BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047N07

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353433.1|  PREDICTED: uncharacterized protein LOC102583...    190   3e-52   
ref|XP_006353432.1|  PREDICTED: uncharacterized protein LOC102583...    190   4e-52   Solanum tuberosum [potatoes]
ref|XP_009799471.1|  PREDICTED: uncharacterized protein LOC104245548    186   1e-50   Nicotiana sylvestris
ref|XP_009587726.1|  PREDICTED: uncharacterized protein LOC104085415    184   6e-50   Nicotiana tomentosiformis
ref|XP_004240914.1|  PREDICTED: uncharacterized protein LOC101246145    184   7e-50   Solanum lycopersicum
ref|XP_008369281.1|  PREDICTED: uncharacterized protein LOC103432852    161   1e-41   Malus domestica [apple tree]
ref|XP_007219560.1|  hypothetical protein PRUPE_ppa001281mg             160   2e-41   Prunus persica
ref|XP_009369204.1|  PREDICTED: uncharacterized protein LOC103958637    160   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_008233789.1|  PREDICTED: uncharacterized protein LOC103332812    159   3e-41   Prunus mume [ume]
ref|XP_011084883.1|  PREDICTED: uncharacterized protein LOC105167...    157   1e-40   Sesamum indicum [beniseed]
ref|XP_011084881.1|  PREDICTED: uncharacterized protein LOC105167...    157   3e-40   Sesamum indicum [beniseed]
ref|XP_011084880.1|  PREDICTED: uncharacterized protein LOC105167...    157   3e-40   Sesamum indicum [beniseed]
ref|XP_011084882.1|  PREDICTED: uncharacterized protein LOC105167...    152   5e-39   Sesamum indicum [beniseed]
gb|KGN45803.1|  hypothetical protein Csa_6G012280                       142   8e-38   Cucumis sativus [cucumbers]
gb|KDP44727.1|  hypothetical protein JCGZ_01227                         146   2e-36   Jatropha curcas
ref|XP_010658245.1|  PREDICTED: uncharacterized protein LOC100241...    145   6e-36   Vitis vinifera
ref|XP_010658247.1|  PREDICTED: uncharacterized protein LOC100241...    144   7e-36   Vitis vinifera
ref|XP_002273020.1|  PREDICTED: uncharacterized protein LOC100241...    144   7e-36   Vitis vinifera
ref|XP_010658246.1|  PREDICTED: uncharacterized protein LOC100241...    144   7e-36   Vitis vinifera
gb|KDO68900.1|  hypothetical protein CISIN_1g002690mg                   144   1e-35   Citrus sinensis [apfelsine]
gb|KDO68901.1|  hypothetical protein CISIN_1g002690mg                   144   1e-35   Citrus sinensis [apfelsine]
gb|KDO68902.1|  hypothetical protein CISIN_1g002690mg                   144   1e-35   Citrus sinensis [apfelsine]
ref|XP_006435779.1|  hypothetical protein CICLE_v10030686mg             144   2e-35   Citrus clementina [clementine]
emb|CAN60362.1|  hypothetical protein VITISV_024684                     143   2e-35   Vitis vinifera
gb|KDO68905.1|  hypothetical protein CISIN_1g002690mg                   140   3e-35   Citrus sinensis [apfelsine]
gb|KDO68904.1|  hypothetical protein CISIN_1g002690mg                   140   1e-34   Citrus sinensis [apfelsine]
ref|XP_004138414.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   2e-34   
gb|KDO68903.1|  hypothetical protein CISIN_1g002690mg                   140   2e-34   Citrus sinensis [apfelsine]
ref|XP_004307650.1|  PREDICTED: uncharacterized protein LOC101304420    135   1e-32   Fragaria vesca subsp. vesca
ref|XP_007008908.1|  UDP-glucose pyrophosphorylase 3 isoform 5          132   2e-32   
ref|XP_002315147.1|  hypothetical protein POPTR_0010s19320g             134   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007008904.1|  UDP-glucose pyrophosphorylase 3 isoform 1          132   1e-31   
ref|XP_007008907.1|  UDP-glucose pyrophosphorylase 3 isoform 4          132   2e-31   
ref|XP_007008905.1|  UDP-glucose pyrophosphorylase 3 isoform 2          132   2e-31   
ref|XP_007008906.1|  UDP-glucose pyrophosphorylase 3 isoform 3          132   2e-31   
ref|XP_008441479.1|  PREDICTED: UDP-sugar pyrophosphorylase             130   9e-31   Cucumis melo [Oriental melon]
ref|XP_011035907.1|  PREDICTED: uncharacterized protein LOC105133...    130   1e-30   Populus euphratica
ref|XP_011035906.1|  PREDICTED: uncharacterized protein LOC105133...    129   1e-30   Populus euphratica
ref|XP_010105428.1|  hypothetical protein L484_009896                   122   4e-30   
ref|XP_002528323.1|  conserved hypothetical protein                     127   1e-29   Ricinus communis
ref|XP_010693077.1|  PREDICTED: uncharacterized protein LOC104906066    123   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010536381.1|  PREDICTED: uncharacterized protein LOC104811372    123   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_010031181.1|  PREDICTED: uncharacterized protein LOC104421052    122   5e-28   Eucalyptus grandis [rose gum]
gb|KCW50445.1|  hypothetical protein EUGRSUZ_J00183                     122   5e-28   Eucalyptus grandis [rose gum]
gb|KJB74378.1|  hypothetical protein B456_011G291300                    122   7e-28   Gossypium raimondii
gb|KJB74379.1|  hypothetical protein B456_011G291300                    121   7e-28   Gossypium raimondii
ref|XP_006601947.1|  PREDICTED: uncharacterized protein LOC100788...    121   1e-27   Glycine max [soybeans]
ref|XP_003552278.1|  PREDICTED: uncharacterized protein LOC100788...    121   1e-27   Glycine max [soybeans]
ref|XP_010257086.1|  PREDICTED: uncharacterized protein LOC104597...    120   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010257084.1|  PREDICTED: uncharacterized protein LOC104597...    120   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010257085.1|  PREDICTED: uncharacterized protein LOC104597...    120   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010907871.1|  PREDICTED: uncharacterized protein LOC105034415    120   2e-27   Elaeis guineensis
ref|XP_004500507.1|  PREDICTED: uncharacterized protein LOC101505226    119   5e-27   
gb|KEH34804.1|  UDP-glucose pyrophosphorylase                           119   7e-27   Medicago truncatula
gb|KJB74377.1|  hypothetical protein B456_011G291300                    118   7e-27   Gossypium raimondii
ref|XP_003600957.1|  hypothetical protein MTR_3g071440                  119   8e-27   Medicago truncatula
ref|XP_009386480.1|  PREDICTED: uncharacterized protein LOC103973588    118   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008811680.1|  PREDICTED: uncharacterized protein LOC103722...    117   3e-26   
ref|XP_008811681.1|  PREDICTED: uncharacterized protein LOC103722...    117   3e-26   
ref|XP_008811677.1|  PREDICTED: uncharacterized protein LOC103722...    117   3e-26   
gb|KHG20503.1|  UDP-sugar pyrophospharylase                             117   4e-26   Gossypium arboreum [tree cotton]
ref|XP_007163567.1|  hypothetical protein PHAVU_001G2449000g            112   1e-24   Phaseolus vulgaris [French bean]
ref|XP_010554677.1|  PREDICTED: uncharacterized protein LOC104824329    112   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_010504480.1|  PREDICTED: uncharacterized protein LOC104781...    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010504481.1|  PREDICTED: uncharacterized protein LOC104781...    112   2e-24   Camelina sativa [gold-of-pleasure]
emb|CDX72178.1|  BnaC08g26960D                                          110   5e-24   
ref|XP_006403031.1|  hypothetical protein EUTSA_v10005783mg             110   5e-24   Eutrema salsugineum [saltwater cress]
ref|XP_006403032.1|  hypothetical protein EUTSA_v10005783mg             110   5e-24   Eutrema salsugineum [saltwater cress]
ref|XP_002878057.1|  hypothetical protein ARALYDRAFT_486043             110   7e-24   
emb|CDY66808.1|  BnaA09g55090D                                          108   2e-23   Brassica napus [oilseed rape]
ref|XP_010516200.1|  PREDICTED: uncharacterized protein LOC104791893    108   3e-23   Camelina sativa [gold-of-pleasure]
emb|CAB87858.1|  putative protein                                       107   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567031.1|  UDP-glucose pyrophosphorylase 3                       107   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116297.1|  PREDICTED: uncharacterized protein LOC103841...    107   9e-23   Brassica rapa
ref|XP_009116298.1|  PREDICTED: uncharacterized protein LOC103841...    107   1e-22   Brassica rapa
ref|XP_003538476.2|  PREDICTED: uncharacterized protein LOC100804...    107   1e-22   Glycine max [soybeans]
ref|XP_006591388.1|  PREDICTED: uncharacterized protein LOC100804...    107   1e-22   Glycine max [soybeans]
ref|XP_010427408.1|  PREDICTED: uncharacterized protein LOC104712253    106   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006292431.1|  hypothetical protein CARUB_v10018646mg             105   3e-22   Capsella rubella
gb|AAK68751.1|  putative protein                                        103   6e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34847.1|  hypothetical protein AALP_AA5G200800                    102   3e-21   Arabis alpina [alpine rockcress]
ref|XP_006847401.1|  hypothetical protein AMTR_s00153p00036670        90.1    6e-17   
gb|EEC79378.1|  hypothetical protein OsI_20285                        78.2    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008656383.1|  PREDICTED: uncharacterized protein LOC103635...  76.3    2e-12   
ref|XP_008656382.1|  PREDICTED: uncharacterized protein LOC103635...  76.3    2e-12   Zea mays [maize]
gb|AFW82285.1|  hypothetical protein ZEAMMB73_228026                  76.3    2e-12   
gb|EYU43434.1|  hypothetical protein MIMGU_mgv1a001986mg              73.9    1e-11   Erythranthe guttata [common monkey flower]
gb|KHN04776.1|  hypothetical protein glysoja_031876                   70.1    2e-10   Glycine soja [wild soybean]
gb|EPS63541.1|  hypothetical protein M569_11245                       63.2    5e-09   Genlisea aurea
gb|EEE64040.1|  hypothetical protein OsJ_18869                        64.3    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439938.1|  hypothetical protein SORBIDRAFT_09g023020        63.5    1e-08   
ref|NP_001055800.2|  Os05g0468600                                     63.9    2e-08   
gb|AAT47007.1|  unknown protein                                       63.9    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566160.2|  PREDICTED: UDP-sugar pyrophosphorylase           62.4    6e-08   Brachypodium distachyon [annual false brome]
dbj|BAJ85276.1|  predicted protein                                    61.2    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655397.1|  PREDICTED: UDP-sugar pyrophosphorylase-like      57.8    2e-06   Oryza brachyantha



>ref|XP_006353433.1| PREDICTED: uncharacterized protein LOC102583756 isoform X2 [Solanum 
tuberosum]
Length=838

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RV+TAPVEYVPPAPDFDFHKEI RLK L+S++ +C +L  RIRV+DSDSRV SFFYS 
Sbjct  66   LTRVTTAPVEYVPPAPDFDFHKEIARLKDLKSKLDNCTNLKDRIRVIDSDSRVNSFFYSH  125

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMIEK  560
             + FSR L  L+LDKYEVFLLKC+VAAGQ+HV G+   EFD+ RSSLKSA YALAEMI+ 
Sbjct  126  KNSFSRVLDTLHLDKYEVFLLKCVVAAGQQHVFGDVCTEFDATRSSLKSAFYALAEMIDN  185

Query  561  WEVN  572
            W+VN
Sbjct  186  WDVN  189



>ref|XP_006353432.1| PREDICTED: uncharacterized protein LOC102583756 isoform X1 [Solanum 
tuberosum]
Length=870

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RV+TAPVEYVPPAPDFDFHKEI RLK L+S++ +C +L  RIRV+DSDSRV SFFYS 
Sbjct  66   LTRVTTAPVEYVPPAPDFDFHKEIARLKDLKSKLDNCTNLKDRIRVIDSDSRVNSFFYSH  125

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMIEK  560
             + FSR L  L+LDKYEVFLLKC+VAAGQ+HV G+   EFD+ RSSLKSA YALAEMI+ 
Sbjct  126  KNSFSRVLDTLHLDKYEVFLLKCVVAAGQQHVFGDVCTEFDATRSSLKSAFYALAEMIDN  185

Query  561  WEVN  572
            W+VN
Sbjct  186  WDVN  189



>ref|XP_009799471.1| PREDICTED: uncharacterized protein LOC104245548 [Nicotiana sylvestris]
Length=875

