PV + L QALG VLAED+ A DPLPPYPAS+KDGYAVVSSD
Sbjct  1    MVSVAEAVSLALSVAARREPVEIELLQALGLVLAEDLQASDPLPPYPASVKDGYAVVSSD  60

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            GPG YP++ E+RAG D   + +  GTVAY+TTGGP+P GADAVVQVENT ++    +  K
Sbjct  61   GPGDYPVVAEARAGLDAKDITLESGTVAYITTGGPVPRGADAVVQVENTCIVSGPRDGKK  120

Query  422  QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAV  601
             +R+L G   G DIRPVG D+AKGD VL +G+ LG  EIGLLA+VG T V+V+P PT+A+
Sbjct  121  TIRVLSGASQGQDIRPVGFDVAKGDKVLSAGDKLGPAEIGLLASVGTTKVKVFPRPTVAI  180

Query  602  LSTGDELVEPEVGCLSRGQI  661
            LSTGDELV+     L RGQI
Sbjct  181  LSTGDELVDYSEKHLQRGQI  200



>gb|KDO47645.1| hypothetical protein CISIN_1g0059001mg, partial [Citrus sinensis]
 gb|KDO47646.1| hypothetical protein CISIN_1g0059001mg, partial [Citrus sinensis]
Length=152

 Score =   212 bits (540),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            KM+S+ EAL+ VLSVAQRLPPV+VPL++ALG+VLAEDI APDPLPPYPAS+KDGYAVV+S
Sbjct  15   KMISAEEALQKVLSVAQRLPPVTVPLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVAS  74

Query  239  DGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            DGPG YP+ITESRAGNDG+GV+VT GTVAYVTTGGPIPDGADAVVQVE+T+ +   + ES
Sbjct  75   DGPGEYPVITESRAGNDGIGVIVTSGTVAYVTTGGPIPDGADAVVQVEDTDEVNHTAAES  134

Query  419  KQVRILKGTGPGVDIRPV  472
            K+V+IL  T  GVDIRPV
Sbjct  135  KRVKILVQTNKGVDIRPV  152



>gb|ABC42492.1| molybdenum cofactor biosynthesis protein Cnx1E [Chlamydomonas 
reinhardtii]
Length=450

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 148/201 (74%), Gaps = 3/201 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S  EA +IVLS  + L  V+V L  ALGRVLAE++ APD LPP+PASIKDGYAVV++D
Sbjct  1    MISIPEAQDIVLSHTRPLGAVTVGLAGALGRVLAEEVRAPDSLPPFPASIKDGYAVVAAD  60

Query  242  GPGVYPIITESRAGN-DGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            G G +P++ ESRAG+ D L   V PG+VAY+TTG P+P GADAVVQVE+TE L D     
Sbjct  61   GVGEFPVVGESRAGHLDQL--PVAPGSVAYITTGAPVPPGADAVVQVEDTEKLPDGEGSQ  118

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            ++VRI K    G DIRPVGSDI +GD VL++GE +G  E+G+LATVG   ++V+ TP +A
Sbjct  119  RRVRICKAAKAGQDIRPVGSDITEGDTVLQAGERVGVAEMGILATVGAVSLKVHATPRVA  178

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDE+V+P    L  GQI
Sbjct  179  VLSTGDEVVDPSTAPLGPGQI  199



>ref|XP_002950060.1| hypothetical protein VOLCADRAFT_90518 [Volvox carteri f. nagariensis]
 gb|EFJ48728.1| hypothetical protein VOLCADRAFT_90518 [Volvox carteri f. nagariensis]
Length=488

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 147/201 (73%), Gaps = 3/201 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+S  EA +IVLS    L  V+V L  ALGRVLAED+ APD LPP+PASIKDGYAVVSSD
Sbjct  1    MISIPEAQDIVLSHTLPLGAVTVHLSDALGRVLAEDVHAPDSLPPFPASIKDGYAVVSSD  60

Query  242  GPGVYPIITESRAGN-DGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNES  418
            G G YP+I ESRAG  D L V   PGTVAY+TTG P+P GADAVVQVE+TE+     +  
Sbjct  61   GVGEYPVIGESRAGQLDELPV--RPGTVAYITTGAPVPPGADAVVQVEDTEVAPQGPDGV  118

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
            ++VRI K    G DIRPVGSDIA+GD+VL++GE +G  E+G+LATVG   ++V+  P +A
Sbjct  119  RRVRINKAAKAGQDIRPVGSDIAEGDIVLRAGELVGVAEVGILATVGAVQLKVHAKPKVA  178

Query  599  VLSTGDELVEPEVGCLSRGQI  661
            VLSTGDE+V+P    L  GQI
Sbjct  179  VLSTGDEVVDPATRPLGPGQI  199



>ref|XP_001698334.1| molybdenum cofactor biosynthesis protein [Chlamydomonas reinhardtii]
 gb|EDP07827.1| molybdopterin biosynthesis protein [Chlamydomonas reinhardtii]
Length=446

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 149/204 (73%), Gaps = 5/204 (2%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            KM+S  EA +IVLS  + L  V+V L  ALGRVLAE++ APD LPP+PASIKDGYAVV++
Sbjct  7    KMISIPEAQDIVLSHTRPLGAVTVGLAGALGRVLAEEVRAPDSLPPFPASIKDGYAVVAA  66

Query  239  DGPGVYPIITESRAGN-DGLGVVVTPGTVAYVTTG--GPIPDGADAVVQVENTELLLDAS  409
            DG G +P++ ESRAG+ D L   V PG+VAY+TTG   P+P GADAVVQVE+TE L D  
Sbjct  67   DGVGEFPVVGESRAGHLDQL--PVAPGSVAYITTGRGAPVPPGADAVVQVEDTEKLPDGE  124

Query  410  NESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTP  589
               ++VRI K    G DIRPVGSDI +GD VL++GE +G  E+G+LATVG   ++V+ TP
Sbjct  125  GSQRRVRICKAAKAGQDIRPVGSDITEGDTVLQAGERVGVAEMGILATVGAVSLKVHATP  184

Query  590  TIAVLSTGDELVEPEVGCLSRGQI  661
             +AVLSTGDE+V+P    L  GQI
Sbjct  185  RVAVLSTGDEVVDPSTAPLGPGQI  208



>ref|XP_006653844.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Oryza 
brachyantha]
Length=671

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +2

Query  212  KDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTE  391
             DGYAVV+SDGPG YP+ITESRAG+D LGVVV PGTVAYVTTGGPIPDGADAV+QVE+TE
Sbjct  65   HDGYAVVASDGPGEYPVITESRAGDDALGVVVAPGTVAYVTTGGPIPDGADAVLQVEDTE  124

Query  392  LLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIV  571
            LL  A + SK+VRIL     G DIR VG DI K  VVLKSGEH+G PEIGLLAT+GVT V
Sbjct  125  LLAGAPDGSKRVRILVRPTEGQDIRNVGCDIEKDSVVLKSGEHIGPPEIGLLATMGVTTV  184

Query  572  QVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
            + Y  PT+AV STGDELV+P    LSRGQI
Sbjct  185  KAYRRPTVAVFSTGDELVQPVTASLSRGQI  214



>gb|KGN66382.1| hypothetical protein Csa_1G600220 [Cucumis sativus]
Length=155

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +2

Query  29   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPAS  208
            M+++     + M+SS+EAL+ VL VA+ LPP+ V LH A+G+VLA+DI A DPLPPYPAS
Sbjct  1    MADHSCVKSTAMISSDEALKTVLEVARCLPPIVVSLHDAMGKVLAQDIRASDPLPPYPAS  60

Query  209  IKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENT  388
            IKDGYAVV+SDGPG YP+ITESRAGNDG+GV VTPGTVAYVTTGGPIPDGADAVVQVE+T
Sbjct  61   IKDGYAVVASDGPGEYPVITESRAGNDGVGVTVTPGTVAYVTTGGPIPDGADAVVQVEDT  120

Query  389  ELLLDASNESKQVRILKGTGPGVDIRPV  472
            E +     ESK+V+I      G DIRPV
Sbjct  121  EKI-----ESKRVKIKVKARKGADIRPV  143



>ref|XP_005646314.1| molybdopterin biosynthesis protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21770.1| molybdopterin biosynthesis protein [Coccomyxa subellipsoidea 
C-169]
Length=436

 Score =   194 bits (494),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 141/204 (69%), Gaps = 3/204 (1%)
 Frame = +2

Query  53   ISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVV  232
            + +MVS  EA + VL+  + LP +S+ L  A+G +L ED+ A +PLPP+PASIKDGYAVV
Sbjct  1    MYRMVSIAEAQKTVLNAIEPLPSISLGLSDAVGHILGEDVIAREPLPPFPASIKDGYAVV  60

