BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047M10

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630891.1|  PREDICTED: UDP-galactose transporter 2-like        306   5e-100   Nicotiana tomentosiformis
ref|XP_009797956.1|  PREDICTED: UDP-galactose transporter 2-like        303   6e-99    Nicotiana sylvestris
ref|XP_004237478.1|  PREDICTED: UDP-galactose transporter 2             299   2e-97    Solanum lycopersicum
ref|XP_006357353.1|  PREDICTED: UDP-galactose transporter 2-like ...    296   3e-96    Solanum tuberosum [potatoes]
emb|CDP12866.1|  unnamed protein product                                293   6e-95    Coffea canephora [robusta coffee]
ref|XP_011100070.1|  PREDICTED: UDP-galactose transporter 2-like        286   2e-92    Sesamum indicum [beniseed]
gb|EYU31111.1|  hypothetical protein MIMGU_mgv1a0096511mg               281   5e-92    Erythranthe guttata [common monkey flower]
gb|EYU30281.1|  hypothetical protein MIMGU_mgv1a009610mg                282   7e-91    Erythranthe guttata [common monkey flower]
ref|XP_006427930.1|  hypothetical protein CICLE_v10027192mg             277   2e-90    
ref|XP_010242229.1|  PREDICTED: UDP-galactose transporter 2-like        281   2e-90    Nelumbo nucifera [Indian lotus]
ref|XP_004502879.1|  PREDICTED: UDP-galactose transporter 2-like ...    280   7e-90    
emb|CBI21537.3|  unnamed protein product                                279   1e-89    Vitis vinifera
ref|XP_002278813.1|  PREDICTED: UDP-galactose transporter 2             279   1e-89    Vitis vinifera
dbj|BAE98980.1|  hypothetical protein                                   278   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437993.1|  PREDICTED: UDP-galactose transporter 2-like        278   2e-89    Camelina sativa [gold-of-pleasure]
ref|NP_192719.1|  Nucleotide-sugar transporter family protein           278   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006464516.1|  PREDICTED: UDP-galactose transporter 2-like ...    277   7e-89    Citrus sinensis [apfelsine]
ref|XP_004496438.1|  PREDICTED: UDP-galactose transporter 2-like        276   8e-89    Cicer arietinum [garbanzo]
gb|KDP35285.1|  hypothetical protein JCGZ_09444                         276   1e-88    Jatropha curcas
ref|XP_003518502.1|  PREDICTED: UDP-galactose transporter 2-like        276   1e-88    Glycine max [soybeans]
ref|XP_003523251.1|  PREDICTED: UDP-galactose transporter 2-like ...    276   1e-88    Glycine max [soybeans]
ref|NP_001239895.1|  uncharacterized protein LOC100800306               276   2e-88    Glycine max [soybeans]
gb|ACU24339.1|  unknown                                                 276   2e-88    Glycine max [soybeans]
ref|XP_010262106.1|  PREDICTED: UDP-galactose transporter 2-like ...    272   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_007143575.1|  hypothetical protein PHAVU_007G083300g             276   2e-88    Phaseolus vulgaris [French bean]
gb|EYU36556.1|  hypothetical protein MIMGU_mgv1a009740mg                275   3e-88    Erythranthe guttata [common monkey flower]
ref|XP_003592056.1|  Membrane protein, putative                         274   5e-88    
ref|XP_010421887.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-galactos...    275   6e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006585315.1|  PREDICTED: UDP-galactose transporter 2-like ...    275   6e-88    Glycine max [soybeans]
ref|NP_001242035.1|  uncharacterized protein LOC100814890               275   7e-88    Glycine max [soybeans]
ref|XP_009335133.1|  PREDICTED: UDP-galactose transporter 2-like        275   7e-88    Pyrus x bretschneideri [bai li]
ref|XP_006579458.1|  PREDICTED: uncharacterized protein LOC100814...    275   7e-88    Glycine max [soybeans]
ref|XP_006585314.1|  PREDICTED: UDP-galactose transporter 2-like ...    275   1e-87    
ref|XP_007137579.1|  hypothetical protein PHAVU_009G138400g             274   1e-87    Phaseolus vulgaris [French bean]
ref|XP_008440118.1|  PREDICTED: UDP-galactose transporter 2             273   2e-87    Cucumis melo [Oriental melon]
ref|XP_009134166.1|  PREDICTED: UDP-galactose transporter 2-like        273   2e-87    Brassica rapa
ref|XP_002533887.1|  organic anion transporter, putative                273   3e-87    Ricinus communis
ref|XP_006599473.1|  PREDICTED: UDP-galactose transporter 2-like ...    273   3e-87    Glycine max [soybeans]
ref|XP_008386368.1|  PREDICTED: UDP-galactose transporter 2             273   4e-87    
emb|CDY05079.1|  BnaC03g28770D                                          275   4e-87    
ref|XP_004504000.1|  PREDICTED: UDP-galactose transporter 2-like        273   4e-87    
ref|XP_010680321.1|  PREDICTED: UDP-galactose transporter 2             273   4e-87    
ref|XP_010262105.1|  PREDICTED: UDP-galactose transporter 2-like ...    272   9e-87    Nelumbo nucifera [Indian lotus]
ref|XP_007151969.1|  hypothetical protein PHAVU_004G090700g             271   9e-87    Phaseolus vulgaris [French bean]
emb|CDX90737.1|  BnaA03g24170D                                          273   1e-86    
gb|ACJ84819.1|  unknown                                                 271   1e-86    Medicago truncatula
ref|XP_003602507.1|  Membrane protein, putative                         271   1e-86    Medicago truncatula
ref|XP_002300904.2|  transporter-related family protein                 271   2e-86    
gb|KJB60019.1|  hypothetical protein B456_009G286100                    271   2e-86    Gossypium raimondii
ref|XP_009610489.1|  PREDICTED: UDP-galactose transporter 2-like        271   2e-86    Nicotiana tomentosiformis
ref|XP_009802605.1|  PREDICTED: UDP-galactose transporter 2-like        270   2e-86    Nicotiana sylvestris
ref|XP_010063828.1|  PREDICTED: UDP-galactose transporter 2-like        270   3e-86    Eucalyptus grandis [rose gum]
ref|XP_004157865.1|  PREDICTED: UDP-galactose transporter 2-like        270   5e-86    
ref|XP_007019594.1|  Nucleotide-sugar transporter family protein ...    270   5e-86    
ref|XP_004141972.1|  PREDICTED: UDP-galactose transporter 2-like        270   5e-86    Cucumis sativus [cucumbers]
ref|XP_011042896.1|  PREDICTED: UDP-galactose transporter 2-like        270   6e-86    Populus euphratica
ref|XP_011100915.1|  PREDICTED: UDP-galactose transporter 2-like        270   7e-86    Sesamum indicum [beniseed]
ref|NP_568059.1|  nucleotide sugar transporter-KT 1                     270   7e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145156.1|  PREDICTED: UDP-galactose transporter 2-like        270   7e-86    Brassica rapa
emb|CDY28389.1|  BnaA05g18510D                                          269   7e-86    Brassica napus [oilseed rape]
ref|XP_002310620.1|  transporter-related family protein                 268   2e-85    Populus trichocarpa [western balsam poplar]
gb|EYU24057.1|  hypothetical protein MIMGU_mgv1a009794mg                268   3e-85    Erythranthe guttata [common monkey flower]
ref|XP_008812584.1|  PREDICTED: UDP-galactose transporter 2-like        268   3e-85    Phoenix dactylifera
ref|XP_011025571.1|  PREDICTED: UDP-galactose transporter 2             267   4e-85    Populus euphratica
gb|KJB40431.1|  hypothetical protein B456_007G062900                    267   5e-85    Gossypium raimondii
gb|KHG07660.1|  UDP-galactose transporter 2 -like protein               267   6e-85    Gossypium arboreum [tree cotton]
emb|CDY12142.1|  BnaC03g60580D                                          267   6e-85    Brassica napus [oilseed rape]
ref|XP_002307514.1|  transporter-related family protein                 267   7e-85    Populus trichocarpa [western balsam poplar]
gb|KHN29130.1|  UDP-galactose transporter 2                             273   7e-85    Glycine soja [wild soybean]
emb|CDY15303.1|  BnaC06g07890D                                          267   8e-85    Brassica napus [oilseed rape]
ref|XP_010097649.1|  hypothetical protein L484_023789                   266   1e-84    Morus notabilis
ref|NP_001190967.1|  nucleotide sugar transporter-KT 1                  266   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336495.1|  PREDICTED: UDP-galactose transporter 2             266   1e-84    Pyrus x bretschneideri [bai li]
emb|CAB44674.1|  putative protein                                       266   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345493.1|  PREDICTED: UDP-galactose transporter 2-like        266   2e-84    Pyrus x bretschneideri [bai li]
ref|XP_011044274.1|  PREDICTED: UDP-galactose transporter 2             266   2e-84    Populus euphratica
ref|XP_003630136.1|  Membrane protein, putative                         266   2e-84    Medicago truncatula
ref|XP_009354062.1|  PREDICTED: UDP-galactose transporter 2-like        265   2e-84    Pyrus x bretschneideri [bai li]
ref|XP_008232334.1|  PREDICTED: UDP-galactose transporter 2             265   2e-84    Prunus mume [ume]
emb|CDX93736.1|  BnaA09g23360D                                          265   2e-84    
ref|XP_009114771.1|  PREDICTED: UDP-galactose transporter 2             265   2e-84    Brassica rapa
emb|CDP11437.1|  unnamed protein product                                265   3e-84    Coffea canephora [robusta coffee]
ref|XP_009345238.1|  PREDICTED: UDP-galactose transporter 2-like        265   3e-84    Pyrus x bretschneideri [bai li]
ref|XP_006284088.1|  hypothetical protein CARUB_v10005218mg             265   3e-84    Capsella rubella
ref|XP_007205521.1|  hypothetical protein PRUPE_ppa008448mg             265   3e-84    Prunus persica
gb|AAM64952.1|  unknown                                                 265   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866846.1|  hypothetical protein ARALYDRAFT_327889             265   3e-84    
ref|XP_006361615.1|  PREDICTED: UDP-galactose transporter 2-like        265   3e-84    Solanum tuberosum [potatoes]
ref|XP_009109471.1|  PREDICTED: UDP-galactose transporter 2             265   3e-84    Brassica rapa
dbj|BAL46503.1|  putative transmembrane protein                         265   4e-84    Diospyros kaki [Japanese persimmon]
ref|XP_007201810.1|  hypothetical protein PRUPE_ppa008384mg             265   4e-84    Prunus persica
ref|XP_010431909.1|  PREDICTED: UDP-galactose transporter 2-like ...    265   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010906037.1|  PREDICTED: UDP-galactose transporter 2-like        265   4e-84    Elaeis guineensis
ref|XP_010027747.1|  PREDICTED: UDP-galactose transporter 2             265   6e-84    Eucalyptus grandis [rose gum]
ref|XP_006411742.1|  hypothetical protein EUTSA_v10025667mg             265   6e-84    Eutrema salsugineum [saltwater cress]
ref|XP_010446483.1|  PREDICTED: UDP-galactose transporter 2-like ...    264   7e-84    Camelina sativa [gold-of-pleasure]
ref|XP_006290034.1|  hypothetical protein CARUB_v10003668mg             264   8e-84    Capsella rubella
ref|XP_007159783.1|  hypothetical protein PHAVU_002G266800g             264   1e-83    Phaseolus vulgaris [French bean]
gb|KHG12708.1|  UDP-galactose transporter 2 -like protein               264   1e-83    Gossypium arboreum [tree cotton]
ref|XP_008381856.1|  PREDICTED: UDP-galactose transporter 2-like        263   1e-83    
ref|XP_007048170.1|  Nucleotide-sugar transporter family protein ...    260   2e-83    
ref|XP_010932887.1|  PREDICTED: UDP-galactose transporter 2-like        263   2e-83    
ref|XP_008777064.1|  PREDICTED: UDP-galactose transporter 2-like ...    263   3e-83    Phoenix dactylifera
emb|CDY42623.1|  BnaC01g00350D                                          263   3e-83    Brassica napus [oilseed rape]
ref|XP_009119734.1|  PREDICTED: UDP-galactose transporter 2-like        262   4e-83    Brassica rapa
ref|XP_011100579.1|  PREDICTED: UDP-galactose transporter 2             262   4e-83    Sesamum indicum [beniseed]
gb|KJB59485.1|  hypothetical protein B456_009G258600                    259   5e-83    Gossypium raimondii
ref|XP_008378692.1|  PREDICTED: UDP-galactose transporter 2-like        262   5e-83    
ref|XP_006589484.1|  PREDICTED: UDP-galactose transporter 2-like ...    261   6e-83    Glycine max [soybeans]
ref|XP_010683206.1|  PREDICTED: UDP-galactose transporter 2-like        261   7e-83    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB59483.1|  hypothetical protein B456_009G258600                    259   8e-83    Gossypium raimondii
gb|KJB18354.1|  hypothetical protein B456_003G048300                    261   8e-83    Gossypium raimondii
ref|XP_003634527.1|  PREDICTED: UDP-galactose transporter 2             261   1e-82    Vitis vinifera