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 123/159 (77%), Gaps = 6/159 (4%)
 Frame = +3

Query  195  IGVSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            I ++RVSTAPVEYVPPAPDFDFHKEI RLKAL+S++  C +L  RIRV+DSDSRV SFF+
Sbjct  65   IRLTRVSTAPVEYVPPAPDFDFHKEIARLKALKSKLDHCTNLKDRIRVIDSDSRVNSFFF  124

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMI  554
            S  + FSR L  L+LD++EVFLLKC+VAAGQ+HV G+   EF+  R SLKSALYALAEMI
Sbjct  125  SHKNSFSRVLETLHLDEFEVFLLKCVVAAGQQHVFGDVCTEFEQKRISLKSALYALAEMI  184

Query  555  EKWEVN------egggggvglglgeeevRALKSMLKSLG  653
            E W+VN       GGGG  G G+G EE  AL+SMLK +G
Sbjct  185  ENWDVNGGSGGGGGGGGVNGYGIGTEEHEALRSMLKIIG  223



>ref|XP_009587726.1| PREDICTED: uncharacterized protein LOC104085415 [Nicotiana tomentosiformis]
Length=871

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = +3

Query  195  IGVSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            I + RVSTAPVEYVPPAPDFD HKEI RLKAL+S++  C +L  RIRV+DSDSRV SFF+
Sbjct  65   IRLPRVSTAPVEYVPPAPDFDIHKEIARLKALKSKLDHCTNLKDRIRVIDSDSRVNSFFF  124

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMI  554
            S  + FSR L  L+LD++EVFLLKC+VAAGQ HV G+   EF+  RSSLKSALYALAEMI
Sbjct  125  SHQNSFSRVLETLHLDQFEVFLLKCVVAAGQHHVFGDVCTEFEQKRSSLKSALYALAEMI  184

Query  555  EKWEV--NegggggvglglgeeevRALKSMLKSLG  653
            E W+V    GGGG  G G+G EE  AL+SMLK +G
Sbjct  185  ENWDVNGGNGGGGVNGYGIGTEEHEALRSMLKIIG  219



>ref|XP_004240914.1| PREDICTED: uncharacterized protein LOC101246145 [Solanum lycopersicum]
Length=867

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RV+TAPVEYVPPAPDFDFHKEI RLK LRS++  C +L  R RV+DSDSRV SFFYS 
Sbjct  63   LTRVTTAPVEYVPPAPDFDFHKEIARLKDLRSKLDSCTNLKDRSRVIDSDSRVNSFFYSH  122

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMIEK  560
             + FSR L  L+LDKYEVFLLKC+VAAGQ+HV G+   E+D+  SSLKSA YALAEMI+ 
Sbjct  123  KNTFSRVLDTLHLDKYEVFLLKCVVAAGQQHVFGDVCTEYDATTSSLKSAFYALAEMIDN  182

Query  561  WEVN  572
            W+VN
Sbjct  183  WDVN  186



>ref|XP_008369281.1| PREDICTED: uncharacterized protein LOC103432852 [Malus domestica]
Length=872

 Score =   161 bits (407),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 5/129 (4%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS-  377
            ++RV+T PVEY P APDFDFH+E+ RLK+LRSR++DC SL  ++RV+D DSRVK FF S 
Sbjct  61   ITRVTTVPVEYAPSAPDFDFHQELSRLKSLRSRLADCDSLRAKLRVIDGDSRVKRFFNSG  120

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG---EF-GGEFDSARSSLKSALYALA  545
             + GFS  LG LNL   E+FL KCLVAAGQEHVLG   +F  GE ++A SS+KSALYAL 
Sbjct  121  SNGGFSAALGSLNLSSEELFLFKCLVAAGQEHVLGWGLQFDNGEVETAMSSVKSALYALV  180

Query  546  EMIEKWEVN  572
             MIEK +VN
Sbjct  181  AMIEKLDVN  189



>ref|XP_007219560.1| hypothetical protein PRUPE_ppa001281mg [Prunus persica]
 gb|EMJ20759.1| hypothetical protein PRUPE_ppa001281mg [Prunus persica]
Length=864

 Score =   160 bits (406),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 79/128 (62%), Positives = 96/128 (75%), Gaps = 4/128 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RV+T PVEY P APDFDFH+E+ RLK LRSR++D  SL  ++RV++ D RVK FF S 
Sbjct  54   ITRVTTVPVEYAPSAPDFDFHQELSRLKTLRSRLADSNSLRAKLRVIEGDPRVKRFFNSS  113

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG---EF-GGEFDSARSSLKSALYALAE  548
            ++GFS  L  LNL  YE+FL KCLVAAGQEHVLG   EF   E +S RSS+KSALYAL  
Sbjct  114  NNGFSTVLASLNLTPYELFLFKCLVAAGQEHVLGWGFEFVQSEMESVRSSVKSALYALVS  173

Query  549  MIEKWEVN  572
            MIEK +VN
Sbjct  174  MIEKLDVN  181



>ref|XP_009369204.1| PREDICTED: uncharacterized protein LOC103958637 [Pyrus x bretschneideri]
Length=871

 Score =   160 bits (404),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 5/129 (4%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS-  377
            ++RV+T PVEY P APDFDFH+E+ RLK+LRSR++DC SL  ++RV+D DSRVK FF S 
Sbjct  60   ITRVTTVPVEYAPSAPDFDFHQELSRLKSLRSRLADCDSLRAKLRVIDGDSRVKRFFNSG  119

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG---EF-GGEFDSARSSLKSALYALA  545
             + GFS  LG LNL   E+FL KCLVAAGQEHVLG   +F  GE ++A SS+K+ALYAL 
Sbjct  120  SNGGFSAALGSLNLSSEELFLFKCLVAAGQEHVLGWGLQFDDGEVETAMSSVKTALYALV  179

Query  546  EMIEKWEVN  572
             MIEK +VN
Sbjct  180  AMIEKLDVN  188



>ref|XP_008233789.1| PREDICTED: uncharacterized protein LOC103332812 [Prunus mume]
Length=864

 Score =   159 bits (403),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 4/128 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RV+T PVEY P APDFDFH+E+ RLK LRSR++D  SL  ++RV++ D RVK FF S 
Sbjct  54   ITRVTTVPVEYAPSAPDFDFHQELSRLKTLRSRLADSNSLRAKLRVIEGDPRVKRFFNSS  113

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG---EF-GGEFDSARSSLKSALYALAE  548
             +GFS  L  LNL  YE+FL KCLVAAGQEHVLG   EF   E +S RSS+KSALYAL  
Sbjct  114  SNGFSMVLASLNLTPYELFLFKCLVAAGQEHVLGWGFEFVQSEMESVRSSVKSALYALVS  173

Query  549  MIEKWEVN  572
            MIEK +VN
Sbjct  174  MIEKLDVN  181



>ref|XP_011084883.1| PREDICTED: uncharacterized protein LOC105167026 isoform X4 [Sesamum 
indicum]
Length=711

 Score =   157 bits (396),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 85/156 (54%), Positives = 109/156 (70%), Gaps = 12/156 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PPAP+FDF KEI RL+ALR  ++ C +L  ++R +DSDSRVKSFF S 
Sbjct  65   IARVSTAPVEYAPPAPEFDFDKEIARLRALREALASCGTLVEKLRTIDSDSRVKSFFKSW  124

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFG-----GEFDSARSSLKSALYALA  545
             + F    G ++L   +++LLKC+VAAGQEHVLGEFG     GE +  RS +K+ALYALA
Sbjct  125  RNDF----GGVSLSDCDLYLLKCVVAAGQEHVLGEFGAELANGEIEIGRSYIKNALYALA  180

Query  546  EMIEKWEVNegggggvglglgeeevRALKSMLKSLG  653
            EMIE W+V+ G  G       +    ALKS+LK LG
Sbjct  181  EMIESWDVDGGSRGHGLKDEEKA---ALKSLLKMLG  213



>ref|XP_011084881.1| PREDICTED: uncharacterized protein LOC105167026 isoform X2 [Sesamum 
indicum]
Length=866

 Score =   157 bits (397),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 85/156 (54%), Positives = 109/156 (70%), Gaps = 12/156 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PPAP+FDF KEI RL+ALR  ++ C +L  ++R +DSDSRVKSFF S 
Sbjct  65   IARVSTAPVEYAPPAPEFDFDKEIARLRALREALASCGTLVEKLRTIDSDSRVKSFFKSW  124

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFG-----GEFDSARSSLKSALYALA  545
             + F    G ++L   +++LLKC+VAAGQEHVLGEFG     GE +  RS +K+ALYALA
Sbjct  125  RNDF----GGVSLSDCDLYLLKCVVAAGQEHVLGEFGAELANGEIEIGRSYIKNALYALA  180

Query  546  EMIEKWEVNegggggvglglgeeevRALKSMLKSLG  653
            EMIE W+V+ G  G       +    ALKS+LK LG
Sbjct  181  EMIESWDVDGGSRGHGLKDEEKA---ALKSLLKMLG  213



>ref|XP_011084880.1| PREDICTED: uncharacterized protein LOC105167026 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   157 bits (397),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 85/156 (54%), Positives = 109/156 (70%), Gaps = 12/156 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PPAP+FDF KEI RL+ALR  ++ C +L  ++R +DSDSRVKSFF S 
Sbjct  65   IARVSTAPVEYAPPAPEFDFDKEIARLRALREALASCGTLVEKLRTIDSDSRVKSFFKSW  124

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFG-----GEFDSARSSLKSALYALA  545
             + F    G ++L   +++LLKC+VAAGQEHVLGEFG     GE +  RS +K+ALYALA
Sbjct  125  RNDF----GGVSLSDCDLYLLKCVVAAGQEHVLGEFGAELANGEIEIGRSYIKNALYALA  180

Query  546  EMIEKWEVNegggggvglglgeeevRALKSMLKSLG  653
            EMIE W+V+ G  G       +    ALKS+LK LG
Sbjct  181  EMIESWDVDGGSRGHGLKDEEKA---ALKSLLKMLG  213



>ref|XP_011084882.1| PREDICTED: uncharacterized protein LOC105167026 isoform X3 [Sesamum 
indicum]
Length=725

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 109/156 (70%), Gaps = 12/156 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PPAP+FDF KEI RL+ALR  ++ C +L  ++R +DSDSRVKSFF S 
Sbjct  65   IARVSTAPVEYAPPAPEFDFDKEIARLRALREALASCGTLVEKLRTIDSDSRVKSFFKSW  124

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFG-----GEFDSARSSLKSALYALA  545
             + F    G ++L   +++LLKC+VAAGQEHVLGEFG     GE +  RS +K+ALYALA
Sbjct  125  RNDF----GGVSLSDCDLYLLKCVVAAGQEHVLGEFGAELANGEIEIGRSYIKNALYALA  180

Query  546  EMIEKWEVNegggggvglglgeeevRALKSMLKSLG  653
            EMIE W+V+ G  G       +    ALKS+LK LG
Sbjct  181  EMIESWDVDGGSRGHGLKDEEKA---ALKSLLKMLG  213



>gb|KGN45803.1| hypothetical protein Csa_6G012280 [Cucumis sativus]
Length=231

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            + RVSTAPV+Y PPAPD+DF +EI RL+AL +++S   +++ +++++D DSRVK FF SR
Sbjct  58   IPRVSTAPVDYAPPAPDYDFQQEILRLRALCTKLSKKKTINDKLKLLDRDSRVKRFFNSR  117

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG----EFGGEFDSARSSLKSALYALAE  548
             + FSR    LNLD Y  FLLKCLVAAGQEHVL         EF++AR  +K ALY+L E
Sbjct  118  RNWFSRVSPHLNLDSYHCFLLKCLVAAGQEHVLSFRIESVESEFETARGVVKHALYSLVE  177

Query  549  MIEKWEVN  572
            +IEK++VN
Sbjct  178  VIEKFDVN  185



>gb|KDP44727.1| hypothetical protein JCGZ_01227 [Jatropha curcas]
Length=881

 Score =   146 bits (369),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 6/129 (5%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            V+RV+T P+EY  PAPD +FH EI RLK+LRS++S   SL+ ++ ++DSDSRVK FF S 
Sbjct  68   VTRVTTVPLEYALPAPDSNFHLEISRLKSLRSKLSGLNSLEQKLLLLDSDSRVKHFFSSH  127

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFG-----GEFDSARSSLKSALYALA  545
             +G SR + +LNLD +E+FLLKCLVAAGQEHVL  FG      E +SAR+S+KSALYAL 
Sbjct  128  RNGVSRAVALLNLDLHELFLLKCLVAAGQEHVL-SFGFELVESEAESARTSVKSALYALV  186