Query  233  SSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN  412
            S+DGPG Y +  E+ AG       +  G+VAY+TTG P+PDGADAVVQVENTE L    +
Sbjct  61   SADGPGDYDVAFEALAGT--AAGQLKAGSVAYITTGAPLPDGADAVVQVENTEKLPAGPD  118

Query  413  ESKQVRILK-GTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTP  589
              ++VRI+K   GPG D+R +GSDIA G+VVL     +GA EIGLLATVG   VQV    
Sbjct  119  GQQRVRIVKPAKGPGDDVRALGSDIAAGEVVLAKDSLVGAAEIGLLATVGAATVQVRRKA  178

Query  590  TIAVLSTGDELVEPEVGCLSRGQI  661
             +AVLSTGDELVEP+   L  GQI
Sbjct  179  RVAVLSTGDELVEPDQETLGPGQI  202



>gb|EMT03164.1| Molybdopterin biosynthesis protein CNX1 [Aegilops tauschii]
Length=696

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +2

Query  206  SIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVEN  385
            + +DGYAVV++DGPG YP+I E+RAG+D LGVVVTPGTVAYVTTGGPIPDGADAVVQVE+
Sbjct  52   AFEDGYAVVAADGPGEYPVIAEARAGDDALGVVVTPGTVAYVTTGGPIPDGADAVVQVED  111

Query  386  TELLLDASNESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVT  565
            TE +  A + SK+VRI      G DIR VG DI K  +VLKSGE++G  EIGLLATVGVT
Sbjct  112  TEQVAAAPDGSKRVRISVRVPEGHDIRSVGCDIEKDYIVLKSGENIGPAEIGLLATVGVT  171

Query  566  IVQVYPTPTIAVLSTGDELVEPEVGCLSRGQI  661
             V+ Y  PTIA  STGDELV+P    L+RGQI
Sbjct  172  TVKAYRRPTIAAFSTGDELVQPATATLNRGQI  203



>gb|KIZ01003.1| Molybdopterin biosynthesis protein CNX1 [Monoraphidium neglectum]
Length=481

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 140/203 (69%), Gaps = 6/203 (3%)
 Frame = +2

Query  59   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSS  238
            KM+S  EA E VL+V   L P   PL  A+GR+LA+ ++A D LPP+PASIKDGYAVVSS
Sbjct  5    KMISIPEAQEAVLAVTPVLGPEEAPLGSAVGRILAQSVSARDSLPPFPASIKDGYAVVSS  64

Query  239  DGPGVYPIITESRAGN--DGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN  412
            DG G YP+ +ESR G   D     + PGTV Y+TTG P+P GADAV+QVE+T+ L  AS+
Sbjct  65   DGLGDYPVASESRPGALPDA---PLQPGTVCYITTGAPVPAGADAVIQVEDTQKL-PASD  120

Query  413  ESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPT  592
                VRILK   PG DIRPVGSDI +G  VL +GE +G  E+G+LATVG T + V   P 
Sbjct  121  GRAAVRILKAAKPGQDIRPVGSDIQQGAEVLAAGERVGVAEVGILATVGATALPVVRRPV  180

Query  593  IAVLSTGDELVEPEVGCLSRGQI  661
            +AVLSTGDE+VEP    L  GQI
Sbjct  181  VAVLSTGDEVVEPSTAALGPGQI  203



>ref|WP_014434007.1| molybdopterin biosynthesis protein MoeA [Caldilinea aerophila]
 dbj|BAM00778.1| molybdopterin biosynthesis protein MoeA [Caldilinea aerophila 
DSM 14535 = NBRC 104270]
Length=422

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 130/191 (68%), Gaps = 3/191 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    AL++VL  A  LPP+++P+  ALG +LA  + A  PLPP+PAS+KDGYAVV++D
Sbjct  8    MIDVEAALDVVLEQATPLPPMTLPIRAALGHILACTVYATRPLPPFPASVKDGYAVVAAD  67

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELL--LDASNE  415
            GPGVYP++ E  AG      V+  G VAY+TTG P+P GADAVV VE TEL+   D +  
Sbjct  68   GPGVYPVVGEVTAGRVA-EFVLKRGEVAYITTGAPLPPGADAVVMVEETELVGREDGATN  126

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
               VRI     PG D+RP+G D+A G  VL +G  LG  EIGLLATVG   V+V+P P +
Sbjct  127  RPLVRIRTRVQPGADVRPIGYDVAVGQEVLSAGTRLGPAEIGLLATVGAAQVEVHPAPRV  186

Query  596  AVLSTGDELVE  628
            A+LSTGDELVE
Sbjct  187  AILSTGDELVE  197



>ref|XP_009820960.1| hypothetical protein, variant 3 [Aphanomyces astaci]
 gb|ETV88560.1| hypothetical protein, variant 3 [Aphanomyces astaci]
Length=443

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+   EA++ V+ +AQ L   SVPLH+ALG VLAE I + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMKEAIDTVIRLAQPLLKTSVPLHEALGCVLAETIKSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLL-DASNES  418
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L D     
Sbjct  79   GVGEFPILSRVAAG-DAPGVQVTPGHVAYVTTGCPVPDGADAVVKIEDTEAILGDDGKTE  137

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              ++IL     G  IRP+G DIA+  VV+++GE +    +GLLATVG+  V +Y TP + 
Sbjct  138  LAIKILHAVQSGTSIRPIGFDIAQDQVVVEAGEVVTPAVLGLLATVGIATVSIYKTPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_009820959.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV88559.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=509

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+   EA++ V+ +AQ L   SVPLH+ALG VLAE I + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMKEAIDTVIRLAQPLLKTSVPLHEALGCVLAETIKSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLL-DASNES  418
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L D     
Sbjct  79   GVGEFPILSRVAAG-DAPGVQVTPGHVAYVTTGCPVPDGADAVVKIEDTEAILGDDGKTE  137

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              ++IL     G  IRP+G DIA+  VV+++GE +    +GLLATVG+  V +Y TP + 
Sbjct  138  LAIKILHAVQSGTSIRPIGFDIAQDQVVVEAGEVVTPAVLGLLATVGIATVSIYKTPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_010774817.1| PREDICTED: gephyrin isoform X6 [Notothenia coriiceps]
Length=470

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  50   LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  109

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  110  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  168

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  169  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  228

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  229  AVMSTGNELLNPE  241



>ref|XP_010774813.1| PREDICTED: gephyrin isoform X2 [Notothenia coriiceps]
Length=513

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  94   LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  153

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  154  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  212

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  213  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  272

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  273  AVMSTGNELLNPE  285



>ref|XP_010774812.1| PREDICTED: gephyrin isoform X1 [Notothenia coriiceps]
Length=514

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  94   LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  153

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  154  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  212

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  213  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  272

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  273  AVMSTGNELLNPE  285



>ref|XP_010774816.1| PREDICTED: gephyrin isoform X5 [Notothenia coriiceps]
Length=489

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  69   LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  128

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  129  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  187

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  188  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  247

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  248  AVMSTGNELLNPE  260



>ref|XP_010774814.1| PREDICTED: gephyrin isoform X3 [Notothenia coriiceps]
Length=508

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  94   LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  153

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  154  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  212

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  213  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  272

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  273  AVMSTGNELLNPE  285



>ref|XP_009820957.1| hypothetical protein H257_00123 [Aphanomyces astaci]
 gb|ETV88557.1| hypothetical protein H257_00123 [Aphanomyces astaci]
Length=631

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+   EA++ V+ +AQ L   SVPLH+ALG VLAE I + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMKEAIDTVIRLAQPLLKTSVPLHEALGCVLAETIKSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLL-DASNES  418
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L D     
Sbjct  79   GVGEFPILSRVAAG-DAPGVQVTPGHVAYVTTGCPVPDGADAVVKIEDTEAILGDDGKTE  137

Query  419  KQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              ++IL     G  IRP+G DIA+  VV+++GE +    +GLLATVG+  V +Y TP + 
Sbjct  138  LAIKILHAVQSGTSIRPIGFDIAQDQVVVEAGEVVTPAVLGLLATVGIATVSIYKTPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_010133790.1| PREDICTED: gephyrin-like, partial [Buceros rhinoceros silvestris]
Length=356

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  75   LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  134

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  135  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  193

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  194  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  253

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  254  AVMSTGNELLNPE  266



>ref|XP_010774815.1| PREDICTED: gephyrin isoform X4 [Notothenia coriiceps]
Length=495

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  75   LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  134

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  135  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  193

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  194  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  253

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  254  AVMSTGNELLNPE  266



>ref|XP_009210028.1| PREDICTED: gephyrin isoform X19 [Papio anubis]
Length=438

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  211  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  270

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  271  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  329

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  330  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  389

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  390  AVMSTGNELLNPE  402



>ref|XP_003971788.1| PREDICTED: gephyrin-like isoform 2 [Takifugu rubripes]
Length=794