ref|XP_004252567.1|  PREDICTED: UDP-galactose transporter 2             261   1e-82    Solanum lycopersicum
ref|XP_004288090.1|  PREDICTED: UDP-galactose transporter 2             261   1e-82    Fragaria vesca subsp. vesca
gb|EPS62651.1|  hypothetical protein M569_12141                         256   1e-82    Genlisea aurea
ref|XP_010555309.1|  PREDICTED: UDP-galactose transporter 2             261   2e-82    Tarenaya hassleriana [spider flower]
ref|XP_011074099.1|  PREDICTED: UDP-galactose transporter 2-like        260   2e-82    Sesamum indicum [beniseed]
ref|XP_010538909.1|  PREDICTED: UDP-galactose transporter 2-like        260   4e-82    Tarenaya hassleriana [spider flower]
ref|XP_006647512.1|  PREDICTED: UDP-galactose transporter 2-like ...    259   4e-82    Oryza brachyantha
ref|XP_006305303.1|  hypothetical protein CARUB_v10009678mg             259   4e-82    Capsella rubella
ref|XP_007048167.1|  Nucleotide-sugar transporter family protein ...    259   5e-82    Theobroma cacao [chocolate]
gb|KJB59484.1|  hypothetical protein B456_009G258600                    259   7e-82    Gossypium raimondii
ref|XP_002307141.1|  transporter-related family protein                 259   8e-82    Populus trichocarpa [western balsam poplar]
ref|XP_004140956.1|  PREDICTED: UDP-galactose transporter 2-like        259   9e-82    Cucumis sativus [cucumbers]
ref|XP_011021966.1|  PREDICTED: UDP-galactose transporter 2-like        259   9e-82    Populus euphratica
ref|NP_564433.1|  nucleotide-sugar transporter family protein           259   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008456746.1|  PREDICTED: UDP-galactose transporter 2-like        258   1e-81    Cucumis melo [Oriental melon]
ref|XP_006842618.1|  hypothetical protein AMTR_s00077p00178780          258   2e-81    
ref|XP_002891071.1|  hypothetical protein ARALYDRAFT_473556             258   2e-81    
gb|KDO57105.1|  hypothetical protein CISIN_1g0430191mg                  252   3e-81    Citrus sinensis [apfelsine]
ref|XP_009416387.1|  PREDICTED: UDP-galactose transporter 2-like        257   4e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150661.1|  integral membrane protein like                     256   6e-81    Zea mays [maize]
ref|XP_006415048.1|  hypothetical protein EUTSA_v10008144mg             257   6e-81    Eutrema salsugineum [saltwater cress]
ref|XP_003575354.1|  PREDICTED: UDP-galactose transporter 2-like        256   7e-81    Brachypodium distachyon [annual false brome]
gb|AFW64703.1|  integral membrane protein like protein isoform 1        256   8e-81    
ref|XP_010530127.1|  PREDICTED: UDP-galactose transporter 2             256   8e-81    Tarenaya hassleriana [spider flower]
ref|XP_010531423.1|  PREDICTED: UDP-galactose transporter 2-like        256   9e-81    Tarenaya hassleriana [spider flower]
ref|XP_004953102.1|  PREDICTED: UDP-galactose transporter 2-like        256   1e-80    Setaria italica
ref|XP_002450200.1|  hypothetical protein SORBIDRAFT_05g001870          256   1e-80    Sorghum bicolor [broomcorn]
ref|XP_004982861.1|  PREDICTED: UDP-galactose transporter 2-like        256   2e-80    Setaria italica
ref|XP_006654160.1|  PREDICTED: UDP-galactose transporter 2-like ...    256   2e-80    
gb|AAM66068.1|  unknown                                                 255   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006434522.1|  hypothetical protein CICLE_v10001769mg             255   3e-80    Citrus clementina [clementine]
ref|NP_001148538.1|  integral membrane protein like                     255   3e-80    Zea mays [maize]
ref|XP_010461221.1|  PREDICTED: UDP-galactose transporter 2-like        255   3e-80    Camelina sativa [gold-of-pleasure]
gb|ACF86881.1|  unknown                                                 255   3e-80    Zea mays [maize]
ref|XP_010096478.1|  hypothetical protein L484_006725                   252   3e-80    
ref|XP_010499941.1|  PREDICTED: UDP-galactose transporter 2             255   3e-80    Camelina sativa [gold-of-pleasure]
gb|EEE62758.1|  hypothetical protein OsJ_17561                          254   4e-80    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054935.1|  Os05g0215800                                       254   4e-80    
ref|XP_009406813.1|  PREDICTED: UDP-galactose transporter 2-like        254   5e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419689.1|  PREDICTED: UDP-galactose transporter 2-like        254   6e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441741.1|  hypothetical protein SORBIDRAFT_08g001580          254   1e-79    Sorghum bicolor [broomcorn]
ref|NP_001047426.1|  Os02g0614500                                       253   1e-79    
gb|EEC73595.1|  hypothetical protein OsI_08063                          253   1e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_002969143.1|  hypothetical protein SELMODRAFT_170422             253   1e-79    
gb|KHG03706.1|  UDP-galactose transporter 2 -like protein               253   2e-79    Gossypium arboreum [tree cotton]
ref|XP_004978448.1|  PREDICTED: UDP-galactose transporter 2-like        253   3e-79    Setaria italica
gb|AAK50365.1|  putative transmembrane protein                          252   3e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EMS67795.1|  hypothetical protein TRIUR3_18539                       252   4e-79    Triticum urartu
ref|XP_004977451.1|  PREDICTED: UDP-galactose transporter 2-like        252   5e-79    Setaria italica
gb|KDP36558.1|  hypothetical protein JCGZ_08325                         251   9e-79    Jatropha curcas
ref|XP_003602508.1|  Membrane protein, putative                         246   1e-78    
ref|XP_010678762.1|  PREDICTED: UDP-galactose transporter 2-like        251   1e-78    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006663829.1|  PREDICTED: UDP-galactose transporter 2-like        251   1e-78    Oryza brachyantha
gb|EMT04054.1|  hypothetical protein F775_26901                         251   1e-78    
ref|NP_001149060.1|  integral membrane protein like                     249   4e-78    
ref|XP_003578985.1|  PREDICTED: UDP-galactose transporter 2-like        249   4e-78    Brachypodium distachyon [annual false brome]
gb|ACG35759.1|  integral membrane protein like                          249   6e-78    Zea mays [maize]
ref|NP_001131725.1|  integral membrane protein like protein isofo...    249   7e-78    Zea mays [maize]
ref|XP_006663828.1|  PREDICTED: UDP-galactose transporter 2-like        248   1e-77    Oryza brachyantha
tpg|DAA63396.1|  TPA: putative integral membrane protein                249   2e-77    
dbj|BAJ99966.1|  predicted protein                                      248   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN72212.1|  hypothetical protein VITISV_012257                     261   4e-77    Vitis vinifera
ref|NP_001066187.1|  Os12g0154600                                       246   8e-77    
gb|ABG21891.1|  transporter, putative, expressed                        245   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066185.1|  Os12g0154000                                       243   8e-76    
gb|ABA95848.2|  transporter, putative, expressed                        243   1e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EMS65678.1|  hypothetical protein TRIUR3_32365                       243   1e-75    Triticum urartu
dbj|BAJ95945.1|  predicted protein                                      243   1e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008672973.1|  PREDICTED: integral membrane protein like is...    243   2e-75    Zea mays [maize]
ref|NP_001150996.1|  integral membrane protein like                     242   3e-75    Zea mays [maize]
ref|XP_010444889.1|  PREDICTED: UDP-galactose transporter 2             240   3e-75    Camelina sativa [gold-of-pleasure]
gb|EMT23032.1|  hypothetical protein F775_28662                         242   2e-74    
gb|ACN28219.1|  unknown                                                 229   5e-72    Zea mays [maize]
gb|ACN34680.1|  unknown                                                 228   8e-72    Zea mays [maize]
ref|XP_010904726.1|  PREDICTED: UDP-galactose transporter 2-like ...    233   9e-72    Elaeis guineensis
gb|EMT00653.1|  hypothetical protein F775_29393                         231   4e-71    
dbj|BAJ85267.1|  predicted protein                                      231   4e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004976151.1|  PREDICTED: UDP-galactose transporter 2-like        231   5e-71    Setaria italica
ref|XP_003580096.1|  PREDICTED: UDP-galactose transporter 2-like        229   2e-70    Brachypodium distachyon [annual false brome]
gb|AFK39529.1|  unknown                                                 228   5e-70    Medicago truncatula
gb|EMS68535.1|  hypothetical protein TRIUR3_30184                       232   7e-70    Triticum urartu
gb|AES72759.2|  nucleotide/sugar transporter family protein             221   1e-67    Medicago truncatula
ref|XP_006434521.1|  hypothetical protein CICLE_v10001769mg             217   6e-66    
gb|KHG20906.1|  UDP-galactose transporter 2 -like protein               217   6e-66    Gossypium arboreum [tree cotton]
ref|XP_008777067.1|  PREDICTED: UDP-galactose transporter 2-like ...    215   3e-65    Phoenix dactylifera
dbj|BAJ88240.1|  predicted protein                                      211   4e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB18357.1|  hypothetical protein B456_003G048300                    215   4e-65    Gossypium raimondii
ref|XP_006647514.1|  PREDICTED: UDP-galactose transporter 2-like ...    209   1e-62    
ref|XP_007048169.1|  Nucleotide-sugar transporter family protein ...    208   2e-62    
ref|XP_008667952.1|  PREDICTED: integral membrane protein like is...    204   4e-61    Zea mays [maize]
ref|XP_009407105.1|  PREDICTED: uncharacterized protein LOC103989887    216   2e-60    
ref|XP_006397142.1|  hypothetical protein EUTSA_v10029422mg             191   5e-57    
ref|XP_010904727.1|  PREDICTED: UDP-galactose transporter 2-like ...    188   2e-54    
ref|XP_009124383.1|  PREDICTED: UDP-galactose transporter 2-like        176   3e-52    
gb|KJB18355.1|  hypothetical protein B456_003G048300                    175   3e-50    Gossypium raimondii
ref|XP_010090745.1|  hypothetical protein L484_013767                   166   1e-45    
ref|XP_001754835.1|  predicted protein                                  166   1e-45    
ref|XP_010684399.1|  PREDICTED: UDP-galactose transporter 2-like        165   3e-45    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001762353.1|  predicted protein                                  164   8e-45    
ref|XP_002865527.1|  hypothetical protein ARALYDRAFT_917531             160   2e-43    Arabidopsis lyrata subsp. lyrata
gb|KHN12124.1|  UDP-galactose transporter 2                             159   3e-43    Glycine soja [wild soybean]
ref|XP_006590383.1|  PREDICTED: UDP-galactose transporter 2-like        159   4e-43    Glycine max [soybeans]
ref|XP_008235850.1|  PREDICTED: UDP-galactose transporter 2-like        159   6e-43    Prunus mume [ume]
ref|XP_001754967.1|  predicted protein                                  159   6e-43    
ref|XP_002969958.1|  hypothetical protein SELMODRAFT_92835              158   1e-42    Selaginella moellendorffii
ref|XP_006305238.1|  hypothetical protein CARUB_v10009605mg             157   2e-42    Capsella rubella
ref|NP_199057.1|  Nucleotide-sugar transporter family protein           157   2e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778573.1|  PREDICTED: UDP-galactose transporter 2-like        157   3e-42    Phoenix dactylifera
gb|KHN05614.1|  UDP-galactose transporter 2                             156   4e-42    Glycine soja [wild soybean]
ref|NP_564133.1|  nucleotide-sugar transporter-like protein             156   4e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270661.1|  PREDICTED: UDP-galactose transporter 2-like        156   5e-42    Nelumbo nucifera [Indian lotus]
ref|XP_001762447.1|  predicted protein                                  156   6e-42    
ref|XP_009607659.1|  PREDICTED: UDP-galactose transporter 2             156   7e-42    Nicotiana tomentosiformis
ref|XP_010481989.1|  PREDICTED: UDP-galactose transporter 2-like        156   8e-42    Camelina sativa [gold-of-pleasure]
emb|CDX88307.1|  BnaC06g37510D                                          155   8e-42    