Query  546  EMIEKWEVN  572
            EMIE ++++
Sbjct  187  EMIESFDLS  195



>ref|XP_010658245.1| PREDICTED: uncharacterized protein LOC100241552 isoform X1 [Vitis 
vinifera]
Length=873

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 106/152 (70%), Gaps = 4/152 (3%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTAPVEY     +FDF  EI RL++LRS I +  S++ ++ VVD DSRVK FF S  S
Sbjct  56   RVSTAPVEYESQEGEFDFEGEIARLQSLRSAIGNAKSVEEKLAVVDGDSRVKRFFCSGKS  115

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHV----LGEFGGEFDSARSSLKSALYALAEMI  554
            G SR LG ++ D YE+FL+KCLVAAGQEHV    LG   GEF+S RS+L+S  Y L EMI
Sbjct  116  GVSRVLGSVSCDSYELFLVKCLVAAGQEHVLSSGLGLLEGEFESERSALRSVFYGLVEMI  175

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSL  650
            EKWEV+   G G   G+ +EE+ ALK +LK+L
Sbjct  176  EKWEVSGAEGLGKKNGVADEEIGALKKLLKTL  207



>ref|XP_010658247.1| PREDICTED: uncharacterized protein LOC100241552 isoform X3 [Vitis 
vinifera]
Length=861

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 106/152 (70%), Gaps = 4/152 (3%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTAPVEY     +FDF  EI RL++LRS I +  S++ ++ VVD DSRVK FF S  S
Sbjct  56   RVSTAPVEYESQEGEFDFEGEIARLQSLRSAIGNAKSVEEKLAVVDGDSRVKRFFCSGKS  115

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHV----LGEFGGEFDSARSSLKSALYALAEMI  554
            G SR LG ++ D YE+FL+KCLVAAGQEHV    LG   GEF+S RS+L+S  Y L EMI
Sbjct  116  GVSRVLGSVSCDSYELFLVKCLVAAGQEHVLSSGLGLLEGEFESERSALRSVFYGLVEMI  175

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSL  650
            EKWEV+   G G   G+ +EE+ ALK +LK+L
Sbjct  176  EKWEVSGAEGLGKKNGVADEEIGALKKLLKTL  207



>ref|XP_002273020.1| PREDICTED: uncharacterized protein LOC100241552 isoform X4 [Vitis 
vinifera]
 emb|CBI25447.3| unnamed protein product [Vitis vinifera]
Length=860

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 106/152 (70%), Gaps = 4/152 (3%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTAPVEY     +FDF  EI RL++LRS I +  S++ ++ VVD DSRVK FF S  S
Sbjct  56   RVSTAPVEYESQEGEFDFEGEIARLQSLRSAIGNAKSVEEKLAVVDGDSRVKRFFCSGKS  115

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHV----LGEFGGEFDSARSSLKSALYALAEMI  554
            G SR LG ++ D YE+FL+KCLVAAGQEHV    LG   GEF+S RS+L+S  Y L EMI
Sbjct  116  GVSRVLGSVSCDSYELFLVKCLVAAGQEHVLSSGLGLLEGEFESERSALRSVFYGLVEMI  175

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSL  650
            EKWEV+   G G   G+ +EE+ ALK +LK+L
Sbjct  176  EKWEVSGAEGLGKKNGVADEEIGALKKLLKTL  207



>ref|XP_010658246.1| PREDICTED: uncharacterized protein LOC100241552 isoform X2 [Vitis 
vinifera]
Length=872

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 106/152 (70%), Gaps = 4/152 (3%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTAPVEY     +FDF  EI RL++LRS I +  S++ ++ VVD DSRVK FF S  S
Sbjct  56   RVSTAPVEYESQEGEFDFEGEIARLQSLRSAIGNAKSVEEKLAVVDGDSRVKRFFCSGKS  115

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHV----LGEFGGEFDSARSSLKSALYALAEMI  554
            G SR LG ++ D YE+FL+KCLVAAGQEHV    LG   GEF+S RS+L+S  Y L EMI
Sbjct  116  GVSRVLGSVSCDSYELFLVKCLVAAGQEHVLSSGLGLLEGEFESERSALRSVFYGLVEMI  175

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSL  650
            EKWEV+   G G   G+ +EE+ ALK +LK+L
Sbjct  176  EKWEVSGAEGLGKKNGVADEEIGALKKLLKTL  207



>gb|KDO68900.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=892

 Score =   144 bits (363),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PP PDF+FH+EI RLK LRSR++   SL  ++ V+DSDSR+K+FF  +
Sbjct  61   ITRVSTAPVEYAPPPPDFNFHQEISRLKKLRSRLAVSQSLSHKLSVLDSDSRLKNFFNDK  120

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS-ARSSLKSALYALAEMI  554
            HS  F+R L  LNLD  ++FL+KC++AAGQEHVL       +S ARS +KSALYAL E I
Sbjct  121  HSNYFARVLASLNLD--QLFLIKCVIAAGQEHVLNLEPEYVESEARSDIKSALYALVEFI  178

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSLG  653
            ++ +VN          L  E+V+ L  +LK+L 
Sbjct  179  DRLDVNGRNSEAKDAVLEIEQVKDLNKLLKTLA  211



>gb|KDO68901.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=864

 Score =   144 bits (363),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PP PDF+FH+EI RLK LRSR++   SL  ++ V+DSDSR+K+FF  +
Sbjct  61   ITRVSTAPVEYAPPPPDFNFHQEISRLKKLRSRLAVSQSLSHKLSVLDSDSRLKNFFNDK  120

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS-ARSSLKSALYALAEMI  554
            HS  F+R L  LNLD  ++FL+KC++AAGQEHVL       +S ARS +KSALYAL E I
Sbjct  121  HSNYFARVLASLNLD--QLFLIKCVIAAGQEHVLNLEPEYVESEARSDIKSALYALVEFI  178

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSLG  653
            ++ +VN          L  E+V+ L  +LK+L 
Sbjct  179  DRLDVNGRNSEAKDAVLEIEQVKDLNKLLKTLA  211



>gb|KDO68902.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=862

 Score =   144 bits (362),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PP PDF+FH+EI RLK LRSR++   SL  ++ V+DSDSR+K+FF  +
Sbjct  61   ITRVSTAPVEYAPPPPDFNFHQEISRLKKLRSRLAVSQSLSHKLSVLDSDSRLKNFFNDK  120

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS-ARSSLKSALYALAEMI  554
            HS  F+R L  LNLD  ++FL+KC++AAGQEHVL       +S ARS +KSALYAL E I
Sbjct  121  HSNYFARVLASLNLD--QLFLIKCVIAAGQEHVLNLEPEYVESEARSDIKSALYALVEFI  178

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSLG  653
            ++ +VN          L  E+V+ L  +LK+L 
Sbjct  179  DRLDVNGRNSEAKDAVLEIEQVKDLNKLLKTLA  211



>ref|XP_006435779.1| hypothetical protein CICLE_v10030686mg [Citrus clementina]
 ref|XP_006486288.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Citrus sinensis]
 gb|ESR49019.1| hypothetical protein CICLE_v10030686mg [Citrus clementina]
Length=868

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PP PDF+FH+EI RLK LRSR++   SL  ++ V+DSDSR+K+FF  +
Sbjct  65   ITRVSTAPVEYAPPPPDFNFHQEISRLKKLRSRLAVSQSLSHKLSVLDSDSRLKNFFNDK  124

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS-ARSSLKSALYALAEMI  554
            HS  F+R L  LNLD  ++FL+KC++AAGQEHVL       +S ARS +KSALYAL E I
Sbjct  125  HSNYFARVLASLNLD--QLFLIKCVIAAGQEHVLNLEPEYVESEARSDIKSALYALVEFI  182

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSLG  653
            ++ +VN          L  E+V+ L  +LK+L 
Sbjct  183  DRLDVNGRNSEAKDAVLEIEQVKDLNKLLKTLA  215



>emb|CAN60362.1| hypothetical protein VITISV_024684 [Vitis vinifera]
Length=866

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTAPVEY     +FDF  EI RL +LRS I +  S++ ++ VVD DSRVK FF S  S
Sbjct  58   RVSTAPVEYESQEGEFDFEGEIARLXSLRSAIGNAKSVEEKLAVVDGDSRVKRFFCSGKS  117

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHV----LGEFGGEFDSARSSLKSALYALAEMI  554
            G SR LG ++ D YE+FL+KCLVAAGQEHV    LG   GEF+S RS+L+S  Y L EMI
Sbjct  118  GVSRVLGSVSCDSYELFLVKCLVAAGQEHVLSSGLGLLEGEFESERSALRSVFYGLVEMI  177

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSL  650
            EKWEV+   G G   G+ +EE+ ALK +LK+L
Sbjct  178  EKWEVSGAEGLGKKNGVADEEIGALKKLLKTL  209



>gb|KDO68905.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=581

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PP PDF+FH+EI RLK LRSR++   SL  ++ V+DSDSR+K+FF  +
Sbjct  61   ITRVSTAPVEYAPPPPDFNFHQEISRLKKLRSRLAVSQSLSHKLSVLDSDSRLKNFFNDK  120

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS-ARSSLKSALYALAEMI  554
            HS  F+R L  LNLD  ++FL+KC++AAGQEHVL       +S ARS +KSALYAL E I
Sbjct  121  HSNYFARVLASLNLD--QLFLIKCVIAAGQEHVLNLEPEYVESEARSDIKSALYALVEFI  178

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSLG  653
            ++ +VN          L  E+V+ L  +LK+L 
Sbjct  179  DRLDVNGRNSEAKDAVLEIEQVKDLNKLLKTLA  211



>gb|KDO68904.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=811

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PP PDF+FH+EI RLK LRSR++   SL  ++ V+DSDSR+K+FF  +
Sbjct  61   ITRVSTAPVEYAPPPPDFNFHQEISRLKKLRSRLAVSQSLSHKLSVLDSDSRLKNFFNDK  120

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS-ARSSLKSALYALAEMI  554
            HS  F+R L  LNLD  ++FL+KC++AAGQEHVL       +S ARS +KSALYAL E I
Sbjct  121  HSNYFARVLASLNLD--QLFLIKCVIAAGQEHVLNLEPEYVESEARSDIKSALYALVEFI  178

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSLG  653
            ++ +VN          L  E+V+ L  +LK+L 
Sbjct  179  DRLDVNGRNSEAKDAVLEIEQVKDLNKLLKTLA  211



>ref|XP_004138414.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101221986 
[Cucumis sativus]
Length=865

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            + RVSTAPV+Y PPAPD+DF +EI RL+AL +++S   +++ +++++D DSRVK FF SR
Sbjct  58   IPRVSTAPVDYAPPAPDYDFQQEILRLRALCTKLSKKKTINDKLKLLDRDSRVKRFFNSR  117

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG----EFGGEFDSARSSLKSALYALAE  548
             + FSR    LNLD Y  FLLKCLVAAGQEHVL         EF++AR  +K ALY+L E
Sbjct  118  RNWFSRVSPHLNLDSYHCFLLKCLVAAGQEHVLSFRIESVESEFETARGVVKHALYSLVE  177

Query  549  MIEKWEVN  572
            +IEK++VN
Sbjct  178  VIEKFDVN  185



>gb|KDO68903.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=834

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 106/152 (70%), Gaps = 4/152 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY PP PDF+FH+EI RLK LRSR++   SL  ++ V+DSDSR+K+FF  +
Sbjct  61   ITRVSTAPVEYAPPPPDFNFHQEISRLKKLRSRLAVSQSLSHKLSVLDSDSRLKNFFNDK  120

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS-ARSSLKSALYALAEMI  554
            HS  F+R L  LNLD  ++FL+KC++AAGQEHVL       +S ARS +KSALYAL E I
Sbjct  121  HSNYFARVLASLNLD--QLFLIKCVIAAGQEHVLNLEPEYVESEARSDIKSALYALVEFI  178

Query  555  EKWEVNegggggvglglgeeevRALKSMLKSL  650
            ++ +VN          L  E+V+ L  +LK+L
Sbjct  179  DRLDVNGRNSEAKDAVLEIEQVKDLNKLLKTL  210



>ref|XP_004307650.1| PREDICTED: uncharacterized protein LOC101304420 [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            V+RV+T PVEY PPAP+F+FH+E+ RLK+LRSR++   SL  + RV+D DSRV+ FF S 
Sbjct  62   VTRVTTVPVEYAPPAPEFEFHRELSRLKSLRSRLAAADSLRAKARVIDGDSRVRRFFSSS  121