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  559

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  560  AVMSTGNELLNPE  572



>gb|EPY79735.1| hypothetical protein CB1_000898039 [Camelus ferus]
Length=352

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  6    LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  65

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  66   GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  124

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  125  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  184

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  185  AVMSTGNELLNPE  197



>ref|XP_009210026.1| PREDICTED: gephyrin isoform X17 [Papio anubis]
Length=471

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  244  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  303

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  304  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  362

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  363  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  422

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  423  AVMSTGNELLNPE  435



>ref|XP_010880833.1| PREDICTED: gephyrin isoform X4 [Esox lucius]
Length=801

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  388  LTSMDKAFITVLEMTAILGTEIINYRDGMGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  447

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  448  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  506

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  507  ELEVRILVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVV  566

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  567  AVMSTGNELLNPE  579



>ref|XP_010880832.1| PREDICTED: gephyrin isoform X3 [Esox lucius]
Length=807

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  388  LTSMDKAFITVLEMTAILGTEIINYRDGMGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  447

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  448  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  506

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  507  ELEVRILVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVV  566

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  567  AVMSTGNELLNPE  579



>ref|XP_003971787.1| PREDICTED: gephyrin-like isoform 1 [Takifugu rubripes]
Length=736

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_007255542.1| PREDICTED: gephyrin isoform X3 [Astyanax mexicanus]
Length=796

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  383  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  442

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  443  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  501

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  502  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  561

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  562  AVMSTGNELLNPE  574



>ref|XP_010880834.1| PREDICTED: gephyrin isoform X5 [Esox lucius]
Length=796

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  383  LTSMDKAFITVLEMTAILGTEIINYRDGMGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  442

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  443  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  501

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  502  ELEVRILVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVV  561

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  562  AVMSTGNELLNPE  574



>ref|XP_009210027.1| PREDICTED: gephyrin isoform X18 [Papio anubis]
Length=457

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  230  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  289

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  290  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  348

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  349  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  408

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  409  AVMSTGNELLNPE  421



>ref|XP_010880830.1| PREDICTED: gephyrin isoform X1 [Esox lucius]
Length=810

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  388  LTSMDKAFITVLEMTAILGTEIINYRDGMGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  447

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  448  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  506

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  507  ELEVRILVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVV  566

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  567  AVMSTGNELLNPE  579



>emb|CDQ81339.1| unnamed protein product [Oncorhynchus mykiss]
Length=386

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  LGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVA  325
            +GRVLA+D+ A D LPP+PAS+KDGYAV ++DGPG   II ES+AG      V+ PG V 
Sbjct  1    MGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGQQPTHTVM-PGQVM  59

Query  326  YVTTGGPIPDGADAVVQVENTELLLDASN--ESKQVRILKGTGPGVDIRPVGSDIAKGDV  499
             VTTG PIP GADAVVQVE+TELL ++ +  E  +VRIL    PG DIRP+G DI +G+ 
Sbjct  60   RVTTGAPIPCGADAVVQVEDTELLRESEDGTEELEVRILVQARPGQDIRPIGHDIKRGEC  119

Query  500  VLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPE  634
            VL  G H+G  EIGLLATVGVT V+V   P +AV+STG+EL+ PE
Sbjct  120  VLSKGTHMGPSEIGLLATVGVTEVEVQKFPVVAVMSTGNELLNPE  164



>ref|XP_010880831.1| PREDICTED: gephyrin isoform X2 [Esox lucius]
Length=809

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  388  LTSMDKAFITVLEMTAILGTEIINYRDGMGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  447

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  448  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  506

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  507  ELEVRILVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVV  566

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  567  AVMSTGNELLNPE  579



>ref|XP_007255541.1| PREDICTED: gephyrin isoform X2 [Astyanax mexicanus]
Length=798

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 123/168 (73%), Gaps = 3/168 (2%)
 Frame = +2

Query  137  HQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPG  316
            ++ +GRVLA+D+ A D LPP+PAS+KDGYAV ++DGPG   II ES+AG      V+ PG
Sbjct  407  YRGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTHTVM-PG  465

Query  317  TVAYVTTGGPIPDGADAVVQVENTELLLDASN--ESKQVRILKGTGPGVDIRPVGSDIAK  490
             V  VTTG PIP GADAVVQVE+TELL ++ +  E  +VRIL    PG DIRP+G DI +
Sbjct  466  QVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTEELEVRILVQARPGQDIRPIGHDIKR  525

Query  491  GDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPE  634
            G+ VL  G H+G  EIGLLATVGVT V+V+  P +AV+STG+EL+ PE
Sbjct  526  GECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVVAVMSTGNELLNPE  573



>ref|XP_007255543.1| PREDICTED: gephyrin isoform X4 [Astyanax mexicanus]
Length=785

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  369  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  428

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  429  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  487

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  488  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  547

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  548  AVMSTGNELLNPE  560



>ref|NP_001165871.1| gephyrin b [Danio rerio]
 dbj|BAI68426.1| gephyrin2 isoform [Danio rerio]
Length=796

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  383  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  442

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  443  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  501

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P I
Sbjct  502  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVI  561

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  562  AVMSTGNELLNPE  574



>ref|XP_007255540.1| PREDICTED: gephyrin isoform X1 [Astyanax mexicanus]
Length=799

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  383  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  442

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  443  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  501

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  502  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  561

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  562  AVMSTGNELLNPE  574



>ref|XP_011489844.1| PREDICTED: gephyrin [Oryzias latipes]
Length=724

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  311  LTSMDKAFITVLEMTAVLSTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  370

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  371  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  429

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  430  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  489

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  490  AVMSTGNELLNPE  502



>ref|XP_005991532.1| PREDICTED: gephyrin isoform X3 [Latimeria chalumnae]
Length=818

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 6/193 (3%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  378  LTSMDKAFITVLEMTPVLGTELIDYRYGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  437

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG       V PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  438  GPGDRFIIGESQAGEQ----TVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  493

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +GD VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  494  ELEVRILVQARPGQDIRPIGHDIKRGDCVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  553

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  554  AVMSTGNELLNPE  566



>ref|XP_005991530.1| PREDICTED: gephyrin isoform X1 [Latimeria chalumnae]
Length=841

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 6/193 (3%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  401  LTSMDKAFITVLEMTPVLGTELIDYRYGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  460

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG       V PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  461  GPGDRFIIGESQAGEQ----TVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  516

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +GD VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  517  ELEVRILVQARPGQDIRPIGHDIKRGDCVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  576

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  577  AVMSTGNELLNPE  589



>ref|XP_009210016.1| PREDICTED: gephyrin isoform X7 [Papio anubis]
Length=516

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  289  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  348

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  349  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  407

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  408  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  467

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  468  AVMSTGNELLNPE  480



>ref|XP_005991535.1| PREDICTED: gephyrin isoform X6 [Latimeria chalumnae]
Length=736

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTPVLGTELIDYRYGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +GD VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGDCVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_005991533.1| PREDICTED: gephyrin isoform X4 [Latimeria chalumnae]
Length=811

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 6/193 (3%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  401  LTSMDKAFITVLEMTPVLGTELIDYRYGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  460

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG       V PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  461  GPGDRFIIGESQAGEQ----TVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  516

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +GD VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  517  ELEVRILVQARPGQDIRPIGHDIKRGDCVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  576

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  577  AVMSTGNELLNPE  589



>ref|XP_007255544.1| PREDICTED: gephyrin isoform X5 [Astyanax mexicanus]
Length=778

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  362  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  421

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  422  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  480

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  481  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  540

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  541  AVMSTGNELLNPE  553



>ref|XP_005991531.1| PREDICTED: gephyrin isoform X2 [Latimeria chalumnae]
Length=822

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 6/193 (3%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  382  LTSMDKAFITVLEMTPVLGTELIDYRYGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  441

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG       V PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  442  GPGDRFIIGESQAGEQ----TVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  497

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +GD VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  498  ELEVRILVQARPGQDIRPIGHDIKRGDCVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  557

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  558  AVMSTGNELLNPE  570



>ref|XP_010880835.1| PREDICTED: gephyrin isoform X6 [Esox lucius]
Length=736

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAILGTEIINYRDGMGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_007255546.1| PREDICTED: gephyrin isoform X7 [Astyanax mexicanus]
Length=736

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_007244719.1| PREDICTED: gephyrin-like isoform X3 [Astyanax mexicanus]
Length=819

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVL++D+ A D LPP+PAS+KDGYAV ++D
Sbjct  406  LTSMDKAFITVLEMTSVLGTEIINYRDGMGRVLSQDVYAKDNLPPFPASVKDGYAVRAAD  465

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  466  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  524

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  525  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  584

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  585  AVMSTGNELLNPE  597



>ref|XP_007255545.1| PREDICTED: gephyrin isoform X6 [Astyanax mexicanus]
Length=739

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_007244723.1| PREDICTED: gephyrin-like isoform X7 [Astyanax mexicanus]
Length=733