ref|XP_010442167.1|  PREDICTED: UDP-galactose transporter 2-like        155   9e-42    Camelina sativa [gold-of-pleasure]
gb|KFK44204.1|  hypothetical protein AALP_AA1G228100                    155   9e-42    Arabis alpina [alpine rockcress]
ref|XP_010494178.1|  PREDICTED: UDP-galactose transporter 2-like        155   9e-42    Camelina sativa [gold-of-pleasure]
emb|CDP07234.1|  unnamed protein product                                155   1e-41    Coffea canephora [robusta coffee]
ref|XP_006279494.1|  hypothetical protein CARUB_v10026693mg             155   1e-41    Capsella rubella
gb|EYU41229.1|  hypothetical protein MIMGU_mgv1a009117mg                155   1e-41    Erythranthe guttata [common monkey flower]
ref|XP_010498559.1|  PREDICTED: UDP-galactose transporter 2-like        155   1e-41    Camelina sativa [gold-of-pleasure]
ref|XP_010477366.1|  PREDICTED: UDP-galactose transporter 2-like        155   1e-41    Camelina sativa [gold-of-pleasure]
ref|NP_001242197.1|  uncharacterized protein LOC100780365               155   2e-41    
ref|XP_008346270.1|  PREDICTED: UDP-galactose transporter 2-like        155   2e-41    
ref|XP_002893149.1|  hypothetical protein ARALYDRAFT_889562             155   2e-41    Arabidopsis lyrata subsp. lyrata
emb|CDX87574.1|  BnaA07g32990D                                          155   2e-41    
gb|AAM61035.1|  unknown                                                 155   2e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927488.1|  PREDICTED: UDP-galactose transporter 2 isofo...    154   2e-41    
gb|KFK32924.1|  hypothetical protein AALP_AA6G307000                    154   2e-41    Arabis alpina [alpine rockcress]
ref|XP_010459808.1|  PREDICTED: UDP-galactose transporter 2-like        154   2e-41    Camelina sativa [gold-of-pleasure]
ref|XP_008235851.1|  PREDICTED: UDP-galactose transporter 2-like        154   3e-41    Prunus mume [ume]
ref|XP_007200355.1|  hypothetical protein PRUPE_ppa008188mg             154   3e-41    Prunus persica
ref|XP_006416334.1|  hypothetical protein EUTSA_v10008081mg             154   3e-41    Eutrema salsugineum [saltwater cress]
ref|XP_004253110.1|  PREDICTED: UDP-galactose transporter 2             154   3e-41    
ref|XP_010927487.1|  PREDICTED: UDP-galactose transporter 2 isofo...    154   3e-41    Elaeis guineensis
ref|XP_007157247.1|  hypothetical protein PHAVU_002G054900g             154   3e-41    Phaseolus vulgaris [French bean]
ref|XP_006403391.1|  hypothetical protein EUTSA_v10003241mg             154   4e-41    Eutrema salsugineum [saltwater cress]
ref|XP_010266319.1|  PREDICTED: UDP-galactose transporter 2-like        154   4e-41    Nelumbo nucifera [Indian lotus]
ref|XP_006342521.1|  PREDICTED: UDP-galactose transporter 2-like        154   5e-41    Solanum tuberosum [potatoes]
gb|EPS67006.1|  hypothetical protein M569_07768                         153   5e-41    Genlisea aurea
ref|XP_008796579.1|  PREDICTED: UDP-galactose transporter 2             154   5e-41    Phoenix dactylifera
ref|XP_010537259.1|  PREDICTED: UDP-galactose transporter 2             154   6e-41    Tarenaya hassleriana [spider flower]
gb|ACN28074.1|  unknown                                                 151   6e-41    Zea mays [maize]
ref|XP_001769568.1|  predicted protein                                  153   8e-41    
ref|XP_010943153.1|  PREDICTED: UDP-galactose transporter 2-like        153   1e-40    Elaeis guineensis
ref|XP_009106334.1|  PREDICTED: UDP-galactose transporter 2             152   2e-40    Brassica rapa
ref|XP_001760216.1|  predicted protein                                  152   2e-40    
ref|XP_006390165.1|  hypothetical protein EUTSA_v10018800mg             152   2e-40    Eutrema salsugineum [saltwater cress]
ref|XP_008382528.1|  PREDICTED: UDP-galactose transporter 2-like        152   2e-40    
dbj|BAJ33722.1|  unnamed protein product                                152   2e-40    Eutrema halophilum
gb|EPS70342.1|  hypothetical protein M569_04417                         152   2e-40    Genlisea aurea
ref|XP_011074037.1|  PREDICTED: UDP-galactose transporter 2             151   3e-40    Sesamum indicum [beniseed]
emb|CDY29480.1|  BnaA06g14900D                                          151   4e-40    Brassica napus [oilseed rape]
ref|XP_009358925.1|  PREDICTED: UDP-galactose transporter 2-like        150   5e-40    Pyrus x bretschneideri [bai li]
ref|XP_010061361.1|  PREDICTED: UDP-galactose transporter 2-like        151   6e-40    Eucalyptus grandis [rose gum]
ref|XP_010063200.1|  PREDICTED: UDP-galactose transporter 2-like ...    150   6e-40    
ref|XP_010094477.1|  hypothetical protein L484_024768                   150   7e-40    Morus notabilis
ref|XP_007199951.1|  hypothetical protein PRUPE_ppb006058mg             151   7e-40    
gb|ACL54282.1|  unknown                                                 150   9e-40    Zea mays [maize]
ref|XP_002463085.1|  hypothetical protein SORBIDRAFT_02g037520          150   1e-39    Sorghum bicolor [broomcorn]
ref|NP_565138.1|  Nucleotide-sugar transporter family protein           150   1e-39    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150491.1|  LOC100284122                                       150   1e-39    Zea mays [maize]
gb|ACN29131.1|  unknown                                                 150   1e-39    Zea mays [maize]
ref|XP_010063199.1|  PREDICTED: UDP-galactose transporter 2-like ...    150   1e-39    Eucalyptus grandis [rose gum]
ref|XP_009149586.1|  PREDICTED: UDP-galactose transporter 2-like ...    150   1e-39    Brassica rapa
ref|XP_002889095.1|  hypothetical protein ARALYDRAFT_476826             150   1e-39    
gb|EPS61546.1|  hypothetical protein M569_13251                         149   2e-39    
emb|CDY33666.1|  BnaC08g19660D                                          149   3e-39    
ref|XP_010939035.1|  PREDICTED: UDP-galactose transporter 2-like        149   3e-39    
ref|XP_009110198.1|  PREDICTED: UDP-galactose transporter 2-like        149   3e-39    
gb|KDP36706.1|  hypothetical protein JCGZ_07997                         149   3e-39    
ref|XP_011458117.1|  PREDICTED: UDP-galactose transporter 2-like        148   4e-39    
ref|XP_010932187.1|  PREDICTED: UDP-galactose transporter 2             148   4e-39    
ref|XP_004154521.1|  PREDICTED: UDP-galactose transporter 2-like        149   4e-39    
ref|XP_006435519.1|  hypothetical protein CICLE_v10001709mg             148   5e-39    
emb|CDX71559.1|  BnaC04g17940D                                          148   8e-39    
ref|XP_007018603.1|  Nucleotide-sugar transporter family protein        147   1e-38    
ref|XP_006302481.1|  hypothetical protein CARUB_v10020575mg             147   1e-38    
gb|KFK42080.1|  hypothetical protein AALP_AA2G208600                    147   1e-38    
ref|XP_008448146.1|  PREDICTED: UDP-galactose transporter 2-like        148   1e-38    
ref|XP_002514380.1|  organic anion transporter, putative                147   1e-38    
ref|XP_004139986.1|  PREDICTED: UDP-galactose transporter 2-like        148   1e-38    
ref|XP_009386154.1|  PREDICTED: UDP-galactose transporter 2-like        147   1e-38    
gb|EMT30396.1|  hypothetical protein F775_27931                         147   2e-38    
ref|XP_010428732.1|  PREDICTED: UDP-galactose transporter 2             147   2e-38    
ref|XP_009414762.1|  PREDICTED: UDP-galactose transporter 2-like        146   3e-38    
gb|KHN09562.1|  UDP-galactose transporter 2                             143   3e-38    
ref|XP_006429823.1|  hypothetical protein CICLE_v10012072mg             146   3e-38    
ref|XP_011041092.1|  PREDICTED: UDP-galactose transporter 2             145   5e-38    
ref|XP_010555797.1|  PREDICTED: UDP-galactose transporter 2-like        146   5e-38    
ref|XP_002307836.1|  transporter-related family protein                 145   5e-38    
ref|XP_010416591.1|  PREDICTED: UDP-galactose transporter 2-like        145   5e-38    
ref|XP_011034738.1|  PREDICTED: UDP-galactose transporter 2             145   6e-38    
ref|NP_001060103.1|  Os07g0581000                                       145   6e-38    
gb|KHG19793.1|  UDP-galactose transporter 2 -like protein               145   6e-38    
ref|XP_002300605.1|  transporter-related family protein                 145   7e-38    
ref|XP_004300063.1|  PREDICTED: UDP-galactose transporter 2-like        145   8e-38    
ref|XP_006492897.1|  PREDICTED: UDP-galactose transporter 2-like        145   1e-37    
ref|XP_006849892.1|  hypothetical protein AMTR_s00022p00090650          145   1e-37    
ref|XP_006657883.1|  PREDICTED: UDP-galactose transporter 2-like        144   1e-37    
ref|XP_004958132.1|  PREDICTED: UDP-galactose transporter 2-like        144   2e-37    
gb|KJB47139.1|  hypothetical protein B456_008G012200                    144   2e-37    
ref|XP_009396888.1|  PREDICTED: UDP-galactose transporter 2-like        144   2e-37    
ref|XP_004511275.1|  PREDICTED: UDP-galactose transporter 2-like ...    143   4e-37    
ref|XP_004511276.1|  PREDICTED: UDP-galactose transporter 2-like ...    143   5e-37    
dbj|BAJ96171.1|  predicted protein                                      139   6e-37    
ref|XP_002278064.1|  PREDICTED: UDP-galactose transporter 2             142   6e-37    
ref|XP_007157245.1|  hypothetical protein PHAVU_002G054900g             140   2e-36    
gb|KDO50181.1|  hypothetical protein CISIN_1g0194682mg                  138   3e-36    
gb|KDP47057.1|  hypothetical protein JCGZ_10784                         140   3e-36    
ref|NP_001241748.1|  integral membrane protein like                     140   3e-36    
ref|XP_008651781.1|  PREDICTED: uncharacterized protein LOC100384...    140   4e-36    
ref|XP_008795633.1|  PREDICTED: UDP-galactose transporter 2-like        140   4e-36    
gb|KEH27299.1|  nucleotide/sugar transporter family protein             140   5e-36    
gb|KJB18356.1|  hypothetical protein B456_003G048300                    137   6e-36    
ref|XP_010533408.1|  PREDICTED: UDP-galactose transporter 2-like        140   7e-36    
ref|XP_009408432.1|  PREDICTED: UDP-galactose transporter 2-like ...    139   1e-35    
emb|CDY04594.1|  BnaC05g16320D                                          140   1e-35    
ref|XP_008235920.1|  PREDICTED: UDP-galactose transporter 2-like        139   1e-35    
emb|CDX95180.1|  BnaC09g16900D                                          139   1e-35    
ref|XP_002510764.1|  organic anion transporter, putative                139   2e-35    
gb|EYU36617.1|  hypothetical protein MIMGU_mgv1a009294mg                139   2e-35    
gb|KCW70404.1|  hypothetical protein EUGRSUZ_F03638                     137   2e-35    
emb|CDP11440.1|  unnamed protein product                                135   2e-35    
ref|XP_008453042.1|  PREDICTED: UDP-galactose transporter 2-like        138   3e-35    
emb|CDY52304.1|  BnaA09g16160D                                          138   5e-35    
ref|XP_009113448.1|  PREDICTED: UDP-galactose transporter 2             138   5e-35    
gb|KJB31918.1|  hypothetical protein B456_005G214900                    135   5e-35    
ref|XP_003562824.2|  PREDICTED: UDP-galactose transporter 2-like        137   6e-35    
ref|XP_004150968.1|  PREDICTED: UDP-galactose transporter 2-like        137   9e-35    
gb|ACN31946.1|  unknown                                                 133   2e-34    
gb|AFW64701.1|  hypothetical protein ZEAMMB73_900572                    133   2e-34    
gb|KHG20996.1|  UDP-galactose transporter 2 -like protein               136   2e-34    
gb|KJB31917.1|  hypothetical protein B456_005G214900                    135   4e-34    
ref|XP_008796458.1|  PREDICTED: UDP-galactose transporter 2             135   5e-34    
tpg|DAA63320.1|  TPA: hypothetical protein ZEAMMB73_067234              130   5e-34    
gb|KEH40271.1|  nucleotide/sugar transporter family protein             134   9e-34    
ref|XP_007200195.1|  hypothetical protein PRUPE_ppa016081mg             134   1e-33    
gb|KJB77442.1|  hypothetical protein B456_012G137400                    134   1e-33    
emb|CAN67265.1|  hypothetical protein VITISV_028728                     129   2e-33    
tpg|DAA63318.1|  TPA: hypothetical protein ZEAMMB73_067234              130   3e-33    
ref|XP_007043142.1|  Nucleotide-sugar transporter family protein ...    129   7e-33    
ref|XP_007043141.1|  Nucleotide-sugar transporter family protein ...    129   1e-31    
ref|XP_002874590.1|  hypothetical protein ARALYDRAFT_489833             126   5e-31    