Query  381  HSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG---EFGGE---FDSARSSLKSALYA  539
            ++   S  L  L+L   E++L KCLVAAGQEHVLG   EF GE    +SARSS+K+A YA
Sbjct  122  NNRVVSAVLAELDLSPGELYLFKCLVAAGQEHVLGWGYEFAGESEAAESARSSVKAAFYA  181

Query  540  LAEMIEKWEVN  572
            + EMIEK +V+
Sbjct  182  IVEMIEKLDVS  192



>ref|XP_007008908.1| UDP-glucose pyrophosphorylase 3 isoform 5, partial [Theobroma 
cacao]
 gb|EOY17718.1| UDP-glucose pyrophosphorylase 3 isoform 5, partial [Theobroma 
cacao]
Length=553

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 11/131 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            ++RVSTA +EY PPAPD  +F +EI RLK LR ++S   +L  +++V++SDS+VK F  +
Sbjct  62   ITRVSTAALEYAPPAPDSNNFQQEISRLKTLRLKLSASKTLKQKLKVLNSDSKVKHFLNT  121

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
            R  GF + LG L L   E FL+KCLVAAGQEHVL      GE GG  D  RSS+K+ALYA
Sbjct  122  R--GFEKVLGSLGLGLDESFLVKCLVAAGQEHVLEMGFGFGEKGG--DGVRSSVKTALYA  177

Query  540  LAEMIEKWEVN  572
            L EMIEKW+VN
Sbjct  178  LVEMIEKWDVN  188



>ref|XP_002315147.1| hypothetical protein POPTR_0010s19320g [Populus trichocarpa]
 gb|EEF01318.1| hypothetical protein POPTR_0010s19320g [Populus trichocarpa]
Length=877

 Score =   134 bits (336),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 69/130 (53%), Positives = 95/130 (73%), Gaps = 9/130 (7%)
 Frame = +3

Query  204  SRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            +RVS APVEY PPAPD F+FH+EI RL++LRS+++   +L+G+  V++ DSRVK FF  +
Sbjct  64   TRVSIAPVEYAPPAPDSFNFHQEISRLQSLRSKLAHSKTLNGKQSVLNDDSRVKRFF--K  121

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEF------DSARSSLKSALYAL  542
              G SRFL  +NL   E+FLLKCLVAAGQEHV+   G E       +S R+S+KSALY+L
Sbjct  122  IGGVSRFLDSINLTSRELFLLKCLVAAGQEHVVSLEGFELVESEAVESVRTSVKSALYSL  181

Query  543  AEMIEKWEVN  572
             E+IE ++++
Sbjct  182  VEIIEGFDLS  191



>ref|XP_007008904.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
 gb|EOY17714.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
Length=830

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 11/131 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            ++RVSTA +EY PPAPD  +F +EI RLK LR ++S   +L  +++V++SDS+VK F  +
Sbjct  65   ITRVSTAALEYAPPAPDSNNFQQEISRLKTLRLKLSASKTLKQKLKVLNSDSKVKHFLNT  124

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
            R  GF + LG L L   E FL+KCLVAAGQEHVL      GE GG  D  RSS+K+ALYA
Sbjct  125  R--GFEKVLGSLGLGLDESFLVKCLVAAGQEHVLEMGFGFGEKGG--DGVRSSVKTALYA  180

Query  540  LAEMIEKWEVN  572
            L EMIEKW+VN
Sbjct  181  LVEMIEKWDVN  191



>ref|XP_007008907.1| UDP-glucose pyrophosphorylase 3 isoform 4, partial [Theobroma 
cacao]
 gb|EOY17717.1| UDP-glucose pyrophosphorylase 3 isoform 4, partial [Theobroma 
cacao]
Length=833

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 11/131 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            ++RVSTA +EY PPAPD  +F +EI RLK LR ++S   +L  +++V++SDS+VK F  +
Sbjct  62   ITRVSTAALEYAPPAPDSNNFQQEISRLKTLRLKLSASKTLKQKLKVLNSDSKVKHFLNT  121

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
            R  GF + LG L L   E FL+KCLVAAGQEHVL      GE GG  D  RSS+K+ALYA
Sbjct  122  R--GFEKVLGSLGLGLDESFLVKCLVAAGQEHVLEMGFGFGEKGG--DGVRSSVKTALYA  177

Query  540  LAEMIEKWEVN  572
            L EMIEKW+VN
Sbjct  178  LVEMIEKWDVN  188



>ref|XP_007008905.1| UDP-glucose pyrophosphorylase 3 isoform 2, partial [Theobroma 
cacao]
 gb|EOY17715.1| UDP-glucose pyrophosphorylase 3 isoform 2, partial [Theobroma 
cacao]
Length=840

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 11/131 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            ++RVSTA +EY PPAPD  +F +EI RLK LR ++S   +L  +++V++SDS+VK F  +
Sbjct  62   ITRVSTAALEYAPPAPDSNNFQQEISRLKTLRLKLSASKTLKQKLKVLNSDSKVKHFLNT  121

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
            R  GF + LG L L   E FL+KCLVAAGQEHVL      GE GG  D  RSS+K+ALYA
Sbjct  122  R--GFEKVLGSLGLGLDESFLVKCLVAAGQEHVLEMGFGFGEKGG--DGVRSSVKTALYA  177

Query  540  LAEMIEKWEVN  572
            L EMIEKW+VN
Sbjct  178  LVEMIEKWDVN  188



>ref|XP_007008906.1| UDP-glucose pyrophosphorylase 3 isoform 3, partial [Theobroma 
cacao]
 gb|EOY17716.1| UDP-glucose pyrophosphorylase 3 isoform 3, partial [Theobroma 
cacao]
Length=876

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 11/131 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            ++RVSTA +EY PPAPD  +F +EI RLK LR ++S   +L  +++V++SDS+VK F  +
Sbjct  62   ITRVSTAALEYAPPAPDSNNFQQEISRLKTLRLKLSASKTLKQKLKVLNSDSKVKHFLNT  121

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
            R  GF + LG L L   E FL+KCLVAAGQEHVL      GE GG  D  RSS+K+ALYA
Sbjct  122  R--GFEKVLGSLGLGLDESFLVKCLVAAGQEHVLEMGFGFGEKGG--DGVRSSVKTALYA  177

Query  540  LAEMIEKWEVN  572
            L EMIEKW+VN
Sbjct  178  LVEMIEKWDVN  188



>ref|XP_008441479.1| PREDICTED: UDP-sugar pyrophosphorylase [Cucumis melo]
Length=870

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            + RVSTAPV+Y PPAPD+DF +EI RL+AL +++S   ++  +++++D DSRVK FF SR
Sbjct  58   IPRVSTAPVDYAPPAPDYDFQQEILRLRALSTKLSKKKTIKEKLKLIDRDSRVKRFFNSR  117

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG----EFGGEFDSARSSLKSALYALAE  548
             + FSR    LNLD Y+ FLLKCLVAAGQEHVL         +F++AR  +K A ++L E
Sbjct  118  RNWFSRVSPHLNLDSYDFFLLKCLVAAGQEHVLSLGIESVESDFETARGVVKHAFFSLVE  177

Query  549  MIEKWEVN  572
            +IEK+++N
Sbjct  178  VIEKFDLN  185



>ref|XP_011035907.1| PREDICTED: uncharacterized protein LOC105133562 isoform X2 [Populus 
euphratica]
Length=863

 Score =   130 bits (326),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 67/130 (52%), Positives = 94/130 (72%), Gaps = 9/130 (7%)
 Frame = +3

Query  204  SRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            +RVS APVEY PPAPD F+FH+EI RL++LRS+++   +L+G+  V++ DSRVK FF  +
Sbjct  64   TRVSIAPVEYAPPAPDSFNFHQEISRLQSLRSKLAHSKTLNGKHSVLNDDSRVKRFF--K  121

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGE------FDSARSSLKSALYAL  542
              G SRFL  +NL   E+FLLKCLVAAGQEHV+   G E       +  R+S+K+ALY+L
Sbjct  122  IEGVSRFLDSINLTSRELFLLKCLVAAGQEHVVSLEGFEVVEREAVEPVRTSVKNALYSL  181

Query  543  AEMIEKWEVN  572
             E+IE ++++
Sbjct  182  VEIIEGFDLS  191



>ref|XP_011035906.1| PREDICTED: uncharacterized protein LOC105133562 isoform X1 [Populus 
euphratica]
Length=877

 Score =   129 bits (325),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 67/130 (52%), Positives = 94/130 (72%), Gaps = 9/130 (7%)
 Frame = +3

Query  204  SRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            +RVS APVEY PPAPD F+FH+EI RL++LRS+++   +L+G+  V++ DSRVK FF  +
Sbjct  64   TRVSIAPVEYAPPAPDSFNFHQEISRLQSLRSKLAHSKTLNGKHSVLNDDSRVKRFF--K  121

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGE------FDSARSSLKSALYAL  542
              G SRFL  +NL   E+FLLKCLVAAGQEHV+   G E       +  R+S+K+ALY+L
Sbjct  122  IEGVSRFLDSINLTSRELFLLKCLVAAGQEHVVSLEGFEVVEREAVEPVRTSVKNALYSL  181

Query  543  AEMIEKWEVN  572
             E+IE ++++
Sbjct  182  VEIIEGFDLS  191



>ref|XP_010105428.1| hypothetical protein L484_009896 [Morus notabilis]
 gb|EXC04703.1| hypothetical protein L484_009896 [Morus notabilis]
Length=233

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +3

Query  255  DFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHSGFSRFLGVLNLDKYEV  434
            DF +EI RLKALRSR+S C SL  R+R+V  D  VK FF S  SGFSR L  LNL  YE+
Sbjct  81   DFRREISRLKALRSRLSRCESLRERLRIVGGDRIVKDFFGSGRSGFSRVLASLNLCSYEL  140

Query  435  FLLKCLVAAGQEHVLGEFG-----GEFDSARSSLKSALYALAEMIEKWEV  569
            FLLKCLVA GQEHVL  FG      EF+SAR S+KSALYAL  MIEK +V
Sbjct  141  FLLKCLVATGQEHVL-TFGFQFVDDEFESARGSIKSALYALVGMIEKLDV  189



>ref|XP_002528323.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34081.1| conserved hypothetical protein [Ricinus communis]
Length=884

 Score =   127 bits (318),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 80/166 (48%), Positives = 106/166 (64%), Gaps = 16/166 (10%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFD-------------FHKEIGRLKALRSRISDCASLDGRIRVV  341
            ++RV+T P++Y PPAPD D             FH+EI RLK+LRS + D  S + ++ V+
Sbjct  64   ITRVTTVPLDYAPPAPDSDNNNNSNNDNDISSFHQEISRLKSLRSNLVDSKSFNQKLSVL  123

Query  342  DSDSRVKSFFYSRHSG-FSRFLGVLNLDKYEVFLLKCLVAAGQEHV--LGEFGGEFDSAR  512
            DSDSRV SFF S H    SR    LNL  +E++LLKCLVAAGQ+HV  LG    E ++AR
Sbjct  124  DSDSRVVSFFNSHHKNRVSRVFNSLNLGFHELYLLKCLVAAGQQHVISLGIKFSEMETAR  183

Query  513  SSLKSALYALAEMIEKWEVNegggggvglglgeeevRALKSMLKSL  650
            S+LKSALYAL +MIE+++   G      L L EEE   L+ +LK+L
Sbjct  184  STLKSALYALVDMIERFDFGNGLHKSNNLDLKEEEFEDLRKLLKTL  229



>ref|XP_010693077.1| PREDICTED: uncharacterized protein LOC104906066 [Beta vulgaris 
subsp. vulgaris]
Length=875

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 10/132 (8%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVEY  PAP+FDF KEI RL+ LR ++S   S++ + RVVD DSRV +FF S 
Sbjct  62   LTRVSTAPVEYASPAPEFDFDKEIARLRNLRLKLSKAGSVEMKHRVVDGDSRVNNFFNSS  121

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFG---------GEFDSARSSLKSAL  533
             + FSR    + LD +E++L+KC+VAAGQEHV+  +G             S+RSSLK+AL
Sbjct  122  WNRFSRVSESVELDSFEMYLIKCVVAAGQEHVI-SYGVEEVEEEEREFESSSRSSLKNAL  180

Query  534  YALAEMIEKWEV  569
            ++LAEMIE W++
Sbjct  181  FSLAEMIESWDI  192



>ref|XP_010536381.1| PREDICTED: uncharacterized protein LOC104811372 [Tarenaya hassleriana]
Length=896