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVL++D+ A D LPP+PAS+KDGYAV ++D
Sbjct  320  LTSMDKAFITVLEMTSVLGTEIINYRDGMGRVLSQDVYAKDNLPPFPASVKDGYAVRAAD  379

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  380  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  438

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  439  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  498

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  499  AVMSTGNELLNPE  511



>dbj|BAI68425.1| gephyrin2 [Danio rerio]
Length=736

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P I
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVI  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_009210021.1| PREDICTED: gephyrin isoform X12 [Papio anubis]
Length=492

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  265  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  324

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  325  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  383

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  384  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  443

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  444  AVMSTGNELLNPE  456



>ref|XP_009210024.1| PREDICTED: gephyrin isoform X15 [Papio anubis]
Length=485

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  258  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  317

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  318  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  376

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  377  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  436

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  437  AVMSTGNELLNPE  449



>ref|XP_009210020.1| PREDICTED: gephyrin isoform X11 [Papio anubis]
Length=504

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  277  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  336

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  337  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  395

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  396  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  455

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  456  AVMSTGNELLNPE  468



>ref|XP_007545562.1| PREDICTED: gephyrin isoform X6 [Poecilia formosa]
Length=686

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            A++STG+EL+ PE
Sbjct  560  AIMSTGNELLNPE  572



>ref|XP_009210025.1| PREDICTED: gephyrin isoform X16 [Papio anubis]
Length=471

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  244  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  303

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  304  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  362

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  363  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  422

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  423  AVMSTGNELLNPE  435



>ref|XP_005731179.1| PREDICTED: gephyrin-like isoform X5 [Pundamilia nyererei]
Length=774

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  360  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  419

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  420  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  478

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  479  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  538

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  539  AVMSTGNELLNPE  551



>ref|XP_005991534.1| PREDICTED: gephyrin isoform X5 [Latimeria chalumnae]
Length=772

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  359  LTSMDKAFITVLEMTPVLGTELIDYRYGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  418

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  419  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  477

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +GD VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  478  ELEVRILVQARPGQDIRPIGHDIKRGDCVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  537

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  538  AVMSTGNELLNPE  550



>ref|XP_009210023.1| PREDICTED: gephyrin isoform X14 [Papio anubis]
Length=490

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  263  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  322

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  323  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  381

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  382  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  441

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  442  AVMSTGNELLNPE  454



>ref|XP_009210022.1| PREDICTED: gephyrin isoform X13 [Papio anubis]
Length=492

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  265  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  324

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  325  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  383

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  384  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  443

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  444  AVMSTGNELLNPE  456



>ref|XP_007244720.1| PREDICTED: gephyrin-like isoform X4 [Astyanax mexicanus]
Length=813

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVL++D+ A D LPP+PAS+KDGYAV ++D
Sbjct  366  LTSMDKAFITVLEMTSVLGTEIINYRDGMGRVLSQDVYAKDNLPPFPASVKDGYAVRAAD  425

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  426  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  484

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  485  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  544

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  545  AVMSTGNELLNPE  557



>ref|XP_009210018.1| PREDICTED: gephyrin isoform X9 [Papio anubis]
Length=511

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  284  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  343

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  344  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  402

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  403  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  462

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  463  AVMSTGNELLNPE  475



>ref|XP_007119741.1| PREDICTED: gephyrin-like [Physeter catodon]
Length=442

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  29   LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  88

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  89   GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  147

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  148  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  207

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  208  AVMSTGNELLNPE  220



>ref|XP_009210015.1| PREDICTED: gephyrin isoform X6 [Papio anubis]
Length=525

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  298  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  357

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  358  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  416

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  417  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  476

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  477  AVMSTGNELLNPE  489



>ref|XP_009210012.1| PREDICTED: gephyrin isoform X3 [Papio anubis]
Length=530

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  303  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  362

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  363  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  421

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  422  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  481

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  482  AVMSTGNELLNPE  494



>ref|XP_009210014.1| PREDICTED: gephyrin isoform X5 [Papio anubis]
Length=528

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  301  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  360

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  361  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  419

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  420  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  479

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  480  AVMSTGNELLNPE  492



>ref|XP_010736720.1| PREDICTED: gephyrin [Larimichthys crocea]
Length=775

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  362  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  421

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  422  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  480

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  481  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  540

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  541  AVMSTGNELLNPE  553



>ref|XP_007244722.1| PREDICTED: gephyrin-like isoform X6 [Astyanax mexicanus]
Length=773

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVL++D+ A D LPP+PAS+KDGYAV ++D
Sbjct  360  LTSMDKAFITVLEMTSVLGTEIINYRDGMGRVLSQDVYAKDNLPPFPASVKDGYAVRAAD  419

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  420  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  478

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  479  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  538

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  539  AVMSTGNELLNPE  551



>ref|XP_008311621.1| PREDICTED: gephyrin isoform X3 [Cynoglossus semilaevis]
Length=781

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  367  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  426

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  427  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  485

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  486  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  545

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  546  AVMSTGNELLNPE  558



>ref|XP_004550512.1| PREDICTED: gephyrin-like isoform X1 [Maylandia zebra]
 ref|XP_005475054.1| PREDICTED: gephyrin-like isoform X3 [Oreochromis niloticus]
 ref|XP_005731175.1| PREDICTED: gephyrin-like isoform X1 [Pundamilia nyererei]
 ref|XP_006792662.1| PREDICTED: gephyrin-like isoform X1 [Neolamprologus brichardi]
Length=795

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  560  AVMSTGNELLNPE  572



>ref|XP_004550514.1| PREDICTED: gephyrin-like isoform X3 [Maylandia zebra]
 ref|XP_005475055.1| PREDICTED: gephyrin-like isoform X4 [Oreochromis niloticus]
 ref|XP_005731177.1| PREDICTED: gephyrin-like isoform X3 [Pundamilia nyererei]
 ref|XP_006792664.1| PREDICTED: gephyrin-like isoform X3 [Neolamprologus brichardi]
Length=781

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  367  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  426

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  427  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  485

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  486  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  545

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  546  AVMSTGNELLNPE  558



>ref|XP_009210019.1| PREDICTED: gephyrin isoform X10 [Papio anubis]
Length=506

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  279  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  338

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  339  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  397

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  398  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  457

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  458  AVMSTGNELLNPE  470



>ref|XP_007244717.1| PREDICTED: gephyrin-like isoform X1 [Astyanax mexicanus]
Length=853

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVL++D+ A D LPP+PAS+KDGYAV ++D
Sbjct  406  LTSMDKAFITVLEMTSVLGTEIINYRDGMGRVLSQDVYAKDNLPPFPASVKDGYAVRAAD  465

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  466  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  524

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  525  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  584

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  585  AVMSTGNELLNPE  597



>ref|XP_003446336.1| PREDICTED: gephyrin-like isoformX2 [Oreochromis niloticus]
 ref|XP_004550513.1| PREDICTED: gephyrin-like isoform X2 [Maylandia zebra]
 ref|XP_005731176.1| PREDICTED: gephyrin-like isoform X2 [Pundamilia nyererei]
 ref|XP_006792663.1| PREDICTED: gephyrin-like isoform X2 [Neolamprologus brichardi]
Length=794

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  560  AVMSTGNELLNPE  572



>ref|XP_005803169.1| PREDICTED: gephyrin-like isoform X3 [Xiphophorus maculatus]
Length=781

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  367  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  426

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  427  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  485

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  486  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  545

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  546  AVMSTGNELLNPE  558



>ref|XP_009210017.1| PREDICTED: gephyrin isoform X8 [Papio anubis]
Length=513

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  286  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  345

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  346  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  404

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  405  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  464

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  465  AVMSTGNELLNPE  477



>ref|XP_004550515.1| PREDICTED: gephyrin-like isoform X4 [Maylandia zebra]
 ref|XP_005475056.1| PREDICTED: gephyrin-like isoform X5 [Oreochromis niloticus]
 ref|XP_005731178.1| PREDICTED: gephyrin-like isoform X4 [Pundamilia nyererei]
 ref|XP_006792665.1| PREDICTED: gephyrin-like isoform X4 [Neolamprologus brichardi]
Length=776

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  362  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  421

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  422  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  480

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  481  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  540

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  541  AVMSTGNELLNPE  553



>gb|KFO14003.1| Gephyrin, partial [Balearica regulorum gibbericeps]
 gb|KFP32347.1| Gephyrin, partial [Colius striatus]
 gb|KFP83166.1| Gephyrin, partial [Apaloderma vittatum]
Length=449

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  36   LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  95

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  96   GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  154

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  155  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  214

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  215  AVMSTGNELLNPE  227



>ref|XP_007244718.1| PREDICTED: gephyrin-like isoform X2 [Astyanax mexicanus]
Length=832

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVL++D+ A D LPP+PAS+KDGYAV ++D
Sbjct  385  LTSMDKAFITVLEMTSVLGTEIINYRDGMGRVLSQDVYAKDNLPPFPASVKDGYAVRAAD  444