dbj|BAC42299.1|  unknown protein                                        126   7e-31    
ref|XP_007019596.1|  Nucleotide-sugar transporter family protein ...    124   1e-30    
gb|EMS67132.1|  hypothetical protein TRIUR3_26161                       124   5e-30    
ref|XP_002500152.1|  hypothetical protein MICPUN_113801                 124   6e-30    
ref|NP_001170519.1|  integral membrane protein like protein             119   2e-28    
ref|XP_005644080.1|  TPT-domain-containing protein                      117   1e-27    
ref|XP_007513501.1|  predicted protein                                  118   1e-27    
ref|XP_009149587.1|  PREDICTED: UDP-galactose transporter 2-like ...    116   4e-27    
gb|KDO85328.1|  hypothetical protein CISIN_1g019191mg                   114   9e-27    
ref|XP_002524332.1|  conserved hypothetical protein                     107   1e-26    
ref|XP_003057785.1|  Drug/Metabolite transporter superfamily            113   3e-26    
gb|KJB31920.1|  hypothetical protein B456_005G214900                    108   1e-24    
ref|XP_010918366.1|  PREDICTED: UDP-galactose transporter 2-like ...    105   2e-24    
ref|XP_010918367.1|  PREDICTED: UDP-galactose transporter 2-like ...    105   2e-24    
ref|XP_009408433.1|  PREDICTED: UDP-galactose transporter 2-like ...    108   2e-24    
gb|ACN28164.1|  unknown                                                 106   2e-24    
gb|KJB31919.1|  hypothetical protein B456_005G214900                    108   2e-24    
ref|XP_010918364.1|  PREDICTED: UDP-galactose transporter 2-like ...    105   4e-24    
ref|XP_010918365.1|  PREDICTED: UDP-galactose transporter 2-like ...    105   5e-24    
gb|KCW44368.1|  hypothetical protein EUGRSUZ_L02160                     101   1e-23    
ref|XP_001695155.1|  uncharacterized transport protein                  105   3e-23    
ref|XP_002957142.1|  hypothetical protein VOLCADRAFT_98177              104   9e-23    
gb|EAZ04474.1|  hypothetical protein OsI_26622                          103   9e-23    
gb|KDD74704.1|  hypothetical protein H632_c1124p1                     99.4    4e-21    
ref|XP_010918369.1|  PREDICTED: UDP-galactose transporter 2-like ...  94.7    7e-21    
ref|XP_010089969.1|  hypothetical protein L484_008047                 97.8    1e-20    
ref|XP_010918368.1|  PREDICTED: UDP-galactose transporter 2-like ...  94.4    2e-20    
gb|KCW80468.1|  hypothetical protein EUGRSUZ_C01813                   92.0    5e-20    
ref|XP_010525583.1|  PREDICTED: UDP-galactose transporter 2-like      91.7    9e-20    
emb|CEG00566.1|  Triose-phosphate transporter domain                  95.1    1e-19    
ref|XP_003575406.1|  PREDICTED: uncharacterized membrane protein ...  94.7    1e-19    
gb|EYU18818.1|  hypothetical protein MIMGU_mgv1a022162mg              94.7    2e-19    
ref|XP_005848787.1|  hypothetical protein CHLNCDRAFT_16992            94.0    2e-19    
ref|XP_001416279.1|  DMT family transporter: phosphate/phosphoeno...  94.0    3e-19    
ref|XP_010689087.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19    
ref|XP_006846794.1|  hypothetical protein AMTR_s00148p00057680        93.6    4e-19    
ref|XP_002972897.1|  hypothetical protein SELMODRAFT_98721            93.2    5e-19    
emb|CDY72196.1|  BnaCnng76420D                                        93.2    5e-19    
ref|XP_003580145.1|  PREDICTED: uncharacterized membrane protein ...  93.2    5e-19    
emb|CDY72071.1|  BnaA07g37530D                                        93.2    5e-19    
ref|XP_002285229.1|  PREDICTED: uncharacterized membrane protein ...  93.2    6e-19    
ref|XP_009140893.1|  PREDICTED: uncharacterized membrane protein ...  92.8    7e-19    
emb|CDY30495.1|  BnaA04g16380D                                        92.8    8e-19    
gb|EYU36176.1|  hypothetical protein MIMGU_mgv1a009587mg              92.8    8e-19    
ref|XP_009103672.1|  PREDICTED: uncharacterized membrane protein ...  92.8    8e-19    
ref|XP_008225872.1|  PREDICTED: uncharacterized membrane protein ...  92.4    9e-19    
ref|XP_007205490.1|  hypothetical protein PRUPE_ppa008177mg           92.4    9e-19    
gb|ABV59990.1|  putative integral membrane protein                    92.4    1e-18    
dbj|BAK03473.1|  predicted protein                                    92.4    1e-18    
ref|XP_004291707.1|  PREDICTED: uncharacterized membrane protein ...  92.4    1e-18    
ref|XP_002988032.1|  hypothetical protein SELMODRAFT_127221           92.0    1e-18    
dbj|BAJ92504.1|  predicted protein                                    92.0    1e-18    
ref|NP_001064870.1|  Os10g0479700                                     92.4    1e-18    
ref|XP_008791566.1|  PREDICTED: uncharacterized membrane protein ...  92.4    1e-18    
ref|XP_010253714.1|  PREDICTED: uncharacterized membrane protein ...  92.0    1e-18    
ref|XP_008463953.1|  PREDICTED: uncharacterized membrane protein ...  92.0    1e-18    
ref|XP_004145747.1|  PREDICTED: uncharacterized membrane protein ...  92.0    2e-18    
ref|XP_006661865.1|  PREDICTED: uncharacterized membrane protein ...  92.0    2e-18    
gb|KJB26212.1|  hypothetical protein B456_004G230300                  91.7    2e-18    
ref|XP_006488075.1|  PREDICTED: uncharacterized membrane protein ...  91.7    2e-18    
gb|KHG05327.1|  hypothetical protein F383_31168                       91.7    2e-18    
ref|XP_010470102.1|  PREDICTED: uncharacterized membrane protein ...  91.3    2e-18    
ref|XP_001770264.1|  predicted protein                                91.7    3e-18    
gb|EEC67179.1|  hypothetical protein OsI_34047                        91.7    3e-18    
ref|XP_006409855.1|  hypothetical protein EUTSA_v10016887mg           91.3    3e-18    
ref|XP_006424552.1|  hypothetical protein CICLE_v10028754mg           91.3    3e-18    
ref|NP_850120.3|  nucleotide/sugar transporter-like protein           90.9    3e-18    
emb|CDP07098.1|  unnamed protein product                              90.9    3e-18    
ref|XP_002529937.1|  UDP-glucuronic acid/UDP-N-acetylgalactosamin...  90.9    3e-18    
ref|XP_010510642.1|  PREDICTED: uncharacterized membrane protein ...  90.9    3e-18    
ref|XP_002880935.1|  hypothetical protein ARALYDRAFT_320561           90.9    3e-18    
gb|KJB20306.1|  hypothetical protein B456_003G142900                  90.9    3e-18    
ref|XP_006294505.1|  hypothetical protein CARUB_v10023536mg           90.9    4e-18    
ref|XP_008349776.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    4e-18    
ref|XP_009367057.1|  PREDICTED: uncharacterized membrane protein ...  90.5    5e-18    
ref|XP_001781792.1|  predicted protein                                90.5    5e-18    
ref|XP_010414550.1|  PREDICTED: uncharacterized membrane protein ...  90.5    5e-18    
ref|XP_009396964.1|  PREDICTED: uncharacterized membrane protein ...  90.5    6e-18    
ref|XP_008385325.1|  PREDICTED: uncharacterized membrane protein ...  90.1    6e-18    
ref|XP_002862929.1|  hypothetical protein ARALYDRAFT_921025           90.1    6e-18    
ref|XP_011040893.1|  PREDICTED: uncharacterized membrane protein ...  90.1    7e-18    
ref|XP_010043760.1|  PREDICTED: uncharacterized membrane protein ...  90.1    7e-18    
ref|XP_002502241.1|  Drug/Metabolite transporter superfamily          89.7    8e-18    
ref|XP_007016770.1|  Nucleotide/sugar transporter family protein ...  89.7    8e-18    
ref|XP_003574070.1|  PREDICTED: uncharacterized membrane protein ...  89.7    1e-17    
ref|XP_003075357.1|  transporter-related (ISS)                        89.4    1e-17    
gb|KDP44037.1|  hypothetical protein JCGZ_05504                       89.4    1e-17    
gb|KEH30028.1|  nucleotide/sugar transporter family protein           89.4    1e-17    
ref|XP_006384912.1|  hypothetical protein POPTR_0004s22160g           90.1    2e-17    
ref|XP_009363812.1|  PREDICTED: uncharacterized membrane protein ...  89.0    2e-17    
ref|XP_003083890.1|  putative glucose-6-phosphate/phosphate-tranl...  88.6    2e-17    
gb|KDO73329.1|  hypothetical protein CISIN_1g042552mg                 86.7    2e-17    
ref|XP_008359325.1|  PREDICTED: uncharacterized membrane protein ...  88.6    3e-17    
ref|XP_011395902.1|  UDP-galactose transporter 2                      88.2    3e-17    
ref|XP_001694868.1|  hypothetical protein CHLREDRAFT_130256           88.2    3e-17    
ref|XP_004487096.1|  PREDICTED: uncharacterized membrane protein ...  87.4    3e-17    
ref|XP_011469983.1|  PREDICTED: uncharacterized membrane protein ...  88.2    3e-17    
ref|XP_010670628.1|  PREDICTED: uncharacterized membrane protein ...  87.8    3e-17    
ref|XP_011469982.1|  PREDICTED: uncharacterized membrane protein ...  88.2    4e-17    
gb|ACU17916.1|  unknown                                               86.3    4e-17    
ref|XP_007150191.1|  hypothetical protein PHAVU_005G134200g           87.8    4e-17    
ref|XP_009783672.1|  PREDICTED: uncharacterized membrane protein ...  87.8    4e-17    
gb|KHG14117.1|  hypothetical protein F383_19012                       87.8    4e-17    
ref|XP_009617482.1|  PREDICTED: uncharacterized membrane protein ...  87.8    4e-17    
ref|XP_003540188.1|  PREDICTED: uncharacterized membrane protein ...  87.4    5e-17    
gb|KEH35570.1|  nucleotide/sugar transporter family protein           87.4    5e-17    
ref|XP_003543477.1|  PREDICTED: uncharacterized membrane protein ...  87.4    6e-17    
ref|XP_004982847.1|  PREDICTED: uncharacterized membrane protein ...  87.4    6e-17    
gb|ACF80912.1|  unknown                                               86.3    7e-17    
ref|XP_004506015.1|  PREDICTED: uncharacterized membrane protein ...  87.0    8e-17    
gb|ACN32180.1|  unknown                                               87.0    8e-17    
ref|XP_004982846.1|  PREDICTED: uncharacterized membrane protein ...  87.0    9e-17    
emb|CDP13914.1|  unnamed protein product                              86.7    1e-16    
ref|XP_001421872.1|  DMT family transporter: glucose-6-phosphate/...  85.9    1e-16    
dbj|BAK03457.1|  predicted protein                                    86.7    1e-16    
tpg|DAA49605.1|  TPA: hypothetical protein ZEAMMB73_360241            86.7    1e-16    
dbj|BAJ93691.1|  predicted protein                                    86.7    1e-16    
ref|XP_004251146.1|  PREDICTED: uncharacterized membrane protein ...  86.3    1e-16    
gb|AES67513.2|  nucleotide/sugar transporter family protein           86.3    1e-16    
ref|XP_002467070.1|  hypothetical protein SORBIDRAFT_01g019150        85.9    2e-16    
ref|XP_006340182.1|  PREDICTED: uncharacterized membrane protein ...  85.9    2e-16    
ref|XP_009613052.1|  PREDICTED: uncharacterized membrane protein ...  85.5    3e-16    
ref|XP_004502852.1|  PREDICTED: uncharacterized membrane protein ...  85.5    3e-16    
ref|XP_010542588.1|  PREDICTED: uncharacterized membrane protein ...  85.1    3e-16    
ref|XP_003526814.1|  PREDICTED: uncharacterized membrane protein ...  85.5    3e-16    
ref|XP_010921130.1|  PREDICTED: uncharacterized membrane protein ...  84.7    5e-16    
ref|NP_001047487.1|  Os02g0628200                                     84.7    5e-16    
ref|XP_009771257.1|  PREDICTED: uncharacterized membrane protein ...  84.3    7e-16    
ref|XP_009594518.1|  PREDICTED: uncharacterized membrane protein ...  84.3    7e-16    
ref|XP_006647547.1|  PREDICTED: uncharacterized membrane protein ...  84.0    9e-16    
ref|XP_006578827.1|  PREDICTED: uncharacterized membrane protein ...  84.0    9e-16    
ref|XP_007017075.1|  Nodulin MtN21 /EamA-like transporter family ...  83.2    9e-16    
ref|XP_010922728.1|  PREDICTED: uncharacterized membrane protein ...  84.0    9e-16    
ref|XP_006578825.1|  PREDICTED: uncharacterized membrane protein ...  84.0    1e-15    
ref|XP_007017074.1|  Nodulin MtN21 /EamA-like transporter family ...  83.6    1e-15    
ref|XP_006432008.1|  hypothetical protein CICLE_v100018661mg          82.8    1e-15    
ref|XP_011084830.1|  PREDICTED: uncharacterized membrane protein ...  84.0    1e-15    
ref|XP_004240867.1|  PREDICTED: uncharacterized membrane protein ...  84.0    1e-15    
ref|XP_008808311.1|  PREDICTED: uncharacterized membrane protein ...  84.0    1e-15    
ref|XP_008665489.1|  PREDICTED: uncharacterized protein LOC100216...  85.5    1e-15    
ref|XP_008665497.1|  PREDICTED: uncharacterized protein LOC100216...  85.5    1e-15    
ref|NP_001169693.1|  hypothetical protein                             83.6    1e-15    