 Score =   123 bits (308),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 68/132 (52%), Positives = 87/132 (66%), Gaps = 8/132 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V+RVSTAPVEY  P P    DF  EI RLK+LRS+++    L  +  V+D+DSRV+ FF 
Sbjct  75   VTRVSTAPVEYATPTPPESDDFLSEIARLKSLRSKLAVSRELHQKDAVIDADSRVRRFFT  134

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG-----EFG-GEFDSARSSLKSALY  536
                GF+  LG + L+  E+FL KCLVAAGQEH L       FG  E  S RSS+K+ALY
Sbjct  135  ENRGGFAEVLGSIGLNLREMFLAKCLVAAGQEHALSLGYEEAFGEAEEYSVRSSVKNALY  194

Query  537  ALAEMIEKWEVN  572
            AL EMIE++++N
Sbjct  195  ALVEMIERFDIN  206



>ref|XP_010031181.1| PREDICTED: uncharacterized protein LOC104421052 [Eucalyptus grandis]
Length=876

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 8/132 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVE  PPAP+F F  EI RL ALRSR++   S+  ++ V+ +DSRV+ FF S 
Sbjct  67   LTRVSTAPVECAPPAPEFGFRSEIERLSALRSRLAGAGSVARKLAVIGADSRVEEFFGSP  126

Query  381  HS---GFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG-EFG---GEF-DSARSSLKSALY  536
             +   G +  LG ++LD+ E+FL+KCLVAAGQEHVLG + G   GEF +SA+S LKSALY
Sbjct  127  SADGGGLAGALGAVDLDEEEMFLIKCLVAAGQEHVLGADVGIPEGEFRESAKSPLKSALY  186

Query  537  ALAEMIEKWEVN  572
            ALAEMIE+ + N
Sbjct  187  ALAEMIERMDAN  198



>gb|KCW50445.1| hypothetical protein EUGRSUZ_J00183 [Eucalyptus grandis]
Length=917

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 96/132 (73%), Gaps = 8/132 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVE  PPAP+F F  EI RL ALRSR++   S+  ++ V+ +DSRV+ FF S 
Sbjct  108  LTRVSTAPVECAPPAPEFGFRSEIERLSALRSRLAGAGSVARKLAVIGADSRVEEFFGSP  167

Query  381  HSG---FSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG-EFG---GEF-DSARSSLKSALY  536
             +     +  LG ++LD+ E+FL+KCLVAAGQEHVLG + G   GEF +SA+S LKSALY
Sbjct  168  SADGGGLAGALGAVDLDEEEMFLIKCLVAAGQEHVLGADVGIPEGEFRESAKSPLKSALY  227

Query  537  ALAEMIEKWEVN  572
            ALAEMIE+ + N
Sbjct  228  ALAEMIERMDAN  239



>gb|KJB74378.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=869

 Score =   122 bits (305),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTA +EY PPAPD +FH EI RLKALR ++S   +L  +++++DSD++VK FF + H 
Sbjct  63   RVSTATIEYAPPAPDSNFHHEISRLKALRLKLSSSTTLKQKLKILDSDAKVK-FFLNTH-  120

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMIEKWE  566
            G+ + L  L L   E+FL+K +VAAGQ+HV     G  D   SS+K+ALY+LA++IEKW+
Sbjct  121  GYKKVLSSLGLGLNELFLVKSMVAAGQDHVFDMGFGFEDREMSSVKTALYSLAKIIEKWD  180



>gb|KJB74379.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=821

 Score =   121 bits (304),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTA +EY PPAPD +FH EI RLKALR ++S   +L  +++++DSD++VK FF + H 
Sbjct  63   RVSTATIEYAPPAPDSNFHHEISRLKALRLKLSSSTTLKQKLKILDSDAKVK-FFLNTH-  120

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMIEKWE  566
            G+ + L  L L   E+FL+K +VAAGQ+HV     G  D   SS+K+ALY+LA++IEKW+
Sbjct  121  GYKKVLSSLGLGLNELFLVKSMVAAGQDHVFDMGFGFEDREMSSVKTALYSLAKIIEKWD  180



>ref|XP_006601947.1| PREDICTED: uncharacterized protein LOC100788781 isoform X2 [Glycine 
max]
Length=843

 Score =   121 bits (303),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 67/123 (54%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP-DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            VSR+ST  +E  PP P DF+F +EI RL  LR R+S C++L+ ++RV+D+DSRVK FF S
Sbjct  49   VSRISTETLEVSPPPPPDFNFRREIARLADLRDRLSACSTLNEKLRVIDADSRVKRFFRS  108

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHV--LGEFGG-EFDSARSSLKSALYALAE  548
            R  G +  L  L L   ++FLLKC+VAAGQEHV  LGE    E   A S++KSALY LA+
Sbjct  109  RR-GLAGVLASLQLSSDQLFLLKCVVAAGQEHVLCLGETESLESSVATSAVKSALYTLAD  167

Query  549  MIE  557
            MIE
Sbjct  168  MIE  170



>ref|XP_003552278.1| PREDICTED: uncharacterized protein LOC100788781 isoform X1 [Glycine 
max]
Length=857

 Score =   121 bits (303),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 67/123 (54%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP-DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            VSR+ST  +E  PP P DF+F +EI RL  LR R+S C++L+ ++RV+D+DSRVK FF S
Sbjct  49   VSRISTETLEVSPPPPPDFNFRREIARLADLRDRLSACSTLNEKLRVIDADSRVKRFFRS  108

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHV--LGEFGG-EFDSARSSLKSALYALAE  548
            R  G +  L  L L   ++FLLKC+VAAGQEHV  LGE    E   A S++KSALY LA+
Sbjct  109  RR-GLAGVLASLQLSSDQLFLLKCVVAAGQEHVLCLGETESLESSVATSAVKSALYTLAD  167

Query  549  MIE  557
            MIE
Sbjct  168  MIE  170



>ref|XP_010257086.1| PREDICTED: uncharacterized protein LOC104597312 isoform X3 [Nelumbo 
nucifera]
Length=855

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 72/128 (56%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVE  P  PD DF  EI RL++L SR+S   +L  +IRV+D DSRV+  F +R
Sbjct  65   ITRVSTAPVESAP-LPDCDFQDEIARLQSLLSRLSSSKNLKDKIRVLDCDSRVRQLFSAR  123

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL----GEFGGEFDSARSSLKSALYALAE  548
              GFSR +  LNLD Y++FLLKCLVAAGQEHVL      F  +++  RSSLKSALY L E
Sbjct  124  KIGFSRVVTSLNLDIYDLFLLKCLVAAGQEHVLYSEFDSFDTKYEFHRSSLKSALYMLVE  183

Query  549  MIEKWEVN  572
            MIE  + N
Sbjct  184  MIENLDAN  191



>ref|XP_010257084.1| PREDICTED: uncharacterized protein LOC104597312 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 72/128 (56%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVE  P  PD DF  EI RL++L SR+S   +L  +IRV+D DSRV+  F +R
Sbjct  65   ITRVSTAPVESAP-LPDCDFQDEIARLQSLLSRLSSSKNLKDKIRVLDCDSRVRQLFSAR  123

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL----GEFGGEFDSARSSLKSALYALAE  548
              GFSR +  LNLD Y++FLLKCLVAAGQEHVL      F  +++  RSSLKSALY L E
Sbjct  124  KIGFSRVVTSLNLDIYDLFLLKCLVAAGQEHVLYSEFDSFDTKYEFHRSSLKSALYMLVE  183

Query  549  MIEKWEVN  572
            MIE  + N
Sbjct  184  MIENLDAN  191



>ref|XP_010257085.1| PREDICTED: uncharacterized protein LOC104597312 isoform X2 [Nelumbo 
nucifera]
Length=872

 Score =   120 bits (302),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 72/128 (56%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            ++RVSTAPVE  P  PD DF  EI RL++L SR+S   +L  +IRV+D DSRV+  F +R
Sbjct  65   ITRVSTAPVESAP-LPDCDFQDEIARLQSLLSRLSSSKNLKDKIRVLDCDSRVRQLFSAR  123

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL----GEFGGEFDSARSSLKSALYALAE  548
              GFSR +  LNLD Y++FLLKCLVAAGQEHVL      F  +++  RSSLKSALY L E
Sbjct  124  KIGFSRVVTSLNLDIYDLFLLKCLVAAGQEHVLYSEFDSFDTKYEFHRSSLKSALYMLVE  183

Query  549  MIEKWEVN  572
            MIE  + N
Sbjct  184  MIENLDAN  191



>ref|XP_010907871.1| PREDICTED: uncharacterized protein LOC105034415 [Elaeis guineensis]
Length=868

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 8/125 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            + RVSTAPVE+ P APDFDF +EI RL A+R+R+ +  SL+ ++RV+D+DSRV+  F +R
Sbjct  61   IIRVSTAPVEHAP-APDFDFGEEIARLDAIRARLREAKSLNEKLRVLDADSRVRDIFSAR  119

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG-----EFGGEFDSARSSLKSALYALA  545
              G S+ LG   L+  EVFLLKCLVAAGQ HVLG       GG     RS+LKSA  ALA
Sbjct  120  RGGISKVLGF--LEPAEVFLLKCLVAAGQGHVLGWELHSGGGGGHRVERSALKSAFVALA  177

Query  546  EMIEK  560
             +IEK
Sbjct  178  GLIEK  182



>ref|XP_004500507.1| PREDICTED: uncharacterized protein LOC101505226 [Cicer arietinum]
Length=878

 Score =   119 bits (298),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 9/128 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS-  377
            V+R+ST  +E  PP P F+F +EI RL ALR++++ C +L  ++RV+D DSRV+ FF S 
Sbjct  59   VARISTETLELSPPPPGFNFRREIARLTALRNKLAACNTLQDKLRVIDVDSRVRRFFGSS  118

Query  378  ---RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHV--LGEF---GGEFDSARSSLKSAL  533
               R++  +R L  L LD + +FLLKCLVAAGQEHV  L E     G    A  S+KSA 
Sbjct  119  SRHRNTVLARLLSELRLDSFNLFLLKCLVAAGQEHVLCLSEIITQSGTRAMASGSVKSAF  178

Query  534  YALAEMIE  557
            YALA+MIE
Sbjct  179  YALAKMIE  186



>gb|KEH34804.1| UDP-glucose pyrophosphorylase [Medicago truncatula]
Length=863

 Score =   119 bits (297),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 87/130 (67%), Gaps = 9/130 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFF--Y  374
            V+R+ST P+E   P P F+F +EI RL +LR +++ C +++ ++R++++D RV+ FF   
Sbjct  57   VARISTEPLELSTPPPGFNFRREITRLTSLRDKLAACDTINDKLRIINADYRVRRFFGSS  116

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALY  536
            SR++G +R L  L LD   +FLLKCLVAAGQEHVL       E G    +   S+KSA Y
Sbjct  117  SRNAGLARVLSTLQLDSENLFLLKCLVAAGQEHVLCLEETMPEMGSSV-TGSGSVKSAFY  175

Query  537  ALAEMIEKWE  566
            ALA+MIEK +
Sbjct  176  ALAKMIEKMD  185



>gb|KJB74377.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=757

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTA +EY PPAPD +FH EI RLKALR ++S   +L  +++++DSD++VK FF + H 
Sbjct  63   RVSTATIEYAPPAPDSNFHHEISRLKALRLKLSSSTTLKQKLKILDSDAKVK-FFLNTH-  120

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMIEKWE  566
            G+ + L  L L   E+FL+K +VAAGQ+HV     G  D   SS+K+ALY+LA++IEKW+
Sbjct  121  GYKKVLSSLGLGLNELFLVKSMVAAGQDHVFDMGFGFEDREMSSVKTALYSLAKIIEKWD  180



>ref|XP_003600957.1| hypothetical protein MTR_3g071440 [Medicago truncatula]
 gb|AES71208.1| UDP-glucose pyrophosphorylase [Medicago truncatula]
Length=868

 Score =   119 bits (297),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 87/130 (67%), Gaps = 9/130 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFF--Y  374
            V+R+ST P+E   P P F+F +EI RL +LR +++ C +++ ++R++++D RV+ FF   
Sbjct  57   VARISTEPLELSTPPPGFNFRREITRLTSLRDKLAACDTINDKLRIINADYRVRRFFGSS  116

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALY  536
            SR++G +R L  L LD   +FLLKCLVAAGQEHVL       E G    +   S+KSA Y
Sbjct  117  SRNAGLARVLSTLQLDSENLFLLKCLVAAGQEHVLCLEETMPEMGSSV-TGSGSVKSAFY  175