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  445  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  503

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  504  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  563

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  564  AVMSTGNELLNPE  576



>ref|XP_005803167.1| PREDICTED: gephyrin-like isoform X1 [Xiphophorus maculatus]
Length=795

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  560  AVMSTGNELLNPE  572



>ref|XP_009210013.1| PREDICTED: gephyrin isoform X4 [Papio anubis]
Length=530

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  303  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  362

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  363  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  421

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  422  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  481

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  482  AVMSTGNELLNPE  494



>ref|XP_008311619.1| PREDICTED: gephyrin isoform X1 [Cynoglossus semilaevis]
Length=795

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  560  AVMSTGNELLNPE  572



>ref|XP_008311620.1| PREDICTED: gephyrin isoform X2 [Cynoglossus semilaevis]
Length=794

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  560  AVMSTGNELLNPE  572



>ref|XP_005803168.1| PREDICTED: gephyrin-like isoform X2 [Xiphophorus maculatus]
Length=794

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  560  AVMSTGNELLNPE  572



>ref|XP_007244721.1| PREDICTED: gephyrin-like isoform X5 [Astyanax mexicanus]
Length=807

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVL++D+ A D LPP+PAS+KDGYAV ++D
Sbjct  360  LTSMDKAFITVLEMTSVLGTEIINYRDGMGRVLSQDVYAKDNLPPFPASVKDGYAVRAAD  419

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  420  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  478

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  479  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  538

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  539  AVMSTGNELLNPE  551



>ref|XP_009877102.1| PREDICTED: gephyrin, partial [Apaloderma vittatum]
 ref|XP_010201745.1| PREDICTED: gephyrin, partial [Colius striatus]
 ref|XP_010307063.1| PREDICTED: gephyrin, partial [Balearica regulorum gibbericeps]
Length=457

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  44   LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  103

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  104  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  162

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  163  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  222

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  223  AVMSTGNELLNPE  235



>pdb|2FTS|A Chain A, Crystal Structure Of The Glycine Receptor-Gephyrin Complex
 pdb|2FU3|A Chain A, Crystal Structure Of Gephyrin E-Domain
 pdb|2FU3|B Chain B, Crystal Structure Of Gephyrin E-Domain
 pdb|4PD0|A Chain A, 1.7 A Resolution Structure Of Gephyrin's E-domain
 pdb|4PD1|A Chain A, Structure Of Gephyrin E Domain With Glycine-beta Receptor 
Peptide
 pdb|4U90|A Chain A, Gephe In Complex With Peg Crosslinked Gaba Receptor 
Alpha3 Subunit Derived Dimeric Peptide
 pdb|4U91|A Chain A, Gephe In Complex With Para-phenyl Crosslinked Glycine 
Receptor Beta Subunit Derived Dimeric Peptide
Length=419

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  6    LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  65

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  66   GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  124

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  125  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  184

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  185  AVMSTGNELLNPE  197



>ref|XP_006792666.1| PREDICTED: gephyrin-like isoform X5 [Neolamprologus brichardi]
Length=756

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  342  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  401

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  402  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  460

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  461  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  520

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  521  AVMSTGNELLNPE  533



>pdb|1T3E|A Chain A, Structural Basis Of Dynamic Glycine Receptor Clustering
 pdb|1T3E|B Chain B, Structural Basis Of Dynamic Glycine Receptor Clustering
Length=421

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  8    LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  67

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  68   GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  126

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  127  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  186

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  187  AVMSTGNELLNPE  199



>ref|XP_004908029.1| PREDICTED: gephyrin, partial [Heterocephalus glaber]
Length=433

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  20   LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  79

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  80   GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  138

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  139  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  198

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  199  AVMSTGNELLNPE  211



>ref|XP_009210010.1| PREDICTED: gephyrin isoform X1 [Papio anubis]
Length=549

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  322  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  381

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  382  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  440

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  441  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  500

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  501  AVMSTGNELLNPE  513



>ref|XP_008274970.1| PREDICTED: gephyrin [Stegastes partitus]
Length=736

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_005803171.1| PREDICTED: gephyrin-like isoform X5 [Xiphophorus maculatus]
Length=736

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_003446335.1| PREDICTED: gephyrin-like isoformX1 [Oreochromis niloticus]
 ref|XP_004550516.1| PREDICTED: gephyrin-like isoform X5 [Maylandia zebra]
 ref|XP_005731180.1| PREDICTED: gephyrin-like isoform X6 [Pundamilia nyererei]
Length=736

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>gb|KFQ75480.1| Gephyrin, partial [Phaethon lepturus]
Length=528

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  302  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  361

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  362  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  420

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  421  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  480

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  481  AVMSTGNELLNPE  493



>ref|XP_005803170.1| PREDICTED: gephyrin-like isoform X4 [Xiphophorus maculatus]
Length=776

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  362  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  421

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  422  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  480

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  481  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  540

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  541  AVMSTGNELLNPE  553



>ref|XP_009210011.1| PREDICTED: gephyrin isoform X2 [Papio anubis]
Length=536

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  309  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  368

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  369  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  427

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  428  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  487

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  488  AVMSTGNELLNPE  500



>ref|XP_010285902.1| PREDICTED: gephyrin, partial [Phaethon lepturus]
Length=530

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  304  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  363

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  364  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  422

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  423  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  482

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  483  AVMSTGNELLNPE  495



>ref|XP_008311622.1| PREDICTED: gephyrin isoform X4 [Cynoglossus semilaevis]
Length=736

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_007545537.1| PREDICTED: gephyrin isoform X3 [Poecilia formosa]
Length=744

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  330  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  389

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  390  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  448

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  449  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  508

Query  596  AVLSTGDELVEPE  634
            A++STG+EL+ PE
Sbjct  509  AIMSTGNELLNPE  521



>ref|XP_007545531.1| PREDICTED: gephyrin isoform X2 [Poecilia formosa]
Length=781

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  367  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  426

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  427  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  485

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  486  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  545

Query  596  AVLSTGDELVEPE  634
            A++STG+EL+ PE
Sbjct  546  AIMSTGNELLNPE  558



>emb|CAG03546.1| unnamed protein product [Tetraodon nigroviridis]
Length=877

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 131/199 (66%), Gaps = 9/199 (5%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  369  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  428

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN---  412
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +   
Sbjct  429  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDLLG  487

Query  413  -----ESKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQV  577
                 E  +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V
Sbjct  488  GFQGTEELEVRILVQVRPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEV  547

Query  578  YPTPTIAVLSTGDELVEPE  634
            +  P IAV+STG+EL+ PE
Sbjct  548  HKFPVIAVMSTGNELLNPE  566



>ref|XP_008395695.1| PREDICTED: gephyrin isoform X2 [Poecilia reticulata]
Length=866

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  448  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  507

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  508  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  566

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  567  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  626

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  627  AVMSTGNELLNPE  639



>ref|XP_008395694.1| PREDICTED: gephyrin isoform X1 [Poecilia reticulata]
Length=867

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  448  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  507

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  508  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  566

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  567  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  626

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  627  AVMSTGNELLNPE  639



>ref|XP_008395696.1| PREDICTED: gephyrin isoform X3 [Poecilia reticulata]
Length=862

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  448  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  507

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  508  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  566

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  567  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  626

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  627  AVMSTGNELLNPE  639



>ref|XP_008395697.1| PREDICTED: gephyrin isoform X4 [Poecilia reticulata]
Length=861

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  448  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  507

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  508  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  566

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  567  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  626

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  627  AVMSTGNELLNPE  639



>ref|XP_008395699.1| PREDICTED: gephyrin isoform X6 [Poecilia reticulata]
Length=848

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  434  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  493

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  494  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  552

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  553  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  612

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  613  AVMSTGNELLNPE  625



>ref|XP_008395703.1| PREDICTED: gephyrin isoform X10 [Poecilia reticulata]
Length=809

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  390  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  449

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  450  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  508

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  509  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  568

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  569  AVMSTGNELLNPE  581



>ref|XP_008395701.1| PREDICTED: gephyrin isoform X8 [Poecilia reticulata]
Length=842

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  423  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  482

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  483  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  541

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  542  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  601

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  602  AVMSTGNELLNPE  614



>ref|XP_008395698.1| PREDICTED: gephyrin isoform X5 [Poecilia reticulata]
Length=853

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  434  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  493

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  494  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  552

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  553  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  612

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  613  AVMSTGNELLNPE  625



>ref|XP_007886279.1| PREDICTED: gephyrin isoform X1 [Callorhinchus milii]
Length=819

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  393  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVFAKDNLPPFPASVKDGYAVRAAD  452

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQ+E+TEL+ ++ +  E
Sbjct  453  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQIEDTELIRESDDGTE  511

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  512  ELEVRILTQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  571