>ref|XP_009630891.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
Length=338

 Score =   306 bits (783),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +2

Query  98   RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttl  277
            +KMS+AV KDEKK  +D AAW FNIVTSVGIIIVNKALMA +GFSFATTLTGLHFATTTL
Sbjct  4    KKMSTAV-KDEKKMTVDVAAWAFNIVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTL  62

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MT  LK LG+IQ+S LPWSER+KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC 
Sbjct  63   MTFFLKWLGHIQNSQLPWSERLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCF  122

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LE+VLD+VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL
Sbjct  123  LEIVLDNVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  182

Query  638  QRKYSLGS  661
            QRKYSLGS
Sbjct  183  QRKYSLGS  190



>ref|XP_009797956.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
Length=338

 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 176/188 (94%), Gaps = 1/188 (1%)
 Frame = +2

Query  98   RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttl  277
            +KMS+ V KDEKK  +D AAW FNIVTSVGIIIVNKALMA +GFSFATTLTGLHFATTTL
Sbjct  4    KKMSTTV-KDEKKMSLDVAAWAFNIVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTL  62

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MT  LK LG+IQ+S LPWSER+KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC 
Sbjct  63   MTFFLKWLGHIQNSQLPWSERLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCF  122

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LE+VLD+VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL
Sbjct  123  LEIVLDNVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  182

Query  638  QRKYSLGS  661
            QRKYSLGS
Sbjct  183  QRKYSLGS  190



>ref|XP_004237478.1| PREDICTED: UDP-galactose transporter 2 [Solanum lycopersicum]
 ref|XP_010319795.1| PREDICTED: UDP-galactose transporter 2 [Solanum lycopersicum]
Length=337

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 174/188 (93%), Gaps = 1/188 (1%)
 Frame = +2

Query  98   RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttl  277
            +KMS AV KDEKK ++D AAW FNIVTSVGIIIVNKALMA +GFSFATTLTG+HFATTTL
Sbjct  4    KKMSMAV-KDEKKMVVDVAAWAFNIVTSVGIIIVNKALMATYGFSFATTLTGMHFATTTL  62

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            M   LK LG+IQ+S LPWSER+KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC 
Sbjct  63   MVFFLKWLGHIQNSQLPWSERLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCF  122

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LE+VLD+VRYSRDTKLSILLVLLGVAICTVTDVSVN KGFIAAFIAVWSTALQQYYVH L
Sbjct  123  LEIVLDNVRYSRDTKLSILLVLLGVAICTVTDVSVNTKGFIAAFIAVWSTALQQYYVHHL  182

Query  638  QRKYSLGS  661
            QRKYSLGS
Sbjct  183  QRKYSLGS  190



>ref|XP_006357353.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006357354.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Solanum 
tuberosum]
Length=337

 Score =   296 bits (758),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 174/188 (93%), Gaps = 1/188 (1%)
 Frame = +2

Query  98   RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttl  277
            +KMS AV KDEKK  +D AAW FNIVTSVGIIIVNKALMA +GFSFATTLTG+HFATTTL
Sbjct  4    KKMSMAV-KDEKKMALDVAAWAFNIVTSVGIIIVNKALMATYGFSFATTLTGMHFATTTL  62

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            M   LK LG+IQ+S LPWSER+KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC 
Sbjct  63   MVFFLKWLGHIQNSQLPWSERLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCF  122

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LE+VLD+VRYSRDTKLSIL+VLLGVAICTVTDVSVN KGF+AAFIAVWSTALQQYYVH+L
Sbjct  123  LEIVLDNVRYSRDTKLSILVVLLGVAICTVTDVSVNTKGFVAAFIAVWSTALQQYYVHYL  182

Query  638  QRKYSLGS  661
            QRKYSLGS
Sbjct  183  QRKYSLGS  190



>emb|CDP12866.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   293 bits (749),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            KDE K +ID AAWTFNIVTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT+ILK L
Sbjct  6    KDENKKVIDVAAWTFNIVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTIILKSL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ+S+LP  ERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLEVVLD+V
Sbjct  66   GYIQNSHLPLHERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLEVVLDNV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVLLGVAICTVTDVSVNAKGFIAA IAVWST+LQQYYVH LQ+KYSLGS
Sbjct  126  RYSRDTKLSIMLVLLGVAICTVTDVSVNAKGFIAASIAVWSTSLQQYYVHSLQQKYSLGS  185



>ref|XP_011100070.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011100071.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011100072.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
Length=334

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E K  +DTAAW FNIVTSVGIIIVNKALMA +GF+FAT+LTGLHFA TT+MTLILKRL
Sbjct  6    KVEHKVALDTAAWMFNIVTSVGIIIVNKALMATYGFTFATSLTGLHFAATTMMTLILKRL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP S+ IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVVLD V
Sbjct  66   GYIQSSHLPVSDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVLDRV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            +YSRDTKLSIL+VLLGVAICTVTDVSVNAKGFIAAFIAVWST+LQQY+VH+LQRKYS+GS
Sbjct  126  QYSRDTKLSILVVLLGVAICTVTDVSVNAKGFIAAFIAVWSTSLQQYFVHYLQRKYSIGS  185



>gb|EYU31111.1| hypothetical protein MIMGU_mgv1a0096511mg, partial [Erythranthe 
guttata]
Length=227

 Score =   281 bits (720),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MS    KD +K  +D AAW FNIVTSVGII+VNKALMA +GF+FATTLTGLHFA TT+MT
Sbjct  1    MSPKGSKDSRKVSLDLAAWLFNIVTSVGIIMVNKALMATYGFTFATTLTGLHFAATTMMT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            LILK LGYIQ ++LP S+ IKFV+F+NFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  61   LILKYLGYIQTTHLPSSDIIKFVIFSNFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD V+YSRDTKLSIL+VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR
Sbjct  121  VVLDRVQYSRDTKLSILVVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  180

Query  644  KYSLGS  661
            K+S+GS
Sbjct  181  KHSIGS  186



>gb|EYU30281.1| hypothetical protein MIMGU_mgv1a009610mg [Erythranthe guttata]
Length=337

 Score =   282 bits (722),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +2

Query  107  SSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTL  286
            S A  K +KKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT 
Sbjct  5    SKATSKADKKATVDAAAWVFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTA  64

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +L+ LGYIQ S+LP+SE +KFV FANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLEV
Sbjct  65   VLRWLGYIQPSHLPYSELLKFVFFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLEV  124

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            V D +RYSRDTKLSIL+VLLGVA+CTVTDVSVN KGFIAAFIAVWST+LQQYYVH+LQRK
Sbjct  125  VFDKIRYSRDTKLSILVVLLGVAVCTVTDVSVNGKGFIAAFIAVWSTSLQQYYVHYLQRK  184

Query  647  YSLGS  661
            YSL S
Sbjct  185  YSLTS  189



>ref|XP_006427930.1| hypothetical protein CICLE_v10027192mg, partial [Citrus clementina]
 gb|ESR41170.1| hypothetical protein CICLE_v10027192mg, partial [Citrus clementina]
Length=227

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSS     ++KA  D AAW FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTT++T
Sbjct  1    MSSTTKAADRKAATDVAAWMFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTMLT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
              L+ LGYIQ S+LP+SE ++FV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  61   TFLRWLGYIQTSHLPFSELVRFVVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD VRYSRDTKLSILLVL GV +CTVTDVSVNAKGFIAAF+AVWSTA+QQYYVH+LQR
Sbjct  121  VVLDKVRYSRDTKLSILLVLFGVGVCTVTDVSVNAKGFIAAFVAVWSTAMQQYYVHYLQR  180

Query  644  KYSLGS  661
            KY+LGS
Sbjct  181  KYNLGS  186



>ref|XP_010242229.1| PREDICTED: UDP-galactose transporter 2-like [Nelumbo nucifera]
Length=335

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D A+W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTLIL+ L
Sbjct  6    KSEKKAAVDAASWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLILRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP  E +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +
Sbjct  66   GYVQASHLPLPELLKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGVA+CTVTDVSVNA+GFIAAF+AVWST+LQQYYVHFLQRKYSLGS
Sbjct  126  RYSRDTKLSIAVVLLGVAVCTVTDVSVNARGFIAAFVAVWSTSLQQYYVHFLQRKYSLGS  185



>ref|XP_004502879.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502880.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Cicer 
arietinum]
 ref|XP_004502881.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Cicer 
arietinum]
Length=335

 Score =   280 bits (715),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 173/186 (93%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA +D A+W FN+VTSV II+VNKALMA +GFSFATTLTG+HFATTTL+T
Sbjct  1    MSSAS-KGDRKASLDAASWLFNVVTSVAIILVNKALMAKYGFSFATTLTGMHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            +ILK LGYIQ S+LP ++ IKFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLE
Sbjct  60   VILKSLGYIQTSHLPTADIIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD+VRYSRDTKLSILLVL+GVA+CTVTDVSVNAKGFIAA IAVWSTALQQYYVHFLQR
Sbjct  120  VVLDNVRYSRDTKLSILLVLIGVAVCTVTDVSVNAKGFIAAVIAVWSTALQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYS+GS
Sbjct  180  KYSIGS  185



>emb|CBI21537.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S   K +KKA +D AAW FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTLMT +
Sbjct  2    SPANKADKKATVDAAAWMFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTLMTTV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP SE ++FVLFAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC+LEVV
Sbjct  62   LRWLGYIQGSHLPVSELLRFVLFANLSIVGMNVSLMWNSVGFYQIAKLSMIPVSCVLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD +RYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAAF+AVWSTALQQYYVHFLQRKY
Sbjct  122  LDKMRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAFVAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_002278813.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 ref|XP_010652877.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 ref|XP_010652878.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
Length=337

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S   K +KKA +D AAW FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTLMT +
Sbjct  4    SPANKADKKATVDAAAWMFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTLMTTV  63

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP SE ++FVLFAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC+LEVV
Sbjct  64   LRWLGYIQGSHLPVSELLRFVLFANLSIVGMNVSLMWNSVGFYQIAKLSMIPVSCVLEVV  123

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD +RYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAAF+AVWSTALQQYYVHFLQRKY
Sbjct  124  LDKMRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAFVAVWSTALQQYYVHFLQRKY  183

Query  650  SLGS  661
            SLGS
Sbjct  184  SLGS  187



>dbj|BAE98980.1| hypothetical protein [Arabidopsis thaliana]
Length=335

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+
Sbjct  2    APVKKSDKKATLDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP++E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LRCLGYIQPSHLPFTELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D +RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKY
Sbjct  122  FDKIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>ref|XP_010437993.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
 ref|XP_010438001.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=335

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+
Sbjct  2    APVKKADKKATLDAAAWIFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP+SE +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LRCLGYIQPSHLPFSELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D +RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKY
Sbjct  122  FDKIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>ref|NP_192719.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 emb|CAB39648.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78104.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAR24728.1| At4g09810 [Arabidopsis thaliana]
 gb|AEE82801.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AIJ01999.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=335

 Score =   278 bits (711),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+
Sbjct  2    APVKKSDKKATLDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP++E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LRCLGYIQPSHLPFTELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D +RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKY
Sbjct  122  FDKIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>ref|XP_006464516.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006464517.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006464518.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006464519.1| PREDICTED: UDP-galactose transporter 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006464520.1| PREDICTED: UDP-galactose transporter 2-like isoform X5 [Citrus 
sinensis]
 ref|XP_006464521.1| PREDICTED: UDP-galactose transporter 2-like isoform X6 [Citrus 
sinensis]
Length=334

 Score =   277 bits (708),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSS     ++KA  D AAW FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTT++T
Sbjct  1    MSSTTKAADRKAATDVAAWMFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTMLT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
              L+ LGYIQ S+LP+SE ++FV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  61   TFLRWLGYIQTSHLPFSELVRFVVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD VRYSRDTKLSILLVL GV +CTVTDVSVNAKGFIAAF+AVWSTA+QQYYVH+LQR
Sbjct  121  VVLDKVRYSRDTKLSILLVLFGVGVCTVTDVSVNAKGFIAAFVAVWSTAMQQYYVHYLQR  180

Query  644  KYSLGS  661
            KY+LGS
Sbjct  181  KYNLGS  186



>ref|XP_004496438.1| PREDICTED: UDP-galactose transporter 2-like [Cicer arietinum]
Length=322

 Score =   276 bits (707),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHF TTTLMT+IL+ L
Sbjct  6    KAEKKAAVDAAAWMFNVVTSVGIIIVNKALMAGYGFSFATTLTGLHFVTTTLMTVILRML  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP SE +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV LD +
Sbjct  66   GYVQPSHLPLSELLKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVALDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVN KGF+AAFIAVWST+LQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIGVVLLGVGVCTVTDVSVNTKGFVAAFIAVWSTSLQQYYVHYLQRKYSLSS  185



>gb|KDP35285.1| hypothetical protein JCGZ_09444 [Jatropha curcas]
Length=335

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA ID A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAS-KADRKAAIDAASWMFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            + L+ LGYIQ S+LP SE +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE
Sbjct  60   VFLRWLGYIQTSHLPLSELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD+VRYSRDTKLSI +VLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQYYVH+LQR
Sbjct  120  VVLDNVRYSRDTKLSITVVLLGVAVCTVTDVSVNAKGFIAAVVAVWSTSLQQYYVHYLQR  179

Query  644  KYSLGS  661
            +YSLGS
Sbjct  180  RYSLGS  185



>ref|XP_003518502.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max]
 gb|KHN00738.1| UDP-galactose transporter 2 [Glycine soja]
Length=322

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVGIIIVNKALMA++GFSFATTLTG+HFATTTLMT++L+ L
Sbjct  6    KAEKKAAVDAAAWMFNVVTSVGIIIVNKALMASYGFSFATTLTGMHFATTTLMTVVLRML  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +
Sbjct  66   GYVQPSHLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VL+GV +CTVTDVSVN +GFIAAFIAVWST++QQYYVHFLQRKYSL S
Sbjct  126  RYSRDTKLSIGVVLMGVGVCTVTDVSVNGRGFIAAFIAVWSTSMQQYYVHFLQRKYSLSS  185