Query  537  ALAEMIEKWE  566
            ALA+MIEK +
Sbjct  176  ALAKMIEKMD  185



>ref|XP_009386480.1| PREDICTED: uncharacterized protein LOC103973588 [Musa acuminata 
subsp. malaccensis]
Length=870

 Score =   118 bits (296),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 86/127 (68%), Gaps = 12/127 (9%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFF-YSRH  383
            RVST PVE  P AP+FDF +EI  L ALRS +    SL  R+ V+D+DSRV++FF  S H
Sbjct  67   RVSTVPVEQAP-APEFDFGEEIAHLDALRSGLLAAKSLAERLNVLDADSRVRNFFGPSAH  125

Query  384  SGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG---EFGGEFDSA-RSSLKSALYALAEM  551
                R      L+  EVFLLKCLVA GQEHVLG   ++GG+   A RS+L++A YALA+M
Sbjct  126  PVLDR------LEASEVFLLKCLVAGGQEHVLGAEMDWGGQLHQAERSALRTAFYALADM  179

Query  552  IEKWEVN  572
            IEKW ++
Sbjct  180  IEKWSLD  186



>ref|XP_008811680.1| PREDICTED: uncharacterized protein LOC103722778 isoform X2 [Phoenix 
dactylifera]
Length=857

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            + RVSTAPVE  P APDFDF +EI RL A+R+R+ +  SL+ ++RV+D+DSRV+ FF  R
Sbjct  60   IHRVSTAPVERAP-APDFDFGEEIARLDAIRARLREAKSLNEKLRVLDADSRVRDFFAPR  118

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGE-----FGGEFDSARSSLKSALYALA  545
              G S+ LG   L+  EV LLKCLVAAGQ HVLG       GG      S+LKSA + LA
Sbjct  119  RGGISKVLGF--LEPAEVVLLKCLVAAGQGHVLGPELDTGGGGAHRVEGSALKSAFFTLA  176

Query  546  EMIEK  560
             +IEK
Sbjct  177  GLIEK  181



>ref|XP_008811681.1| PREDICTED: uncharacterized protein LOC103722778 isoform X3 [Phoenix 
dactylifera]
Length=841

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            + RVSTAPVE  P APDFDF +EI RL A+R+R+ +  SL+ ++RV+D+DSRV+ FF  R
Sbjct  60   IHRVSTAPVERAP-APDFDFGEEIARLDAIRARLREAKSLNEKLRVLDADSRVRDFFAPR  118

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGE-----FGGEFDSARSSLKSALYALA  545
              G S+ LG   L+  EV LLKCLVAAGQ HVLG       GG      S+LKSA + LA
Sbjct  119  RGGISKVLGF--LEPAEVVLLKCLVAAGQGHVLGPELDTGGGGAHRVEGSALKSAFFTLA  176

Query  546  EMIEK  560
             +IEK
Sbjct  177  GLIEK  181



>ref|XP_008811677.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811678.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811679.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
Length=867

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSR  380
            + RVSTAPVE  P APDFDF +EI RL A+R+R+ +  SL+ ++RV+D+DSRV+ FF  R
Sbjct  60   IHRVSTAPVERAP-APDFDFGEEIARLDAIRARLREAKSLNEKLRVLDADSRVRDFFAPR  118

Query  381  HSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGE-----FGGEFDSARSSLKSALYALA  545
              G S+ LG   L+  EV LLKCLVAAGQ HVLG       GG      S+LKSA + LA
Sbjct  119  RGGISKVLGF--LEPAEVVLLKCLVAAGQGHVLGPELDTGGGGAHRVEGSALKSAFFTLA  176

Query  546  EMIEK  560
             +IEK
Sbjct  177  GLIEK  181



>gb|KHG20503.1| UDP-sugar pyrophospharylase [Gossypium arboreum]
Length=875

 Score =   117 bits (292),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 60/118 (51%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = +3

Query  207  RVSTAPVEYVPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHS  386
            RVSTA +EY PPAPD +FH EI RLKALR ++S   +L  +++++DSD++VK FF + H 
Sbjct  66   RVSTATIEYAPPAPDSNFHHEISRLKALRLKLSSSTTLKQKLKILDSDAKVK-FFLNTH-  123

Query  387  GFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDSARSSLKSALYALAEMIEK  560
            G+ + L  L L   E+FL+K +VAAGQ+HV     G  D   SS+K+ALY+LA++IEK
Sbjct  124  GYKKVLSSLGLGLNELFLVKSMVAAGQDHVFDMGFGFEDREMSSVKTALYSLAKIIEK  181



>ref|XP_007163567.1| hypothetical protein PHAVU_001G2449000g, partial [Phaseolus vulgaris]
 gb|ESW35561.1| hypothetical protein PHAVU_001G2449000g, partial [Phaseolus vulgaris]
Length=636

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPD-FDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            V+R+ST  +E  PP PD F+FH+EI RL ALR R++ CA+L  ++RV+++DSRVK FF S
Sbjct  52   VARISTETLEVSPPPPDDFNFHREIARLAALRDRLAACATLVEKLRVLNADSRVKRFFGS  111

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL----GEFGGEFDSARSSLKSALYALA  545
               G +R L  L L   ++FLLKC+VAAGQEHVL     E      +A S++KSALYA+A
Sbjct  112  GR-GLARVLASLRLSSDQLFLLKCVVAAGQEHVLCLDEAESLESAAAAASAVKSALYAIA  170

Query  546  EMIEK  560
            EMIE 
Sbjct  171  EMIEN  175



>ref|XP_010554677.1| PREDICTED: uncharacterized protein LOC104824329 [Tarenaya hassleriana]
Length=877

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 86/133 (65%), Gaps = 10/133 (8%)
 Frame = +3

Query  201  VSRVSTAPVEY---VPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFF  371
            V+RV+TAPVE     PP PD DF  EI RLKALRS+++    +  +  VV++D RV  FF
Sbjct  55   VTRVTTAPVERAAPTPPEPD-DFLSEIARLKALRSKLAVSREMQHKDAVVNADPRVHRFF  113

Query  372  YSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHV--LGEFGG----EFDSARSSLKSAL  533
                 GF+  LG + L   E+F++KCLVAAGQEH   LG        E  SARSS+K+AL
Sbjct  114  TENRGGFAEVLGSIGLTSSEMFVVKCLVAAGQEHAFSLGYEEAFVEREESSARSSMKNAL  173

Query  534  YALAEMIEKWEVN  572
            YAL EMIE+++VN
Sbjct  174  YALVEMIERFDVN  186



>ref|XP_010504480.1| PREDICTED: uncharacterized protein LOC104781493 isoform X1 [Camelina 
sativa]
Length=885

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 68/137 (50%), Positives = 87/137 (64%), Gaps = 14/137 (10%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIR--VVDSDSRVKSF  368
            V  VST PVEY  P P    DF  EIGRLK+LRS++ D +S D R +  V+D+D RV+ F
Sbjct  66   VRHVSTVPVEYPTPTPPESDDFLSEIGRLKSLRSKL-DVSSKDLRRKDAVIDADPRVRRF  124

Query  369  FYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL---------GEFGGEFDSARSSL  521
            F     GFS+ LG L L+  E+FL+KC++AAGQEH L          E   E  + RSS+
Sbjct  125  FSENRGGFSKVLGSLGLNSEEMFLVKCVIAAGQEHALCMNYEEGFEEEEEEEEYTVRSSV  184

Query  522  KSALYALAEMIEKWEVN  572
            K+ALYAL EMIE+ +VN
Sbjct  185  KNALYALVEMIERLDVN  201



>ref|XP_010504481.1| PREDICTED: uncharacterized protein LOC104781493 isoform X2 [Camelina 
sativa]
Length=885

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 68/137 (50%), Positives = 87/137 (64%), Gaps = 14/137 (10%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIR--VVDSDSRVKSF  368
            V  VST PVEY  P P    DF  EIGRLK+LRS++ D +S D R +  V+D+D RV+ F
Sbjct  66   VRHVSTVPVEYPTPTPPESDDFLSEIGRLKSLRSKL-DVSSKDLRRKDAVIDADPRVRRF  124

Query  369  FYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL---------GEFGGEFDSARSSL  521
            F     GFS+ LG L L+  E+FL+KC++AAGQEH L          E   E  + RSS+
Sbjct  125  FSENRGGFSKVLGSLGLNSEEMFLVKCVIAAGQEHALCMNYEEGFEEEEEEEEYTVRSSV  184

Query  522  KSALYALAEMIEKWEVN  572
            K+ALYAL EMIE+ +VN
Sbjct  185  KNALYALVEMIERLDVN  201



>emb|CDX72178.1| BnaC08g26960D [Brassica napus]
Length=867

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 84/134 (63%), Gaps = 10/134 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V+RVST PVEY  P P    DF  EI RLKAL +++     L  +  V+DSDSRV+ FF 
Sbjct  56   VTRVSTVPVEYSTPTPPESDDFSSEIDRLKALLAKLDVSKDLRRKEAVIDSDSRVRRFFS  115

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL--------GEFGGEFDSARSSLKSA  530
                G S+ LG L LD  E+FLLKC++AAGQEH L         E   E  + RSS+K+A
Sbjct  116  ENRGGLSKVLGSLGLDSREMFLLKCVIAAGQEHALCVGYEETFEEEEEEEYTVRSSVKTA  175

Query  531  LYALAEMIEKWEVN  572
            LYAL E+IE+++VN
Sbjct  176  LYALVELIERFDVN  189



>ref|XP_006403031.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
 gb|ESQ44484.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
Length=886

 Score =   110 bits (276),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 82/133 (62%), Gaps = 9/133 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V RVST PVEY  P P    DF  EI RLKAL S++     L  +  V+D+DSRV+ FF 
Sbjct  68   VRRVSTVPVEYSTPTPPESDDFSSEIDRLKALLSKLDVSKDLRRKEAVIDADSRVRRFFS  127

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL-------GEFGGEFDSARSSLKSAL  533
                G S+ L  L L+  E+FL+KC++AAGQEH L        E   E  + RSS+K+AL
Sbjct  128  DNRGGLSKVLASLGLNSKEMFLVKCVIAAGQEHALCVGYEETFEEEEEEYTVRSSVKNAL  187

Query  534  YALAEMIEKWEVN  572
            YAL EMIE+++VN
Sbjct  188  YALVEMIERFDVN  200



>ref|XP_006403032.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
 gb|ESQ44485.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
Length=888

 Score =   110 bits (276),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 82/133 (62%), Gaps = 9/133 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V RVST PVEY  P P    DF  EI RLKAL S++     L  +  V+D+DSRV+ FF 
Sbjct  68   VRRVSTVPVEYSTPTPPESDDFSSEIDRLKALLSKLDVSKDLRRKEAVIDADSRVRRFFS  127

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL-------GEFGGEFDSARSSLKSAL  533
                G S+ L  L L+  E+FL+KC++AAGQEH L        E   E  + RSS+K+AL
Sbjct  128  DNRGGLSKVLASLGLNSKEMFLVKCVIAAGQEHALCVGYEETFEEEEEEYTVRSSVKNAL  187

Query  534  YALAEMIEKWEVN  572
            YAL EMIE+++VN
Sbjct  188  YALVEMIERFDVN  200



>ref|XP_002878057.1| hypothetical protein ARALYDRAFT_486043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54316.1| hypothetical protein ARALYDRAFT_486043 [Arabidopsis lyrata subsp. 
lyrata]
Length=883

 Score =   110 bits (275),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 61/133 (46%), Positives = 81/133 (61%), Gaps = 9/133 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V  VST PVEY  P P    DF  EI RL +LR+++     L  +  V+D+DSRV+ FF 
Sbjct  65   VRHVSTVPVEYATPTPPESDDFLSEIDRLNSLRAKLDVSKDLRRKDAVIDADSRVRRFFS  124

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG-------EFGGEFDSARSSLKSAL  533
                G  + LG L L+  E+FL+KC++AAGQEH L        E   E  + RSS+K+AL
Sbjct  125  ENRGGLPQVLGSLGLNSKEMFLVKCVIAAGQEHALCMNYEEAFEQDAEEYTVRSSVKNAL  184

Query  534  YALAEMIEKWEVN  572
            YAL EMIE+++VN
Sbjct  185  YALVEMIERFDVN  197



>emb|CDY66808.1| BnaA09g55090D [Brassica napus]
Length=866

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 82/131 (63%), Gaps = 8/131 (6%)
 Frame = +3

Query  204  SRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            +RVST PVEY  P P    DF  EI RLK+L +++     L  +  V+DSDSRV+ FF  
Sbjct  58   TRVSTVPVEYSTPTPPESDDFSSEIDRLKSLLTKLDVSNDLRRKEAVIDSDSRVRRFFGE  117