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  572  AVMSTGNELLNPE  584



>dbj|BAI68423.1| gephyrin1 isoform [Danio rerio]
Length=795

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  382  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  441

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG     + V PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  442  GPGDRFIIGESQAGEQPT-LTVMPGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  500

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  501  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  560

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  561  AVMSTGNELLNPE  573



>ref|XP_007886280.1| PREDICTED: gephyrin isoform X2 [Callorhinchus milii]
Length=771

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  358  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVFAKDNLPPFPASVKDGYAVRAAD  417

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQ+E+TEL+ ++ +  E
Sbjct  418  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQIEDTELIRESDDGTE  476

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  477  ELEVRILTQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  536

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  537  AVMSTGNELLNPE  549



>ref|XP_008395704.1| PREDICTED: gephyrin isoform X11 [Poecilia reticulata]
Length=803

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  390  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  449

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  450  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  508

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  509  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  568

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  569  AVMSTGNELLNPE  581



>ref|XP_008395702.1| PREDICTED: gephyrin isoform X9 [Poecilia reticulata]
Length=834

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  415  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  474

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  475  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  533

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  534  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  593

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  594  AVMSTGNELLNPE  606



>ref|XP_007545524.1| PREDICTED: gephyrin isoform X1 [Poecilia formosa]
Length=794

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  381  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  440

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  441  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  499

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  500  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  559

Query  596  AVLSTGDELVEPE  634
            A++STG+EL+ PE
Sbjct  560  AIMSTGNELLNPE  572



>ref|XP_008395700.1| PREDICTED: gephyrin isoform X7 [Poecilia reticulata]
Length=848

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  429  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  488

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  489  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  547

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  548  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  607

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  608  AVMSTGNELLNPE  620



>ref|XP_007545554.1| PREDICTED: gephyrin isoform X5 [Poecilia formosa]
Length=736

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            A++STG+EL+ PE
Sbjct  502  AIMSTGNELLNPE  514



>dbj|BAI68421.1| gephyrin1 [Danio rerio]
Length=735

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  322  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  381

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG     + V PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  382  GPGDRFIIGESQAGEQPT-LTVMPGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  440

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  441  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  500

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  501  AVMSTGNELLNPE  513



>ref|XP_010895559.1| PREDICTED: gephyrin-like [Esox lucius]
Length=796

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  383  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  442

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  443  GPGDRFIIGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  501

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  502  ELEVRILVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVV  561

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  562  AVMSTGNELLNPE  574



>ref|XP_007545546.1| PREDICTED: gephyrin isoform X4 [Poecilia formosa]
Length=737

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            A++STG+EL+ PE
Sbjct  502  AIMSTGNELLNPE  514



>emb|CDQ60441.1| unnamed protein product [Oncorhynchus mykiss]
Length=445

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 126/187 (67%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   IVLSVAQRLPPVSVPLH---QALGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYP  259
             +L  +    P  +  +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++DGPG   
Sbjct  8    FLLCFSLSFSPFFILFYPTVDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRF  67

Query  260  IITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--ESKQVRI  433
            II ES+AG      V+ PG V  VTTG P+P GADAVVQVE+TELL ++ +  E  +VRI
Sbjct  68   IIGESQAGQQPTHTVM-PGQVMRVTTGAPVPCGADAVVQVEDTELLRESDDGTEELEVRI  126

Query  434  LKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTG  613
            L    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +AV+STG
Sbjct  127  LVQARPGQDIRPIGHDIKRGECVLSKGTHMGPSEIGLLATVGVTEVEVQKFPVVAVMSTG  186

Query  614  DELVEPE  634
            +EL+ PE
Sbjct  187  NELLNPE  193



>ref|NP_001170915.1| gephyrin [Danio rerio]
 dbj|BAI68424.1| gephyrin1 isoform [Danio rerio]
Length=834

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  421  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  480

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG     + V PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  481  GPGDRFIIGESQAGEQPT-LTVMPGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  539

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  540  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  599

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  600  AVMSTGNELLNPE  612



>ref|XP_009910881.1| PREDICTED: gephyrin [Haliaeetus albicilla]
Length=386

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  LGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVA  325
            +GRVLA+D+ A D LPP+PAS+KDGYAV ++DGPG   II ES+AG      V+ PG V 
Sbjct  1    MGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVM-PGQVM  59

Query  326  YVTTGGPIPDGADAVVQVENTELLLDASN--ESKQVRILKGTGPGVDIRPVGSDIAKGDV  499
             VTTG PIP GADAVVQVE+TEL+ ++ +  E  +VRIL    PG DIRP+G DI +G+ 
Sbjct  60   RVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGEC  119

Query  500  VLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPE  634
            VL  G H+G  EIGLLATVGVT V+V   P +AV+STG+EL+ PE
Sbjct  120  VLAKGTHMGPSEIGLLATVGVTEVEVNKFPVVAVMSTGNELLNPE  164



>dbj|BAI68422.1| gephyrin1 isoform [Danio rerio]
Length=774

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  361  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  420

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG     + V PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  421  GPGDRFIIGESQAGEQPT-LTVMPGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  479

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  480  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  539

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  540  AVMSTGNELLNPE  552



>ref|XP_006632748.1| PREDICTED: gephyrin-like [Lepisosteus oculatus]
Length=736

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTPVLSTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  383  GPGDRFIIGESQAGEQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  442  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVQKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_008863031.1| hypothetical protein, variant 18 [Aphanomyces invadans]
 gb|ETW09226.1| hypothetical protein, variant 18 [Aphanomyces invadans]
Length=453

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    A++ VL +A+ L   SVPL +ALG VLAE + + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMQRAIDTVLGLAKPLLKTSVPLQEALGSVLAETVRSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L    +++
Sbjct  79   GVGEFPILSRVAAG-DAPGVHVTPGRVAYVTTGCPVPDGADAVVKIEDTEAVLGEDGKTE  137

Query  422  -QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              V+IL     G  IRP+G DIA+G+V++++GE +    +GLLATVG+  V +Y  P + 
Sbjct  138  VAVKILHAVQSGTSIRPIGHDIAQGEVIVEAGEVITPAVLGLLATVGIASVPIYKIPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_005812094.1| PREDICTED: gephyrin-like [Xiphophorus maculatus]
Length=736

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFILGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  442  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>gb|KFP96091.1| Gephyrin, partial [Haliaeetus albicilla]
Length=393

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  LGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVA  325
            +GRVLA+D+ A D LPP+PAS+KDGYAV ++DGPG   II ES+AG      V+ PG V 
Sbjct  8    MGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVM-PGQVM  66

Query  326  YVTTGGPIPDGADAVVQVENTELLLDASN--ESKQVRILKGTGPGVDIRPVGSDIAKGDV  499
             VTTG PIP GADAVVQVE+TEL+ ++ +  E  +VRIL    PG DIRP+G DI +G+ 
Sbjct  67   RVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGEC  126

Query  500  VLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPE  634
            VL  G H+G  EIGLLATVGVT V+V   P +AV+STG+EL+ PE
Sbjct  127  VLAKGTHMGPSEIGLLATVGVTEVEVNKFPVVAVMSTGNELLNPE  171



>ref|NP_001085376.1| MGC83148 protein [Xenopus laevis]
 gb|AAH71153.1| MGC83148 protein [Xenopus laevis]
Length=860

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+++ A D LPP+PAS+KDGYAV ++D
Sbjct  447  LTSMDKAFITVLEMTAVLGTEIINYRDGMGRVLAQEVYAKDNLPPFPASVKDGYAVRAAD  506

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  507  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESDDGTE  565

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V+  P +
Sbjct  566  ELEVRILVQVRPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVHKFPVV  625

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  626  AVMSTGNELLNPE  638



>ref|XP_008574539.1| PREDICTED: gephyrin, partial [Galeopterus variegatus]
Length=387

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  LGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVA  325
            +GRVLA+D+ A D LPP+PAS+KDGYAV ++DGPG   II ES+AG      V+ PG V 
Sbjct  2    MGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVM-PGQVM  60

Query  326  YVTTGGPIPDGADAVVQVENTELLLDASN--ESKQVRILKGTGPGVDIRPVGSDIAKGDV  499
             VTTG PIP GADAVVQVE+TEL+ ++ +  E  +VRIL    PG DIRP+G DI +G+ 
Sbjct  61   RVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGEC  120

Query  500  VLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPE  634
            VL  G H+G  EIGLLATVGVT V+V   P +AV+STG+EL+ PE
Sbjct  121  VLAKGTHMGPSEIGLLATVGVTEVEVNKFPVVAVMSTGNELLNPE  165



>ref|XP_006760165.1| PREDICTED: gephyrin-like, partial [Myotis davidii]
Length=630

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  404  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  463

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  464  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  522

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  523  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  582