>ref|XP_003523251.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
 ref|XP_006578815.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
 ref|XP_006578816.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Glycine 
max]
Length=333

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+V K +KKA ID A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+TLI
Sbjct  2    SSVSKGDKKASIDAASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTLI  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            LK LGYIQ S+LP S+ IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LKSLGYIQTSHLPVSDIIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSI+LVLLGVA+CTVTDVSVNAKGFIAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  LDNVRYSRDTKLSIVLVLLGVAVCTVTDVSVNAKGFIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            S+GS
Sbjct  182  SIGS  185



>ref|NP_001239895.1| uncharacterized protein LOC100800306 [Glycine max]
 gb|ACU23308.1| unknown [Glycine max]
Length=333

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+V K ++KA ID A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+TLI
Sbjct  2    SSVSKGDRKASIDAASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTLI  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            LK LGYIQ S+LP S+ IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LKSLGYIQTSHLPLSDIIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSI+LVLLGVA+CTVTDVSVNAKGFIAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  LDNVRYSRDTKLSIVLVLLGVAVCTVTDVSVNAKGFIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            S+GS
Sbjct  182  SIGS  185



>gb|ACU24339.1| unknown [Glycine max]
Length=322

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVGIIIVNKALMA++GFSFATTLTG+HFATTTLMT++L+ L
Sbjct  6    KAEKKAAVDAAAWMFNVVTSVGIIIVNKALMASYGFSFATTLTGMHFATTTLMTVVLRML  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +
Sbjct  66   GYVQPSHLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VL+GV +CTVTDVSVN +GFIAAFIAVWST++QQYYVHFLQRKYSL S
Sbjct  126  RYSRDTKLSIGVVLMGVGVCTVTDVSVNGRGFIAAFIAVWSTSMQQYYVHFLQRKYSLSS  185



>ref|XP_010262106.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Nelumbo 
nucifera]
Length=231

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  KKA +D A+W FN+VTSVGIIIVNK LMA +GFSFATTLTGLHFATTTLMT +L+ L
Sbjct  11   KSGKKAAVDAASWMFNVVTSVGIIIVNKTLMATYGFSFATTLTGLHFATTTLMTSVLRWL  70

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +
Sbjct  71   GYIQASHLPLPELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKI  130

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGVA+CTVTDVSVNA+GFIAAF+AVWST+LQQYYVHFLQRKYSL S
Sbjct  131  RYSRDTKLSIAVVLLGVAVCTVTDVSVNARGFIAAFVAVWSTSLQQYYVHFLQRKYSLSS  190



>ref|XP_007143575.1| hypothetical protein PHAVU_007G083300g [Phaseolus vulgaris]
 gb|ESW15569.1| hypothetical protein PHAVU_007G083300g [Phaseolus vulgaris]
Length=322

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHF TTTLMT ILK L
Sbjct  6    KSEKKASVDAAAWLFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFVTTTLMTSILKML  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP+ E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +
Sbjct  66   GYIQPSHLPFPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEIVFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            +YSRDTKLSI +VLLGV +CTVTDVSVN +GF+AAF+AVWST+LQQYYVHFLQRKYSL S
Sbjct  126  QYSRDTKLSICIVLLGVGVCTVTDVSVNTRGFVAAFVAVWSTSLQQYYVHFLQRKYSLSS  185



>gb|EYU36556.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata]
 gb|EYU36557.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata]
 gb|EYU36558.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata]
Length=333

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT++L+ L
Sbjct  6    KADKKASVDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP+ E ++FVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +
Sbjct  66   GYIQTSHLPFQELLRFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSIL+VLLGVA+CTVTDVSVN+KGF+AAFIAVWSTA+QQYYV FLQRKYSL S
Sbjct  126  RYSRDTKLSILIVLLGVAVCTVTDVSVNSKGFVAAFIAVWSTAMQQYYVSFLQRKYSLSS  185



>ref|XP_003592056.1| Membrane protein, putative [Medicago truncatula]
 gb|AES62307.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=320

 Score =   274 bits (701),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVGIIIVNKALM  +GFSFATTLTGLHF TTT+MTL+L+ L
Sbjct  6    KAEKKAAVDAAAWMFNVVTSVGIIIVNKALMGGYGFSFATTLTGLHFVTTTIMTLVLRVL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP SE +KFV FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV LD +
Sbjct  66   GYVQPSHLPLSELLKFVFFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVCLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVN KGF+AAFIAVWST+LQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIGIVLLGVGVCTVTDVSVNMKGFVAAFIAVWSTSLQQYYVHYLQRKYSLSS  185



>ref|XP_010421887.1| PREDICTED: LOW QUALITY PROTEIN: UDP-galactose transporter 2 [Camelina 
sativa]
Length=336

 Score =   275 bits (703),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+
Sbjct  2    APVKKADKKATLDAAAWIFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP+SE +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPV+CLLEVV
Sbjct  62   LRCLGYIQPSHLPFSELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVTCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             + +RYSRDTKLSI LVL+GV +CTVTD SVN KGFIAAF+AVWSTALQQYYVH+LQRKY
Sbjct  122  FEKIRYSRDTKLSIGLVLVGVGVCTVTDFSVNTKGFIAAFVAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>ref|XP_006585315.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
Length=336

 Score =   275 bits (702),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++K  +D A+W FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAT-KGDRKTALDVASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            + LK LGYIQ S+LP  + IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   VFLKWLGYIQTSHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQYYVHFLQR
Sbjct  120  VILDNVRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTSLQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYSLGS
Sbjct  180  KYSLGS  185



>ref|NP_001242035.1| uncharacterized protein LOC100814890 [Glycine max]
 gb|ACU20778.1| unknown [Glycine max]
Length=337

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++K  +D A+W FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAT-KGDRKTALDVASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            + LK LGY+Q S+LP  + IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   VFLKWLGYVQTSHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQYYVHFLQR
Sbjct  120  VILDNVRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTSLQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYSLGS
Sbjct  180  KYSLGS  185



>ref|XP_009335133.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335134.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335135.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335136.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335137.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335138.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=334

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA  D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+L+ L
Sbjct  6    KADKKAG-DVAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLVLRWL  64

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP SE +KF++FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +
Sbjct  65   GYIQPSHLPVSELLKFMVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKI  124

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVNAKGFIAAFIAVWST+LQQYYVHFLQRKYSLGS
Sbjct  125  RYSRDTKLSIGIVLLGVGVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHFLQRKYSLGS  184



>ref|XP_006579458.1| PREDICTED: uncharacterized protein LOC100814890 isoform X1 [Glycine 
max]
 ref|XP_006579459.1| PREDICTED: uncharacterized protein LOC100814890 isoform X2 [Glycine 
max]
 ref|XP_006579460.1| PREDICTED: uncharacterized protein LOC100814890 isoform X3 [Glycine 
max]
 ref|XP_006579461.1| PREDICTED: uncharacterized protein LOC100814890 isoform X4 [Glycine 
max]
 gb|KHN34023.1| UDP-galactose transporter 2 [Glycine soja]
Length=337

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++K  +D A+W FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAT-KGDRKTALDVASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            + LK LGY+Q S+LP  + IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   VFLKWLGYVQTSHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQYYVHFLQR
Sbjct  120  VILDNVRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTSLQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYSLGS
Sbjct  180  KYSLGS  185



>ref|XP_006585314.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
Length=356

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 169/187 (90%), Gaps = 1/187 (1%)
 Frame = +2

Query  101  KMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlM  280
             MSSA  K ++K  +D A+W FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+
Sbjct  20   NMSSAT-KGDRKTALDVASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLL  78

Query  281  TLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLL  460
            T+ LK LGYIQ S+LP  + IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC L
Sbjct  79   TVFLKWLGYIQTSHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFL  138

Query  461  EVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQ  640
            EV+LD+VRYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQYYVHFLQ
Sbjct  139  EVILDNVRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTSLQQYYVHFLQ  198

Query  641  RKYSLGS  661
            RKYSLGS
Sbjct  199  RKYSLGS  205



>ref|XP_007137579.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 ref|XP_007137580.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 ref|XP_007137581.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 gb|ESW09573.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 gb|ESW09574.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 gb|ESW09575.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
Length=333

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+V K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+TLI
Sbjct  2    SSVSKGDRKASLDAASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTLI  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            LK LGYIQ S+LP S+ IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LKSLGYIQTSHLPLSDIIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSI+LVLLGVA+CTVTDVSVNAKGFIAA IAVWSTALQQYYVH+LQRKY
Sbjct  122  LDNVRYSRDTKLSIVLVLLGVAVCTVTDVSVNAKGFIAALIAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            S+GS
Sbjct  182  SIGS  185



>ref|XP_008440118.1| PREDICTED: UDP-galactose transporter 2 [Cucumis melo]
 ref|XP_008440120.1| PREDICTED: UDP-galactose transporter 2 [Cucumis melo]
Length=334

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+  K + KA +D A+W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATT+L+T I
Sbjct  2    SSPGKSDHKATLDAASWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTSLLTFI  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            LK+LGYIQDS+LP+ + +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LKQLGYIQDSHLPFLDILKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD V+YSRDTKLSILLVLLGV +CTVTDVSVN KGF+AA +AVWST+LQQYYVH LQRKY
Sbjct  122  LDKVQYSRDTKLSILLVLLGVGVCTVTDVSVNMKGFVAAVVAVWSTSLQQYYVHHLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_009134166.1| PREDICTED: UDP-galactose transporter 2-like [Brassica rapa]
Length=334

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  KK+ +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+L+ L
Sbjct  6    KANKKSTVDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLVLRCL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP++E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPV+CLLEVV D +
Sbjct  66   GYIQPSHLPFTELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVACLLEVVFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSLTS  185



>ref|XP_002533887.1| organic anion transporter, putative [Ricinus communis]
 gb|EEF28498.1| organic anion transporter, putative [Ricinus communis]
Length=335

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T +
Sbjct  2    SSPSKADRKAALDAASWMFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTFV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP SE +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LRWLGYIQASHLPVSELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSI +VLLGVA+CTVTDVSVN KGFIAA +AVWST+LQQYYVHFLQR+Y
Sbjct  122  LDNVRYSRDTKLSITIVLLGVAVCTVTDVSVNTKGFIAAVVAVWSTSLQQYYVHFLQRRY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_006599473.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
 ref|XP_006599474.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
 ref|XP_006599475.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Glycine 
max]
 ref|XP_006599476.1| PREDICTED: UDP-galactose transporter 2-like isoform X4 [Glycine 
max]
 gb|KHN41307.1| UDP-galactose transporter 2 [Glycine soja]
Length=322

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTG+HFATTTLMT++L+ L
Sbjct  6    KAEKKAAMDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGMHFATTTLMTVVLRML  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP  + +KFVL ANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +
Sbjct  66   GYVQPSHLPLPDLLKFVLVANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VL+GV +CTVTDVSVN +GFIAAF+AVWST++QQYYVHFLQRKYSL S
Sbjct  126  RYSRDTKLSICVVLMGVGVCTVTDVSVNGRGFIAAFVAVWSTSMQQYYVHFLQRKYSLSS  185



>ref|XP_008386368.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
 ref|XP_008386369.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
 ref|XP_008386370.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
 ref|XP_008386372.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
Length=334

 Score =   273 bits (697),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA  D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT +L+ L
Sbjct  6    KADKKAG-DVAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTXVLRWL  64

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP SE +KF++FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +
Sbjct  65   GYIQPSHLPVSELLKFMVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKI  124

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVNAKGFIAAFIAVWST+LQQYYVHFLQRKYSLGS
Sbjct  125  RYSRDTKLSIGIVLLGVGVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHFLQRKYSLGS  184



>emb|CDY05079.1| BnaC03g28770D [Brassica napus]
Length=396

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  KKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+L+ L
Sbjct  68   KANKKATVDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLVLRCL  127

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP++E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPV+CLLEVV D +
Sbjct  128  GYIQPSHLPFTELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVACLLEVVFDKI  187

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  188  RYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSLTS  247



>ref|XP_004504000.1| PREDICTED: UDP-galactose transporter 2-like [Cicer arietinum]
Length=362

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            ++  K ++K  ID A+W FN+VTSVGII+VNKALMA  GF+FATTLTGLHFATTTL+T  
Sbjct  27   ASTTKGDRKIAIDLASWMFNVVTSVGIILVNKALMATHGFTFATTLTGLHFATTTLLTSF  86

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            LK +GYIQD++LP S+ IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  87   LKWMGYIQDTHLPLSDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  146

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LDSVRYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWSTALQQYYVHFLQ+KY
Sbjct  147  LDSVRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTALQQYYVHFLQKKY  206

Query  650  SLGS  661
            SLGS
Sbjct  207  SLGS  210



>ref|XP_010680321.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680322.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680323.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680325.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
Length=337