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
               G S+ LG L LD  E+FL+KC++AAGQEH L           E  + RSS+K+ALYA
Sbjct  118  NRGGLSKVLGSLGLDSREMFLVKCVIAAGQEHALCVGYEETFEEEEEYTVRSSVKTALYA  177

Query  540  LAEMIEKWEVN  572
            L EMIE+++VN
Sbjct  178  LVEMIERFDVN  188



>ref|XP_010516200.1| PREDICTED: uncharacterized protein LOC104791893 [Camelina sativa]
Length=885

 Score =   108 bits (271),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 86/137 (63%), Gaps = 14/137 (10%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIR--VVDSDSRVKSF  368
            V  VST PVEY  P P    DF  EI RLK+LR+++ D +S D R +  V+D+D RV+ F
Sbjct  64   VRHVSTVPVEYPTPTPPESDDFLSEIDRLKSLRAKL-DVSSKDLRRKDAVIDADPRVRRF  122

Query  369  FYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL---------GEFGGEFDSARSSL  521
            F     G S+ LG L L+  E+FL+KC++AAGQEH L          E   E  + RSS+
Sbjct  123  FSENRGGLSKVLGSLGLNSEEMFLVKCVIAAGQEHALCMNYEEGFEEEEEEEEYTVRSSV  182

Query  522  KSALYALAEMIEKWEVN  572
            KSALYAL EMIE+++VN
Sbjct  183  KSALYALVEMIERFDVN  199



>emb|CAB87858.1| putative protein [Arabidopsis thaliana]
Length=871

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 61/133 (46%), Positives = 80/133 (60%), Gaps = 9/133 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V  VST PVEY  P P    DF  EI RLK+L S++     L  +  V+D+DSRV+ FF 
Sbjct  65   VRHVSTVPVEYSTPTPPESDDFLSEIDRLKSLLSKLDVSKDLRRKDAVIDADSRVRRFFS  124

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL-------GEFGGEFDSARSSLKSAL  533
                G S+  G L L+  E+FL+KC++AAGQEH L            E  + RSS+K+AL
Sbjct  125  ENRGGLSKVFGYLGLNSNEMFLVKCVIAAGQEHALCMNYEEAFGEEEEEYTVRSSVKNAL  184

Query  534  YALAEMIEKWEVN  572
            YAL EMIE+++VN
Sbjct  185  YALVEMIERFDVN  197



>ref|NP_567031.1| UDP-glucose pyrophosphorylase 3 [Arabidopsis thaliana]
 gb|AEE79469.1| UDP-glucose pyrophosphorylase 3 [Arabidopsis thaliana]
Length=883

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 61/133 (46%), Positives = 80/133 (60%), Gaps = 9/133 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V  VST PVEY  P P    DF  EI RLK+L S++     L  +  V+D+DSRV+ FF 
Sbjct  65   VRHVSTVPVEYSTPTPPESDDFLSEIDRLKSLLSKLDVSKDLRRKDAVIDADSRVRRFFS  124

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL-------GEFGGEFDSARSSLKSAL  533
                G S+  G L L+  E+FL+KC++AAGQEH L            E  + RSS+K+AL
Sbjct  125  ENRGGLSKVFGYLGLNSNEMFLVKCVIAAGQEHALCMNYEEAFGEEEEEYTVRSSVKNAL  184

Query  534  YALAEMIEKWEVN  572
            YAL EMIE+++VN
Sbjct  185  YALVEMIERFDVN  197



>ref|XP_009116297.1| PREDICTED: uncharacterized protein LOC103841505 isoform X1 [Brassica 
rapa]
Length=874

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = +3

Query  204  SRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            +RVST PVEY  P P    DF  EI RLK+L +++        +  V+DSDSRV+ FF  
Sbjct  58   TRVSTVPVEYSTPTPPESDDFSSEIDRLKSLLTKLDVSNDQRRKEAVIDSDSRVRRFFSE  117

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
               G S+ LG L LD  E+FL+KC++AAGQEH L           E  + RSS+K+ALYA
Sbjct  118  NRGGLSKVLGSLGLDSREMFLVKCVIAAGQEHALCVGYEETFEEEEEYTVRSSVKTALYA  177

Query  540  LAEMIEKWEVN  572
            L EMIE+++VN
Sbjct  178  LVEMIERFDVN  188



>ref|XP_009116298.1| PREDICTED: uncharacterized protein LOC103841505 isoform X2 [Brassica 
rapa]
Length=872

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = +3

Query  204  SRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYS  377
            +RVST PVEY  P P    DF  EI RLK+L +++        +  V+DSDSRV+ FF  
Sbjct  58   TRVSTVPVEYSTPTPPESDDFSSEIDRLKSLLTKLDVSNDQRRKEAVIDSDSRVRRFFSE  117

Query  378  RHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL------GEFGGEFDSARSSLKSALYA  539
               G S+ LG L LD  E+FL+KC++AAGQEH L           E  + RSS+K+ALYA
Sbjct  118  NRGGLSKVLGSLGLDSREMFLVKCVIAAGQEHALCVGYEETFEEEEEYTVRSSVKTALYA  177

Query  540  LAEMIEKWEVN  572
            L EMIE+++VN
Sbjct  178  LVEMIERFDVN  188



>ref|XP_003538476.2| PREDICTED: uncharacterized protein LOC100804343 isoform X1 [Glycine 
max]
Length=863

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 16/132 (12%)
 Frame = +3

Query  201  VSRVSTAPVEY---VPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFF  371
            V+R+ST  +E     PP P F+F +EI RL +LR R++ C +L+ ++RV+D+DSRVK FF
Sbjct  49   VARISTETLEVSPPPPPPPGFNFRREIARLASLRDRLAACTTLNEKLRVMDADSRVKRFF  108

Query  372  YSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS----------ARSSL  521
             SRH G +R L  L L   ++FLLKC+VAAGQEHVL    GE +S            S++
Sbjct  109  RSRH-GLARVLASLQLSSDQLFLLKCVVAAGQEHVLCL--GETESLESSASAAAATMSAV  165

Query  522  KSALYALAEMIE  557
            KSALYALAEMIE
Sbjct  166  KSALYALAEMIE  177



>ref|XP_006591388.1| PREDICTED: uncharacterized protein LOC100804343 isoform X2 [Glycine 
max]
Length=837

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 16/132 (12%)
 Frame = +3

Query  201  VSRVSTAPVEY---VPPAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFF  371
            V+R+ST  +E     PP P F+F +EI RL +LR R++ C +L+ ++RV+D+DSRVK FF
Sbjct  49   VARISTETLEVSPPPPPPPGFNFRREIARLASLRDRLAACTTLNEKLRVMDADSRVKRFF  108

Query  372  YSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFDS----------ARSSL  521
             SRH G +R L  L L   ++FLLKC+VAAGQEHVL    GE +S            S++
Sbjct  109  RSRH-GLARVLASLQLSSDQLFLLKCVVAAGQEHVLCL--GETESLESSASAAAATMSAV  165

Query  522  KSALYALAEMIE  557
            KSALYALAEMIE
Sbjct  166  KSALYALAEMIE  177



>ref|XP_010427408.1| PREDICTED: uncharacterized protein LOC104712253 [Camelina sativa]
Length=889

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 15/138 (11%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIR--VVDSDSRVKSF  368
            V  VST PVEY  P P    DF  EI RLK+LR+++ D +S D R +  V+D+D RV+ F
Sbjct  67   VRHVSTVPVEYPTPTPPESDDFLSEIDRLKSLRAKL-DVSSKDLRRKDAVIDADPRVRRF  125

Query  369  FYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL----------GEFGGEFDSARSS  518
            F     G S+ LG L L+  E+FL+KC++AAGQEH +           E   E  + RSS
Sbjct  126  FSENRGGLSKVLGSLGLNSEEMFLVKCVIAAGQEHAICMNYEEGFEEEEEEEEEYTVRSS  185

Query  519  LKSALYALAEMIEKWEVN  572
            +K+ALYAL EMIE+++VN
Sbjct  186  VKNALYALVEMIERFDVN  203



>ref|XP_006292431.1| hypothetical protein CARUB_v10018646mg [Capsella rubella]
 gb|EOA25329.1| hypothetical protein CARUB_v10018646mg [Capsella rubella]
Length=879

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (64%), Gaps = 8/132 (6%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V  VST PVEY  P P    DF  EI RLK+L +++     L  +  V+D+DSRV+ FF 
Sbjct  62   VRHVSTVPVEYSTPTPPESDDFLSEIDRLKSLLAKLDVSKDLRRKDAVIDADSRVRRFFS  121

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLG-EFGGEFD-----SARSSLKSALY  536
                G ++ LG L L+  ++FL+KC++AAGQEH L   +G  F+     + RSS+K+ALY
Sbjct  122  ENRGGLAKVLGSLGLNSKDMFLVKCVIAAGQEHALCMNYGEAFEEEEEYTVRSSVKNALY  181

Query  537  ALAEMIEKWEVN  572
            AL EMIE+++VN
Sbjct  182  ALVEMIERFDVN  193



>gb|AAK68751.1| putative protein [Arabidopsis thaliana]
 gb|AAL47372.1| putative protein [Arabidopsis thaliana]
Length=503

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 80/133 (60%), Gaps = 9/133 (7%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAPDF--DFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V  VST PVEY  P P    DF  EI RLK+L S++     L  +  V+D+DSRV+ FF 
Sbjct  65   VRHVSTVPVEYSTPTPPESDDFLSEIDRLKSLLSKLDVSKDLRRKDAVIDADSRVRRFFS  124

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL-------GEFGGEFDSARSSLKSAL  533
                G S+  G L L+  E+FL+KC++AAGQEH L            E  + RSS+K+AL
Sbjct  125  ENRGGLSKVFGYLGLNSNEMFLVKCVIAAGQEHALCMNYEEAFGEEEEEYTVRSSVKNAL  184

Query  534  YALAEMIEKWEVN  572
            YAL EMIE+++VN
Sbjct  185  YALVEMIERFDVN  197



>gb|KFK34847.1| hypothetical protein AALP_AA5G200800 [Arabis alpina]
Length=870

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 79/131 (60%), Gaps = 7/131 (5%)
 Frame = +3

Query  201  VSRVSTAPVEYVPPAP--DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFY  374
            V RVST PVEY  P P    DF  EI RLK+LRS++     +  +  V+DSDSRV+ FF 
Sbjct  54   VRRVSTVPVEYSTPTPPESDDFLSEIDRLKSLRSKLDVSKDIRRKESVIDSDSRVRRFFS  113

Query  375  SRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVL-----GEFGGEFDSARSSLKSALYA  539
                G  +      L+  E FL+KC++AAGQEH L       F  E  + R+S+K+ALYA
Sbjct  114  ENRGGLCKVFDSFGLNSKETFLIKCVIAAGQEHALCVGYEEAFEEEEYTVRNSVKNALYA  173

Query  540  LAEMIEKWEVN  572
            L EMIE+++VN
Sbjct  174  LVEMIERFDVN  184



>ref|XP_006847401.1| hypothetical protein AMTR_s00153p00036670 [Amborella trichopoda]
 gb|ERN08982.1| hypothetical protein AMTR_s00153p00036670 [Amborella trichopoda]
Length=904

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 58/139 (42%), Positives = 75/139 (54%), Gaps = 18/139 (13%)
 Frame = +3

Query  210  VSTAPVEYVP--PAPDFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRH  383
            VST  VE+    P P+     E+ RL ALR+ +S    +  +I V+D + RVK+FFY+  
Sbjct  78   VSTVSVEHSSDTPTPESKLETELARLVALRAVLSQANGMSEKIAVLDKEPRVKNFFYNNT  137

Query  384  SGFSRFLGVLNLDKYEVFLLKCLVAAGQEHV-------LGEFGGEFDSAR---------S  515
            +        L LD+ E++LLKCLVA+GQ HV       L E  G FD  R         S
Sbjct  138  NINGGVFASLKLDQSELYLLKCLVASGQGHVLQIDPFWLDEGIGGFDLERENGSSKGYGS  197

Query  516  SLKSALYALAEMIEKWEVN  572
            SLKSA Y L  MIEK+E N
Sbjct  198  SLKSAFYVLLGMIEKFEAN  216



>gb|EEC79378.1| hypothetical protein OsI_20285 [Oryza sativa Indica Group]
Length=860

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 76/147 (52%), Gaps = 37/147 (25%)
 Frame = +3

Query  210  VSTAPVEY-VPPAP-----------DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDS  353
            VSTAP+E  V P P           D     E+ RL ALR+R+    SL  ++R +D+++
Sbjct  21   VSTAPLERGVGPGPATSREQPRGGGDPALAAELARLSALRARLRGARSLADKLRALDAET  80