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  583  AVMSTGNELLNPE  595



>ref|XP_008863027.1| hypothetical protein, variant 14 [Aphanomyces invadans]
 ref|XP_008863028.1| hypothetical protein, variant 15 [Aphanomyces invadans]
 ref|XP_008863029.1| hypothetical protein, variant 16 [Aphanomyces invadans]
 ref|XP_008863030.1| hypothetical protein, variant 17 [Aphanomyces invadans]
 gb|ETW09222.1| hypothetical protein, variant 14 [Aphanomyces invadans]
 gb|ETW09223.1| hypothetical protein, variant 15 [Aphanomyces invadans]
 gb|ETW09224.1| hypothetical protein, variant 16 [Aphanomyces invadans]
 gb|ETW09225.1| hypothetical protein, variant 17 [Aphanomyces invadans]
Length=482

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    A++ VL +A+ L   SVPL +ALG VLAE + + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMQRAIDTVLGLAKPLLKTSVPLQEALGSVLAETVRSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L    +++
Sbjct  79   GVGEFPILSRVAAG-DAPGVHVTPGRVAYVTTGCPVPDGADAVVKIEDTEAVLGEDGKTE  137

Query  422  -QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              V+IL     G  IRP+G DIA+G+V++++GE +    +GLLATVG+  V +Y  P + 
Sbjct  138  VAVKILHAVQSGTSIRPIGHDIAQGEVIVEAGEVITPAVLGLLATVGIASVPIYKIPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_011489073.1| PREDICTED: gephyrin-like [Oryzias latipes]
Length=644

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  231  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  290

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  291  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  349

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  350  ELEVRIMVQVRPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  409

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  410  AVMSTGNELLNPE  422



>ref|XP_008863025.1| hypothetical protein, variant 12 [Aphanomyces invadans]
 ref|XP_008863026.1| hypothetical protein, variant 13 [Aphanomyces invadans]
 gb|ETW09220.1| hypothetical protein, variant 12 [Aphanomyces invadans]
 gb|ETW09221.1| hypothetical protein, variant 13 [Aphanomyces invadans]
Length=484

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    A++ VL +A+ L   SVPL +ALG VLAE + + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMQRAIDTVLGLAKPLLKTSVPLQEALGSVLAETVRSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L    +++
Sbjct  79   GVGEFPILSRVAAG-DAPGVHVTPGRVAYVTTGCPVPDGADAVVKIEDTEAVLGEDGKTE  137

Query  422  -QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              V+IL     G  IRP+G DIA+G+V++++GE +    +GLLATVG+  V +Y  P + 
Sbjct  138  VAVKILHAVQSGTSIRPIGHDIAQGEVIVEAGEVITPAVLGLLATVGIASVPIYKIPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_010795752.1| PREDICTED: gephyrin-like [Notothenia coriiceps]
Length=690

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  352  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  411

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  412  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  470

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  471  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  530

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  531  AVMSTGNELLNPE  543



>ref|XP_007575455.1| PREDICTED: gephyrin-like isoform X2 [Poecilia formosa]
Length=736

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  323  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  382

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  383  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  441

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  442  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  501

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  502  AVMSTGNELLNPE  514



>ref|XP_007640584.1| PREDICTED: gephyrin isoform X2, partial [Cricetulus griseus]
Length=563

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  337  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  396

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  397  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  455

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  456  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  515

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  516  AVMSTGNELLNPE  528



>ref|XP_006891897.1| PREDICTED: gephyrin-like, partial [Elephantulus edwardii]
Length=650

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  369  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  428

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  429  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  487

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  488  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  547

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  548  AVMSTGNELLNPE  560



>ref|XP_008863024.1| hypothetical protein, variant 11 [Aphanomyces invadans]
 gb|ETW09219.1| hypothetical protein, variant 11 [Aphanomyces invadans]
Length=522

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    A++ VL +A+ L   SVPL +ALG VLAE + + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMQRAIDTVLGLAKPLLKTSVPLQEALGSVLAETVRSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L    +++
Sbjct  79   GVGEFPILSRVAAG-DAPGVHVTPGRVAYVTTGCPVPDGADAVVKIEDTEAVLGEDGKTE  137

Query  422  -QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              V+IL     G  IRP+G DIA+G+V++++GE +    +GLLATVG+  V +Y  P + 
Sbjct  138  VAVKILHAVQSGTSIRPIGHDIAQGEVIVEAGEVITPAVLGLLATVGIASVPIYKIPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_006873126.1| PREDICTED: gephyrin-like [Chrysochloris asiatica]
Length=568

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  155  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  214

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  215  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  273

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  274  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  333

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  334  AVMSTGNELLNPE  346



>ref|XP_008863018.1| hypothetical protein, variant 9 [Aphanomyces invadans]
 ref|XP_008863023.1| hypothetical protein, variant 10 [Aphanomyces invadans]
 gb|ETW09217.1| hypothetical protein, variant 9 [Aphanomyces invadans]
 gb|ETW09218.1| hypothetical protein, variant 10 [Aphanomyces invadans]
Length=524

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    A++ VL +A+ L   SVPL +ALG VLAE + + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMQRAIDTVLGLAKPLLKTSVPLQEALGSVLAETVRSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L    +++
Sbjct  79   GVGEFPILSRVAAG-DAPGVHVTPGRVAYVTTGCPVPDGADAVVKIEDTEAVLGEDGKTE  137

Query  422  -QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              V+IL     G  IRP+G DIA+G+V++++GE +    +GLLATVG+  V +Y  P + 
Sbjct  138  VAVKILHAVQSGTSIRPIGHDIAQGEVIVEAGEVITPAVLGLLATVGIASVPIYKIPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_005461955.1| PREDICTED: gephyrin-like isoform X3 [Oreochromis niloticus]
Length=803

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  390  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  449

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  450  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  508

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  509  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  568

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  569  AVMSTGNELLNPE  581



>ref|XP_010743432.1| PREDICTED: gephyrin-like isoform X1 [Larimichthys crocea]
Length=778

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  365  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  424

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  425  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  483

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  484  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  543

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  544  AVMSTGNELLNPE  556



>ref|XP_010743433.1| PREDICTED: gephyrin-like isoform X2 [Larimichthys crocea]
Length=744

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  331  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  390

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  391  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  449

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  450  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  509

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  510  AVMSTGNELLNPE  522



>ref|XP_008301210.1| PREDICTED: gephyrin-like [Stegastes partitus]
Length=779

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  366  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  425

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  426  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  484

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  485  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  544

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  545  AVMSTGNELLNPE  557



>ref|XP_007985214.1| PREDICTED: gephyrin isoform X25 [Chlorocebus sabaeus]
Length=694

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  447  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  506

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  507  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  565

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  566  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  625

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  626  AVMSTGNELLNPE  638



>ref|XP_008314898.1| PREDICTED: gephyrin-like isoform X3 [Cynoglossus semilaevis]
Length=750

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  337  LTSMDKAFITVLEMTPILGIEVINYRAGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  396

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  397  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  455

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  456  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  515

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  516  AVMSTGNELLNPE  528



>ref|XP_005751787.1| PREDICTED: gephyrin-like isoform X2 [Pundamilia nyererei]
Length=738

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  325  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  384

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  385  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  443

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  444  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  503

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  504  AVMSTGNELLNPE  516



>gb|KFQ07278.1| Gephyrin, partial [Leptosomus discolor]
Length=610

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  197  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  256

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  257  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  315

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  316  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  375

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  376  AVMSTGNELLNPE  388



>ref|XP_008314882.1| PREDICTED: gephyrin-like isoform X1 [Cynoglossus semilaevis]
Length=674

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  LGRVLAEDITAPDPLPPYPASIKDGYAVVSSDGPGVYPIITESRAGNDGLGVVVTPGTVA  325
            LGRVLA+DI A D LPP+PAS+KDGYAV ++DGPG   I+ ES+AG      V+ PG V 
Sbjct  289  LGRVLAQDIYAKDNLPPFPASVKDGYAVRAADGPGDRFIMGESQAGQQPTHTVM-PGQVM  347

Query  326  YVTTGGPIPDGADAVVQVENTELLLDASN--ESKQVRILKGTGPGVDIRPVGSDIAKGDV  499
             VTTG PIP GADAVVQVE+TELL ++ +  E  +VRI+    PG DIRP+G DI +G+ 
Sbjct  348  RVTTGAPIPCGADAVVQVEDTELLRESEDGTEELEVRIMVQARPGQDIRPIGHDIRRGEC  407

Query  500  VLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIAVLSTGDELVEPE  634
            VL  G H+G  EIGLLATVGVT V V+  P +AV+STG+EL+ PE
Sbjct  408  VLAKGTHMGPSEIGLLATVGVTEVSVHKFPVVAVMSTGNELLNPE  452



>ref|XP_007575454.1| PREDICTED: gephyrin-like isoform X1 [Poecilia formosa]
Length=766

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  353  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  412

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  413  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  471

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  472  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  531