 Score =   273 bits (697),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D  AW FNIVTSVGIIIVNKALMAN+GF+FATTLTGLHFATTTLMT  L+ L
Sbjct  6    KGDRKAALDMGAWLFNIVTSVGIIIVNKALMANYGFTFATTLTGLHFATTTLMTFTLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ + LP+SE +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV DSV
Sbjct  66   GFIQPTKLPFSEILKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDSV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVLLGVA+CTVTD+SVNAKGFI+A +AVWSTALQQYYVH LQRKYS+GS
Sbjct  126  RYSRDTKLSIVLVLLGVAVCTVTDLSVNAKGFISALVAVWSTALQQYYVHHLQRKYSIGS  185



>ref|XP_010262105.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Nelumbo 
nucifera]
Length=340

 Score =   272 bits (695),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  KKA +D A+W FN+VTSVGIIIVNK LMA +GFSFATTLTGLHFATTTLMT +L+ L
Sbjct  11   KSGKKAAVDAASWMFNVVTSVGIIIVNKTLMATYGFSFATTLTGLHFATTTLMTSVLRWL  70

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +
Sbjct  71   GYIQASHLPLPELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKI  130

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGVA+CTVTDVSVNA+GFIAAF+AVWST+LQQYYVHFLQRKYSL S
Sbjct  131  RYSRDTKLSIAVVLLGVAVCTVTDVSVNARGFIAAFVAVWSTSLQQYYVHFLQRKYSLSS  190



>ref|XP_007151969.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
 ref|XP_007151970.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
 gb|ESW23963.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
 gb|ESW23964.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
Length=321

 Score =   271 bits (693),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTG+HFATTTLMT+ILK L
Sbjct  6    KAEKKAAVDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGMHFATTTLMTVILKML  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP  + +KFV+FANFSIVGMN+SLMWNSVGFYQIAKL+MIPVSCLLEVVLD +
Sbjct  66   GYVQPSHLPLPDLLKFVVFANFSIVGMNISLMWNSVGFYQIAKLTMIPVSCLLEVVLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR TKLSI +VLLGV +CTVTDVSVN +GFIAAFIAVWST++QQYYVH+LQRKYSL S
Sbjct  126  RYSRGTKLSIGIVLLGVGVCTVTDVSVNTRGFIAAFIAVWSTSMQQYYVHYLQRKYSLSS  185



>emb|CDX90737.1| BnaA03g24170D [Brassica napus]
Length=385

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  KK+ +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+L+ L
Sbjct  57   KANKKSTVDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLVLRCL  116

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP++E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPV+CLLEVV D +
Sbjct  117  GYIQPSHLPFTELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVACLLEVVFDKI  176

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  177  RYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSLTS  236



>gb|ACJ84819.1| unknown [Medicago truncatula]
Length=335

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTG+HFATTTL+T
Sbjct  1    MSSAS-KGDRKASLDAASWLFNVVTSVGIILVNKALMATYGFSFATTLTGMHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++LK LGYIQ S+LP S+ IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLE
Sbjct  60   VVLKSLGYIQTSHLPKSDIIKFVLFANCSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD+VRYSRDTKLSI+LVL GVA+CTVTDVSVN KGFIAA IAV STALQQYYVHFLQR
Sbjct  120  VVLDNVRYSRDTKLSIILVLAGVAVCTVTDVSVNTKGFIAAVIAVCSTALQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYS+GS
Sbjct  180  KYSIGS  185



>ref|XP_003602507.1| Membrane protein, putative [Medicago truncatula]
 gb|AES72758.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=335

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTG+HFATTTL+T
Sbjct  1    MSSAS-KGDRKASLDAASWLFNVVTSVGIILVNKALMATYGFSFATTLTGMHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++LK LGYIQ S+LP S+ IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLE
Sbjct  60   VVLKSLGYIQTSHLPKSDIIKFVLFANCSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD+VRYSRDTKLSI+LVL GVA+CTVTDVSVN KGFIAA IAV STALQQYYVHFLQR
Sbjct  120  VVLDNVRYSRDTKLSIILVLAGVAVCTVTDVSVNTKGFIAAVIAVCSTALQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYS+GS
Sbjct  180  KYSIGS  185



>ref|XP_002300904.2| transporter-related family protein [Populus trichocarpa]
 gb|EEE80177.2| transporter-related family protein [Populus trichocarpa]
Length=336

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            M+ +  K  KK   D AAW FN+VTSVGIIIVNKALMA +GFS+ATTLTG+HFATTTLMT
Sbjct  1    MAPSSSKANKKGAADAAAWMFNVVTSVGIIIVNKALMATYGFSYATTLTGMHFATTTLMT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
             +L+ LGYIQ S+LP+ E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLE
Sbjct  61   GVLRWLGYIQASHLPYPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+ D +RYSRDTKLSI +VLLGV +CTVTDVSVNAKGFIAAFIAVWST+LQQYYVH+LQR
Sbjct  121  VLFDKIRYSRDTKLSIGVVLLGVGVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHYLQR  180

Query  644  KYSLGS  661
            KYSL S
Sbjct  181  KYSLSS  186



>gb|KJB60019.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
 gb|KJB60020.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
 gb|KJB60021.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
 gb|KJB60022.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
Length=335

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D +AW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT +L+ L
Sbjct  6    KAERKAVVDASAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTAVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP +E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV+D +
Sbjct  66   GYIQSSHLPMAELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVMDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVN KGFIAAFIAVWST+LQQYYVH LQR+Y+L S
Sbjct  126  RYSRDTKLSIAVVLLGVGVCTVTDVSVNTKGFIAAFIAVWSTSLQQYYVHHLQRRYNLSS  185



>ref|XP_009610489.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
 ref|XP_009610490.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
 ref|XP_009610491.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
Length=327

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA  D AAW FN+VTSVGIIIVNKALMAN+GF FATTLTG+HFATTTLMT++L+ L
Sbjct  6    KADKKAAGDVAAWMFNVVTSVGIIIVNKALMANYGFFFATTLTGMHFATTTLMTIVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  + +KFVLFANFSIVGMN+SLMWNSVGFYQIAKLSMIPVSCLLEV  D +
Sbjct  66   GYIQASHLPLPDLLKFVLFANFSIVGMNISLMWNSVGFYQIAKLSMIPVSCLLEVAFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VLLGVA+CTVTDVSVN KGFIAAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLLGVAVCTVTDVSVNTKGFIAAFVAVWSTALQQYYVHYLQRKYSLSS  185



>ref|XP_009802605.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
 ref|XP_009802606.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
 ref|XP_009802607.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
Length=327

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA  D AAW FN+VTSVGIIIVNKALMAN+GF FATTLTG+HFATTTLMT++L+ L
Sbjct  6    KADKKAAGDVAAWMFNVVTSVGIIIVNKALMANYGFFFATTLTGMHFATTTLMTIVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  + +KFVLFANFSIVGMN+SLMWNSVGFYQIAKLSMIPVSCLLEV  D +
Sbjct  66   GYIQASHLPLPDLLKFVLFANFSIVGMNISLMWNSVGFYQIAKLSMIPVSCLLEVAFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VLLGVA+CTVTDVSVN KGFIAAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLLGVAVCTVTDVSVNTKGFIAAFVAVWSTALQQYYVHYLQRKYSLSS  185



>ref|XP_010063828.1| PREDICTED: UDP-galactose transporter 2-like [Eucalyptus grandis]
 ref|XP_010063829.1| PREDICTED: UDP-galactose transporter 2-like [Eucalyptus grandis]
 gb|KCW71092.1| hypothetical protein EUGRSUZ_F04190 [Eucalyptus grandis]
Length=335

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHF TTTLMT IL+ L
Sbjct  6    KADQKAAVDVAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFVTTTLMTAILRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP+ E +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVVLD +
Sbjct  66   GYIQSSHLPFQELLKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVLDKM  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVN KGF+AA IAVWSTALQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIGVVLLGVGVCTVTDVSVNTKGFVAALIAVWSTALQQYYVHYLQRKYSLSS  185



>ref|XP_004157865.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
Length=334

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+  K + KA +D A+W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATT+L+T I
Sbjct  2    SSPGKSDHKATLDAASWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTSLLTFI  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            LK+LGYIQDS+LP+ + +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LKQLGYIQDSHLPFLDILKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD V+YSRDTKLSILLVL GV +CTVTDVSVN KGF+AA +AVW T+LQQYYVH LQRKY
Sbjct  122  LDKVQYSRDTKLSILLVLFGVGVCTVTDVSVNMKGFVAAVVAVWCTSLQQYYVHHLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_007019594.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007019595.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16819.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16820.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
Length=335

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA++D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT +L+ L
Sbjct  6    KADRKAVVDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTAVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV+D +
Sbjct  66   GYIQSSHLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVMDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVN KGF+AAFIAVWST+LQQYYVH LQR+Y+L S
Sbjct  126  RYSRDTKLSIAVVLLGVGVCTVTDVSVNTKGFVAAFIAVWSTSLQQYYVHHLQRRYNLSS  185



>ref|XP_004141972.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
 gb|KGN48413.1| hypothetical protein Csa_6G486860 [Cucumis sativus]
Length=334

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+  K + KA +D A+W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATT+L+T I
Sbjct  2    SSPGKSDHKATLDAASWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTSLLTFI  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            LK+LGYIQDS+LP+ + +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LKQLGYIQDSHLPFLDILKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD V+YSRDTKLSILLVL GV +CTVTDVSVN KGF+AA +AVW T+LQQYYVH LQRKY
Sbjct  122  LDKVQYSRDTKLSILLVLFGVGVCTVTDVSVNMKGFVAAVVAVWCTSLQQYYVHHLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_011042896.1| PREDICTED: UDP-galactose transporter 2-like [Populus euphratica]
Length=336

 Score =   270 bits (689),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            M+ +  K  KK   D AAW FN+VTSVGIIIVNKALMA +GFS+ATTLTG+HFATTTLMT
Sbjct  1    MAPSSSKANKKGAADAAAWMFNVVTSVGIIIVNKALMATYGFSYATTLTGMHFATTTLMT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
             +L+ LGYIQ S+LP+ E +KFV FANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLE
Sbjct  61   GVLRWLGYIQASHLPYPELLKFVFFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+ D +RYSRDTKLSI +VLLGV +CTVTDVSVNAKGFIAAFIAVWST+LQQYYVH+LQR
Sbjct  121  VLFDKIRYSRDTKLSIGVVLLGVGVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHYLQR  180

Query  644  KYSLGS  661
            KYSL S
Sbjct  181  KYSLSS  186



>ref|XP_011100915.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
Length=339

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +2

Query  98   RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttl  277
            +KMSS + KD+ K  +D AAW FN+VTSVGIIIVNKALMA +GF+FATTLTGLHF+ TTL
Sbjct  8    KKMSS-LSKDDHKMAVDAAAWLFNVVTSVGIIIVNKALMATYGFTFATTLTGLHFSVTTL  66

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MTL+LK LGY+Q S+LP ++ +KFV FAN S+VGMNVSLMWNSVGFYQIAKLSMIPV+CL
Sbjct  67   MTLVLKSLGYVQSSHLPVADILKFVFFANLSVVGMNVSLMWNSVGFYQIAKLSMIPVACL  126

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEVV D ++YSRDTKLSIL+VLLGVAICTVTDVSV+AKGFIAA +AVWST LQQYYVH L
Sbjct  127  LEVVFDQIKYSRDTKLSILVVLLGVAICTVTDVSVSAKGFIAALVAVWSTTLQQYYVHSL  186

Query  638  QRKYSLGS  661
            QRK+S+GS
Sbjct  187  QRKHSIGS  194



>ref|NP_568059.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 ref|NP_849527.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AAM13878.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13117.1| unknown protein [Arabidopsis thaliana]
 gb|AEE87066.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AEE87067.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AIJ01998.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=337

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  98   RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttl  277
            +KMS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL
Sbjct  3    KKMSATTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTL  62

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            +T  L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL
Sbjct  63   LTTFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  122

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEV+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+L
Sbjct  123  LEVMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYL  182

Query  638  QRKYSLGS  661
            QRKYSLGS
Sbjct  183  QRKYSLGS  190



>ref|XP_009145156.1| PREDICTED: UDP-galactose transporter 2-like [Brassica rapa]
Length=335

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KK  +D AAW FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFA TTLMT++
Sbjct  2    APVSKADKKVAVDAAAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFAFTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYI  S+LP+ E ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V
Sbjct  62   LRCLGYIHPSHLPFPELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD +RYSRDTKLSI LVL+GV +CTVTDVSVN+KGF+AAF+AVWST+LQQYYVH+LQRKY
Sbjct  122  LDKIRYSRDTKLSIGLVLVGVGVCTVTDVSVNSKGFLAAFVAVWSTSLQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>emb|CDY28389.1| BnaA05g18510D [Brassica napus]
Length=335

 Score =   269 bits (688),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KK  +D AAW FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFA TTLMT++
Sbjct  2    APVSKADKKVAVDAAAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFAFTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYI  S+LP+ E ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V
Sbjct  62   LRCLGYIHPSHLPFPELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD +RYSRDTKLSI LVL+GV +CTVTDVSVN+KGF+AAF+AVWST+LQQYYVH+LQRKY
Sbjct  122  LDKIRYSRDTKLSIGLVLVGVGVCTVTDVSVNSKGFLAAFVAVWSTSLQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>ref|XP_002310620.1| transporter-related family protein [Populus trichocarpa]
 gb|ABK93556.1| unknown [Populus trichocarpa]
 gb|EEE91070.1| transporter-related family protein [Populus trichocarpa]
Length=334