Query  354  RVKSFFYSRHSGFSRFLGVLN-LDKYEVFLLKCLVAAGQEHVLGEFGGEFD---------  503
            RV  FF    +G     GVL  L+  EVFLLKCLVAAGQEHVL   G E D         
Sbjct  81   RVVEFFGEGSNG-----GVLGALEPREVFLLKCLVAAGQEHVL---GAELDWDGRGHEHH  132

Query  504  -------SARSSLKSALYALAEMIEKW  563
                     RS+L+ AL +LA ++ KW
Sbjct  133  HHHNGGSDGRSALRQALSSLAALVGKW  159



>ref|XP_008656383.1| PREDICTED: uncharacterized protein LOC103635785 isoform X2 [Zea 
mays]
Length=827

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 74/149 (50%), Gaps = 38/149 (26%)
 Frame = +3

Query  210  VSTAPVEYVPP------AP--------DFDFHKEIGRLKALRSRISDCASLDGRIRVVDS  347
            VSTAP+E  PP      AP        D     E+ RL A R R+    +L  ++R +D+
Sbjct  61   VSTAPIEREPPGLAPTPAPTPAQQPHQDPAIAAEVARLSAARERLRAAHTLHEKLRALDA  120

Query  348  DSRVKSFFYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFD--------  503
            + RV +FF    S     LGVL  +  EV LLKCLVAAGQEHVLG    E D        
Sbjct  121  EPRVAAFFGEESS--RGVLGVL--EPREVLLLKCLVAAGQEHVLGH---ELDWYGGDGGH  173

Query  504  ---------SARSSLKSALYALAEMIEKW  563
                     S  S+L+ ALY+LA ++ KW
Sbjct  174  HEHHHRNGVSGGSALRDALYSLAGLVGKW  202



>ref|XP_008656382.1| PREDICTED: uncharacterized protein LOC103635785 isoform X1 [Zea 
mays]
Length=872

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 74/149 (50%), Gaps = 38/149 (26%)
 Frame = +3

Query  210  VSTAPVEYVPP------AP--------DFDFHKEIGRLKALRSRISDCASLDGRIRVVDS  347
            VSTAP+E  PP      AP        D     E+ RL A R R+    +L  ++R +D+
Sbjct  61   VSTAPIEREPPGLAPTPAPTPAQQPHQDPAIAAEVARLSAARERLRAAHTLHEKLRALDA  120

Query  348  DSRVKSFFYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFD--------  503
            + RV +FF    S     LGVL  +  EV LLKCLVAAGQEHVLG    E D        
Sbjct  121  EPRVAAFFGEESS--RGVLGVL--EPREVLLLKCLVAAGQEHVLGH---ELDWYGGDGGH  173

Query  504  ---------SARSSLKSALYALAEMIEKW  563
                     S  S+L+ ALY+LA ++ KW
Sbjct  174  HEHHHRNGVSGGSALRDALYSLAGLVGKW  202



>gb|AFW82285.1| hypothetical protein ZEAMMB73_228026 [Zea mays]
Length=964

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 74/149 (50%), Gaps = 38/149 (26%)
 Frame = +3

Query  210  VSTAPVEYVPP------AP--------DFDFHKEIGRLKALRSRISDCASLDGRIRVVDS  347
            VSTAP+E  PP      AP        D     E+ RL A R R+    +L  ++R +D+
Sbjct  61   VSTAPIEREPPGLAPTPAPTPAQQPHQDPAIAAEVARLSAARERLRAAHTLHEKLRALDA  120

Query  348  DSRVKSFFYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGEFGGEFD--------  503
            + RV +FF    S     LGVL  +  EV LLKCLVAAGQEHVLG    E D        
Sbjct  121  EPRVAAFFGEESS--RGVLGVL--EPREVLLLKCLVAAGQEHVLGH---ELDWYGGDGGH  173

Query  504  ---------SARSSLKSALYALAEMIEKW  563
                     S  S+L+ ALY+LA ++ KW
Sbjct  174  HEHHHRNGVSGGSALRDALYSLAGLVGKW  202



>gb|EYU43434.1| hypothetical protein MIMGU_mgv1a001986mg [Erythranthe guttata]
Length=730

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +3

Query  432  VFLLKCLVAAGQEHVLGEFG-----GEFDSARSSLKSALYALAEMIEKWEVNegggggvg  596
            ++LLKC+VAAGQEHVLG+FG     GE +  RS++K+ALY LAEMIE W++N  G     
Sbjct  1    MYLLKCVVAAGQEHVLGQFGRELENGELEMGRSAIKTALYTLAEMIENWDLNGRGTSHDF  60

Query  597  lglgeeevRALKSMLKSLG  653
                     AL+S+LK LG
Sbjct  61   KDEDRV---ALRSLLKMLG  76



>gb|KHN04776.1| hypothetical protein glysoja_031876 [Glycine soja]
Length=772

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +3

Query  345  SDSRVKSFFYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHV--LGEFGG-EFDSARS  515
            SDSRVK FF SR  G +  L  L L   ++FLLKC+VAAGQEHV  LGE    E   A S
Sbjct  14   SDSRVKRFFRSRR-GLAGVLASLQLSSDQLFLLKCVVAAGQEHVLCLGETESLESSVATS  72

Query  516  SLKSALYALAEMIE  557
            ++KSALY LA+MIE
Sbjct  73   AVKSALYTLADMIE  86



>gb|EPS63541.1| hypothetical protein M569_11245, partial [Genlisea aurea]
Length=198

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +3

Query  432  VFLLKCLVAAGQEHVLGE-FGGEFDSAR----SSLKSALYALAEMIEKWEVNegggggvg  596
            V+L+KC+VAAGQEHV GE F  + D A+    +++K+ALYALAEMIE W+V++  G G  
Sbjct  1    VYLVKCVVAAGQEHVFGEDFMRDLDDAQARKGTAIKNALYALAEMIETWDVHDTFGTGTF  60

Query  597  lglgeeevRALKSMLKSL  650
                +  +RAL +ML+ +
Sbjct  61   DIEDKVALRALLNMLEEV  78



>gb|EEE64040.1| hypothetical protein OsJ_18869 [Oryza sativa Japonica Group]
Length=1033

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 25/108 (23%)
 Frame = +3

Query  291  RSRISDCASLDGRIRVVDSDSRVKSFFYSRHSGFSRFLGVLN-LDKYEVFLLKCLVAAGQ  467
            R+R+    SL  ++R +D+++RV  FF    +G     GVL  L+  EVFLLKCLVAAGQ
Sbjct  233  RARLRGARSLADKLRALDAETRVVEFFGEGSNG-----GVLGALEPREVFLLKCLVAAGQ  287

Query  468  EHVLGEFGGEFD----------------SARSSLKSALYALAEMIEKW  563
            EHVL   G E D                  RS+L+ AL +LA ++ KW
Sbjct  288  EHVL---GAELDWDGRGHEHHHHHNGGSDGRSALRQALSSLAALVGKW  332



>ref|XP_002439938.1| hypothetical protein SORBIDRAFT_09g023020 [Sorghum bicolor]
 gb|EES18368.1| hypothetical protein SORBIDRAFT_09g023020 [Sorghum bicolor]
Length=377

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 20/120 (17%)
 Frame = +3

Query  249  DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDSRVKSFFYSRHSGFSRFLGVLN-LDK  425
            D     E+ RL A R R+    +L  ++R +D++ RV +FF     G     GVL  L+ 
Sbjct  88   DPAIAAEVARLSAARERLRAARTLRDKLRALDAEPRVAAFF-----GKDSSRGVLGALEP  142

Query  426  YEVFLLKCLVAAGQEHVLGE----FGGEFD----------SARSSLKSALYALAEMIEKW  563
             EV LLKCLVAAGQEHVLG     +GG+            S  S+L+ ALY+LA ++ KW
Sbjct  143  REVLLLKCLVAAGQEHVLGYELDWYGGDGRHEHHHRNGGVSGGSALRDALYSLAGLVGKW  202



>ref|NP_001055800.2| Os05g0468600 [Oryza sativa Japonica Group]
 dbj|BAF17714.2| Os05g0468600 [Oryza sativa Japonica Group]
Length=850

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 25/108 (23%)
 Frame = +3

Query  291  RSRISDCASLDGRIRVVDSDSRVKSFFYSRHSGFSRFLGVLN-LDKYEVFLLKCLVAAGQ  467
            R+R+    SL  ++R +D+++RV  FF    +G     GVL  L+  EVFLLKCLVAAGQ
Sbjct  96   RARLRGARSLADKLRALDAETRVVEFFGEGSNG-----GVLGALEPREVFLLKCLVAAGQ  150

Query  468  EHVLGEFGGEFD----------------SARSSLKSALYALAEMIEKW  563
            EHVL   G E D                  RS+L+ AL +LA ++ KW
Sbjct  151  EHVL---GAELDWDGRGHEHHHHHNGGSDGRSALRQALSSLAALVGKW  195



>gb|AAT47007.1| unknown protein [Oryza sativa Japonica Group]
Length=808

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 25/108 (23%)
 Frame = +3

Query  291  RSRISDCASLDGRIRVVDSDSRVKSFFYSRHSGFSRFLGVLN-LDKYEVFLLKCLVAAGQ  467
            R+R+    SL  ++R +D+++RV  FF    +G     GVL  L+  EVFLLKCLVAAGQ
Sbjct  96   RARLRGARSLADKLRALDAETRVVEFFGEGSNG-----GVLGALEPREVFLLKCLVAAGQ  150

Query  468  EHVLGEFGGEFD----------------SARSSLKSALYALAEMIEKW  563
            EHVL   G E D                  RS+L+ AL +LA ++ KW
Sbjct  151  EHVL---GAELDWDGRGHEHHHHHNGGSDGRSALRQALSSLAALVGKW  195



>ref|XP_003566160.2| PREDICTED: UDP-sugar pyrophosphorylase [Brachypodium distachyon]
Length=865

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 15/94 (16%)
 Frame = +3

Query  315  SLDGRIRVVDSDSRVKSFFYSRHSGFSRFLGVLNLDKYEVFLLKCLVAAGQEHVLGE---  485
            SLD ++R +D++  V  FF     G    +GVL     EV+LLKCLVAAGQ+HVLG    
Sbjct  103  SLDDKLRALDAEPHVAGFFSEATRG--GVMGVLK--PREVYLLKCLVAAGQDHVLGMELD  158

Query  486  -FGGEFDSAR-------SSLKSALYALAEMIEKW  563
              GG ++  R       S+L+ ALY+LA ++ KW
Sbjct  159  WAGGSYERHRNGGGGGGSALREALYSLAGLVGKW  192



>dbj|BAJ85276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=854

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 75/138 (54%), Gaps = 23/138 (17%)
 Frame = +3

Query  204  SRVSTAPVEYVP-PAP---------DFDFHKEIGRLKALRSRISDCASLDGRIRVVDSDS  353
             RVSTA  E+ P P P         D     E+ RL A R+R+    SL  ++R +D++ 
Sbjct  51   QRVSTASPEHGPGPGPSAEQQPRPHDQALAAEVARLSAARARLRAARSLADKLRALDAEP  110

Query  354  RVKSFFYSRHSGFSRFLGVL-NLDKYEVFLLKCLVAAGQEHVLG-----EFGGEFDSAR-  512
            RV +FF     G +   GVL  L   E +LLKCLVAAGQ+HVLG       GG  +  R 
Sbjct  111  RVAAFF-----GDASSRGVLAGLQPREAYLLKCLVAAGQDHVLGAELGWAGGGSHERPRN  165

Query  513  -SSLKSALYALAEMIEKW  563
             S+L+ ALY+LA ++ KW
Sbjct  166  GSALREALYSLAGLVGKW  183



>ref|XP_006655397.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Oryza brachyantha]
Length=818

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 51/94 (54%), Gaps = 24/94 (26%)
 Frame = +3

Query  330  IRVVDSDSRVKSFFYSRHSGFSRFLGVLN-LDKYEVFLLKCLVAAGQEHVLGEFGGEFDS  506
            +R +D++ RV  FF    +G     GVL  L+  EVFLLKCLVAAGQEHVL   G E D 
Sbjct  62   LRALDAEPRVVEFFGEGSNG-----GVLGALEPREVFLLKCLVAAGQEHVL---GAELDW  113

Query  507  ARSS---------------LKSALYALAEMIEKW  563
              SS               L+ ALY+LA ++ KW
Sbjct  114  DGSSQEHHHHHNGGSNGSALRQALYSLAGLVGKW  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875