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  532  AVMSTGNELLNPE  544



>ref|XP_008863015.1| hypothetical protein, variant 6 [Aphanomyces invadans]
 ref|XP_008863016.1| hypothetical protein, variant 7 [Aphanomyces invadans]
 gb|ETW09214.1| hypothetical protein, variant 6 [Aphanomyces invadans]
 gb|ETW09215.1| hypothetical protein, variant 7 [Aphanomyces invadans]
Length=562

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    A++ VL +A+ L   SVPL +ALG VLAE + + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMQRAIDTVLGLAKPLLKTSVPLQEALGSVLAETVRSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L    +++
Sbjct  79   GVGEFPILSRVAAG-DAPGVHVTPGRVAYVTTGCPVPDGADAVVKIEDTEAVLGEDGKTE  137

Query  422  -QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              V+IL     G  IRP+G DIA+G+V++++GE +    +GLLATVG+  V +Y  P + 
Sbjct  138  VAVKILHAVQSGTSIRPIGHDIAQGEVIVEAGEVITPAVLGLLATVGIASVPIYKIPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>ref|XP_004055367.1| PREDICTED: gephyrin, partial [Gorilla gorilla gorilla]
Length=639

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  226  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  285

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  286  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  344

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  345  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  404

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  405  AVMSTGNELLNPE  417



>ref|XP_005942199.1| PREDICTED: gephyrin-like isoform X2 [Haplochromis burtoni]
Length=785

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  372  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  431

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  432  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  490

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  491  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  550

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  551  AVMSTGNELLNPE  563



>ref|XP_004649707.1| PREDICTED: gephyrin [Jaculus jaculus]
Length=782

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  356  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  415

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  416  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  474

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  475  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  534

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  535  AVMSTGNELLNPE  547



>ref|XP_008863019.1| hypothetical protein, variant 4 [Aphanomyces invadans]
 gb|ETW09212.1| hypothetical protein, variant 4 [Aphanomyces invadans]
Length=602

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            M+    A++ VL +A+ L   SVPL +ALG VLAE + + +PLPP+ AS+ DGYAVV+SD
Sbjct  19   MIPMQRAIDTVLGLAKPLLKTSVPLQEALGSVLAETVRSKEPLPPFRASVMDGYAVVASD  78

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASNESK  421
            G G +PI++   AG D  GV VTPG VAYVTTG P+PDGADAVV++E+TE +L    +++
Sbjct  79   GVGEFPILSRVAAG-DAPGVHVTPGRVAYVTTGCPVPDGADAVVKIEDTEAVLGEDGKTE  137

Query  422  -QVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTIA  598
              V+IL     G  IRP+G DIA+G+V++++GE +    +GLLATVG+  V +Y  P + 
Sbjct  138  VAVKILHAVQSGTSIRPIGHDIAQGEVIVEAGEVITPAVLGLLATVGIASVPIYKIPVVG  197

Query  599  VLSTGDELVE  628
            VLSTG ELV+
Sbjct  198  VLSTGSELVD  207



>gb|KFV15625.1| Gephyrin, partial [Pterocles gutturalis]
Length=639

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  226  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  285

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  286  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  344

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  345  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  404

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  405  AVMSTGNELLNPE  417



>ref|XP_010219094.1| PREDICTED: gephyrin isoform X9 [Tinamus guttatus]
Length=799

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  362  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  421

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  422  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  480

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  481  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  540

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  541  AVMSTGNELLNPE  553



>ref|XP_004569994.1| PREDICTED: gephyrin-like [Maylandia zebra]
Length=777

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  364  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  423

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  424  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  482

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  483  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  542

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  543  AVMSTGNELLNPE  555



>ref|XP_005751786.1| PREDICTED: gephyrin-like isoform X1 [Pundamilia nyererei]
Length=784

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  371  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  430

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  431  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  489

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  490  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  549

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  550  AVMSTGNELLNPE  562



>ref|XP_005461956.1| PREDICTED: gephyrin-like isoform X4 [Oreochromis niloticus]
Length=784

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     LGRVLA+DI A D LPP+PAS+KDGYAV ++D
Sbjct  371  LTSMDKAFITVLEMTPILGIEVINYRDGLGRVLAQDIYAKDNLPPFPASVKDGYAVRAAD  430

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   I+ ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TELL ++ +  E
Sbjct  431  GPGDRFIMGESQAGQQPTHTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELLRESEDGTE  489

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRI+    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V V+  P +
Sbjct  490  ELEVRIMVQARPGQDIRPIGHDIRRGECVLAKGTHMGPSEIGLLATVGVTEVSVHKFPVV  549

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  550  AVMSTGNELLNPE  562



>ref|XP_009004421.1| PREDICTED: gephyrin isoform X8 [Callithrix jacchus]
Length=779

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  366  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  425

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  426  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  484

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  485  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  544

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  545  AVMSTGNELLNPE  557



>ref|XP_010389401.1| PREDICTED: gephyrin isoform X22 [Corvus cornix cornix]
Length=727

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  314  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  373

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  374  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  432

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  433  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  492

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  493  AVMSTGNELLNPE  505



>ref|XP_007985213.1| PREDICTED: gephyrin isoform X24 [Chlorocebus sabaeus]
Length=722

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  309  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  368

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  369  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  427

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  428  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  487

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  488  AVMSTGNELLNPE  500



>gb|KFP67249.1| Gephyrin, partial [Cariama cristata]
 gb|KGL81544.1| Gephyrin, partial [Tinamus guttatus]
Length=671

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  258  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  317

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  318  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  376

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  377  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  436

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  437  AVMSTGNELLNPE  449



>ref|XP_008698917.1| PREDICTED: gephyrin isoform X4 [Ursus maritimus]
Length=715

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  302  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  361

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  362  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  420

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  421  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  480

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  481  AVMSTGNELLNPE  493



>ref|XP_008137162.1| PREDICTED: gephyrin isoform X5 [Eptesicus fuscus]
Length=705

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  292  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  351

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  352  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  410

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  411  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  470

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  471  AVMSTGNELLNPE  483



>ref|XP_007054326.1| PREDICTED: gephyrin [Chelonia mydas]
Length=659

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  246  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  305

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  306  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  364

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  365  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  424

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  425  AVMSTGNELLNPE  437



>gb|KFM10386.1| Gephyrin, partial [Aptenodytes forsteri]
 gb|KFW65002.1| Gephyrin, partial [Pygoscelis adeliae]
Length=715

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  302  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  361

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  362  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  420

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  421  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  480

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  481  AVMSTGNELLNPE  493



>gb|EMC83799.1| Gephyrin, partial [Columba livia]
 gb|KFO63660.1| Gephyrin, partial [Corvus brachyrhynchos]
 gb|KFO70207.1| Gephyrin, partial [Cuculus canorus]
 gb|KFP12096.1| Gephyrin, partial [Egretta garzetta]
 gb|KFQ25905.1| Gephyrin, partial [Merops nubicus]
 gb|KFR07001.1| Gephyrin, partial [Opisthocomus hoazin]
 gb|KFU85216.1| Gephyrin, partial [Chaetura pelagica]
 gb|KFV74218.1| Gephyrin, partial [Picoides pubescens]
 gb|KFV78222.1| Gephyrin, partial [Struthio camelus australis]
 gb|KFV97138.1| Gephyrin, partial [Fulmarus glacialis]
 gb|KGL92034.1| Gephyrin, partial [Charadrius vociferus]
Length=715

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  302  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  361

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  362  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  420

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  421  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  480

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  481  AVMSTGNELLNPE  493



>dbj|BAH12583.1| unnamed protein product [Homo sapiens]
Length=705

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  292  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  351

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  352  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  410

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  411  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  470

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  471  AVMSTGNELLNPE  483



>gb|ACE06970.1| gephyrin isoform [Rattus norvegicus]
Length=730

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (2%)
 Frame = +2

Query  62   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYPASIKDGYAVVSSD  241
            + S ++A   VL +   L    +     +GRVLA+D+ A D LPP+PAS+KDGYAV ++D
Sbjct  317  LTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAAD  376

Query  242  GPGVYPIITESRAGNDGLGVVVTPGTVAYVTTGGPIPDGADAVVQVENTELLLDASN--E  415
            GPG   II ES+AG      V+ PG V  VTTG PIP GADAVVQVE+TEL+ ++ +  E
Sbjct  377  GPGDRFIIGESQAGEQPTQTVM-PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTE  435

Query  416  SKQVRILKGTGPGVDIRPVGSDIAKGDVVLKSGEHLGAPEIGLLATVGVTIVQVYPTPTI  595
              +VRIL    PG DIRP+G DI +G+ VL  G H+G  EIGLLATVGVT V+V   P +
Sbjct  436  ELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVV  495

Query  596  AVLSTGDELVEPE  634
            AV+STG+EL+ PE
Sbjct  496  AVMSTGNELLNPE  508



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140