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSS   K ++KA  D A+W FN+VTSVGII+VNKALMA +G+SFATTLTGLHFATTTL+T
Sbjct  1    MSST--KADRKAAGDAASWLFNVVTSVGIILVNKALMATYGYSFATTLTGLHFATTTLLT  58

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++L+ LGYIQ S+LP  + +KFVLFAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  59   VVLRWLGYIQPSHLPLPDLLKFVLFANCSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  118

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLDSVRYSRDTKLSIL+VLLGVA+CTVTDVSVNAKGF+AA IAVWSTALQQYYVH+LQR
Sbjct  119  VVLDSVRYSRDTKLSILVVLLGVAVCTVTDVSVNAKGFVAAVIAVWSTALQQYYVHYLQR  178

Query  644  KYSLGS  661
            +YSLGS
Sbjct  179  RYSLGS  184



>gb|EYU24057.1| hypothetical protein MIMGU_mgv1a009794mg [Erythranthe guttata]
Length=331

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  131  KKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYI  310
             KA +D AAW FNIVTSVGII+VNKALMA +GF+FATTLTGLHFA TT+MT IL+ LGYI
Sbjct  6    NKAGLDAAAWIFNIVTSVGIILVNKALMATYGFTFATTLTGLHFAATTVMTFILRSLGYI  65

Query  311  QDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYS  490
            Q S+LP  E IKFV+ ANFSIVGMNVSLMWNSVGFYQIAKLSMIPV+CLLEVVLD +RYS
Sbjct  66   QSSHLPTIEIIKFVIVANFSIVGMNVSLMWNSVGFYQIAKLSMIPVACLLEVVLDKMRYS  125

Query  491  RDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RDTKLSIL+VL GV ICTVTDVSVNAKGF+AAFIAVWST++QQYYVHFLQRK+S+GS
Sbjct  126  RDTKLSILVVLFGVGICTVTDVSVNAKGFVAAFIAVWSTSMQQYYVHFLQRKHSIGS  182



>ref|XP_008812584.1| PREDICTED: UDP-galactose transporter 2-like [Phoenix dactylifera]
Length=335

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  KKA +DT AW FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTT+MT +LK L
Sbjct  6    KANKKAALDTGAWLFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTIMTSVLKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  E IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCLLEV+ D +
Sbjct  66   GYIQGSHLPLQELIKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCLLEVLFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GVA+CTVTDVSVN++G +AA IAVWSTALQQYYVHFLQRKYSLGS
Sbjct  126  RYSRDTKLSIVVVLIGVAVCTVTDVSVNSRGLMAAMIAVWSTALQQYYVHFLQRKYSLGS  185



>ref|XP_011025571.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
 ref|XP_011025572.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
 ref|XP_011025573.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
 ref|XP_011025574.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
Length=334

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSS   K ++KA  D A+W FN+VTSVGII+VNKALMA +G+SFATTLTGLHFATTTL+T
Sbjct  1    MSST--KADRKAAGDAASWLFNVVTSVGIILVNKALMATYGYSFATTLTGLHFATTTLLT  58

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++L+ LGYIQ S+LP  + +KFVLFAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  59   VVLRWLGYIQPSHLPLPDLLKFVLFANCSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  118

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VVLD+VRYSRDTKLSIL+VLLGVA+CTVTDVSVNAKGF+AA IAVWSTALQQYYVH+LQR
Sbjct  119  VVLDNVRYSRDTKLSILVVLLGVAVCTVTDVSVNAKGFVAAVIAVWSTALQQYYVHYLQR  178

Query  644  KYSLGS  661
            +YSLGS
Sbjct  179  RYSLGS  184



>gb|KJB40431.1| hypothetical protein B456_007G062900 [Gossypium raimondii]
 gb|KJB40432.1| hypothetical protein B456_007G062900 [Gossypium raimondii]
Length=335

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+V K ++K  +D A+W+FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T++
Sbjct  2    SSVSKADRKTALDVASWSFNIVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTLLTVL  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQDS++P  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LRWLGYIQDSHIPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D VRYSRDTKLSILLVLLGVA+CTVTDVSVN KGF+AA IAVWSTALQQYYVHFLQRK+
Sbjct  122  FDKVRYSRDTKLSILLVLLGVAVCTVTDVSVNVKGFLAAVIAVWSTALQQYYVHFLQRKH  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>gb|KHG07660.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=335

 Score =   267 bits (682),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+V K ++K  +D A+W+FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T++
Sbjct  2    SSVSKADRKTALDVASWSFNIVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTLLTVL  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ+S++P  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LRSLGYIQNSHIPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D VRYSRDTKLSILLVLLGVA+CTVTDVSVN KGF+AA IAVWSTALQQYYVHFLQRK+
Sbjct  122  FDKVRYSRDTKLSILLVLLGVAVCTVTDVSVNVKGFLAAVIAVWSTALQQYYVHFLQRKH  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>emb|CDY12142.1| BnaC03g60580D [Brassica napus]
Length=335

 Score =   267 bits (682),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +A  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  
Sbjct  2    AATSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTF  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LIWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQRKY
Sbjct  122  LDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_002307514.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE94510.1| transporter-related family protein [Populus trichocarpa]
Length=335

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KK   D  AW FN+VTSVGIIIVNKALMA +GFS+ATTLTG+HFATTTLMT++L+ L
Sbjct  6    KADKKGAADAGAWMFNVVTSVGIIIVNKALMATYGFSYATTLTGMHFATTTLMTVVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP+ E +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLS+IPVSCLLEV  D +
Sbjct  66   GYIQASHLPFPELLKFVVFANFSIVGMNVSLMWNSVGFYQIAKLSIIPVSCLLEVFFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVNAKGFIAAFIAVWST+LQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIGVVLLGVGVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHYLQRKYSLSS  185



>gb|KHN29130.1| UDP-galactose transporter 2 [Glycine soja]
Length=537

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 168/186 (90%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            M SA  K ++K  +D A+W FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T
Sbjct  1    MCSAT-KGDRKTALDVASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            + LK LGYIQ S+LP  + IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   VFLKWLGYIQTSHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQYYVHFLQR
Sbjct  120  VILDNVRYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTSLQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYSLGS
Sbjct  180  KYSLGS  185



>emb|CDY15303.1| BnaC06g07890D [Brassica napus]
Length=335

 Score =   267 bits (682),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KK   D  AW FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFA TTLMT++
Sbjct  2    APVSKADKKTAADAGAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFAFTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP++E ++F+ FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V
Sbjct  62   LRCLGYIQPSHLPFTELLRFIFFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD +RYSRDTKLSI LVL GV +CTVTDVSVN+KGF+AAF+AVWST+LQQYYVH+LQRKY
Sbjct  122  LDKIRYSRDTKLSIGLVLAGVGVCTVTDVSVNSKGFLAAFVAVWSTSLQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>ref|XP_010097649.1| hypothetical protein L484_023789 [Morus notabilis]
 gb|EXB70604.1| hypothetical protein L484_023789 [Morus notabilis]
Length=332

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTG+HFATTTLMT++L+ LGYIQ S+LP+ E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGMHFATTTLMTVVLRWLGYIQPSHLPFPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  78   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIAV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVN +GFIAAFIAVWST+LQQYYVHFLQRKYSLGS
Sbjct  138  VLLGVGVCTVTDVSVNTRGFIAAFIAVWSTSLQQYYVHFLQRKYSLGS  185



>ref|NP_001190967.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AEE87068.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
Length=333

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T
Sbjct  1    MSATTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
              L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE
Sbjct  61   TFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQR
Sbjct  121  VMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQR  180

Query  644  KYSLGS  661
            KYSLGS
Sbjct  181  KYSLGS  186



>ref|XP_009336495.1| PREDICTED: UDP-galactose transporter 2 [Pyrus x bretschneideri]
Length=334

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT++L+ LGYIQ S+LP SE
Sbjct  17   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVVLRWLGYIQPSHLPVSE  76

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KF++FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  77   LLKFMVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIGI  136

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS
Sbjct  137  VLLGVGVCTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  184



>emb|CAB44674.1| putative protein [Arabidopsis thaliana]
 emb|CAB80602.1| putative protein [Arabidopsis thaliana]
Length=342

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T
Sbjct  1    MSATTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
              L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE
Sbjct  61   TFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQR
Sbjct  121  VMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQR  180

Query  644  KYSLGS  661
            KYSLGS
Sbjct  181  KYSLGS  186



>ref|XP_009345493.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=332

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNK+LMA  GFSFATTLTGLHFATTTL+T++LK L
Sbjct  6    KADRKASLDAASWLFNVVTSVGIIIVNKSLMATHGFSFATTLTGLHFATTTLLTIVLKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSC LEVVLD+V
Sbjct  66   GYIQPSQLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCFLEVVLDNV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR TKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRGTKLSITLVLLGVAVCTVTDVSVNAKGFIAALVAVWSTALQQHYVHSLQRKYSLGS  185



>ref|XP_011044274.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
Length=335

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KK   D  AW FN+VTSVGIIIVNKALMA +GFS+ATTLTG+HFATTTLMT +L+ L
Sbjct  6    KADKKGAADVGAWMFNVVTSVGIIIVNKALMATYGFSYATTLTGMHFATTTLMTGVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYI+ S+LP+ E +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLS+IPVSCLLEV+LD +
Sbjct  66   GYIRASHLPFPELLKFVVFANFSIVGMNVSLMWNSVGFYQIAKLSIIPVSCLLEVLLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVNAKGFIAAFIAVWST+LQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIGVVLLGVGVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHYLQRKYSLSS  185



>ref|XP_003630136.1| Membrane protein, putative [Medicago truncatula]
 gb|AET04612.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=342

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  113  AVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLIL  292
            +  K ++K  +D A+W FN+VTSVGII+VNKALMA +GF+FATTLTGLHFATTTL+T  L
Sbjct  3    STTKGDRKIALDLASWLFNVVTSVGIILVNKALMATYGFTFATTLTGLHFATTTLLTSFL  62

Query  293  KRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVL  472
            K  GYIQD++LP  + IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE+VL
Sbjct  63   KWNGYIQDTHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEIVL  122

Query  473  DSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYS  652
            D+V+YSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWSTALQQYYVHFLQ+KYS
Sbjct  123  DNVKYSRDTKLSISLVLLGVAVCTVTDVSVNAKGFIAAAVAVWSTALQQYYVHFLQKKYS  182

Query  653  LGS  661
            LGS
Sbjct  183  LGS  185



>ref|XP_009354062.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=332

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNK+LMA  GFSFATTLTGLHFATTTL+T++LK L
Sbjct  6    KADRKASLDAASWLFNVVTSVGIIIVNKSLMATHGFSFATTLTGLHFATTTLLTVVLKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSC LEVVLD+V
Sbjct  66   GYIQPSQLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCFLEVVLDNV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR TKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRGTKLSITLVLLGVAVCTVTDVSVNAKGFIAALVAVWSTALQQHYVHSLQRKYSLGS  185



>ref|XP_008232334.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
Length=331

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNK+LMA  GFSFATTLTGLHFATTTL+T+ILK L
Sbjct  6    KADRKASLDAASWLFNVVTSVGIIIVNKSLMATHGFSFATTLTGLHFATTTLLTVILKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSC LEVVLD+V
Sbjct  66   GYIQPSQLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCFLEVVLDNV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR TKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQ+YVH LQRKYSLGS
Sbjct  126  RYSRSTKLSITLVLLGVAVCTVTDVSVNAKGFIAALVAVWSTSLQQHYVHSLQRKYSLGS  185



>emb|CDX93736.1| BnaA09g23360D [Brassica napus]
Length=335

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KK   D  AW FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFA TTLMT++
Sbjct  2    APVSKADKKTAADAGAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFAFTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP++E ++FV FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V
Sbjct  62   LRCLGYIQPSHLPFTELLRFVFFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD +RYSR TKLSI LVL+GV +CTVTDVSVN+KGF+AAF+AVWST+LQQYYVH+LQRKY
Sbjct  122  LDKIRYSRHTKLSIGLVLVGVGVCTVTDVSVNSKGFLAAFVAVWSTSLQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>ref|XP_009114771.1| PREDICTED: UDP-galactose transporter 2 [Brassica rapa]
Length=335

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            + V K +KK   D  AW FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFA TTLMT++
Sbjct  2    APVSKADKKTAADAGAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFAFTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP++E ++FV FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V
Sbjct  62   LRCLGYIQPSHLPFTELLRFVFFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD +RYSR TKLSI LVL+GV +CTVTDVSVN+KGF+AAF+AVWST+LQQYYVH+LQRKY
Sbjct  122  LDKIRYSRHTKLSIGLVLVGVGVCTVTDVSVNSKGFLAAFVAVWSTSLQQYYVHYLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLSS  185



>emb|CDP11437.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTG+HFATTTLMT +L+ LGYIQ S+LP+ E
Sbjct  18   WLFNVVTSVGIIIVNKALMATYGFSFATTLTGMHFATTTLMTAVLRWLGYIQSSHLPFPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +RYSRDTKLSI L
Sbjct  78   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKIRYSRDTKLSIAL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVN KGF+AAFIAVWST+LQQYYVHFLQRKYSLGS
Sbjct  138  VLLGVGVCTVTDVSVNTKGFVAAFIAVWSTSLQQYYVHFLQRKYSLGS  185



>ref|XP_009345238.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009345239.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=332

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNK+LMA  GFSFATTLTGLHFATTTL+T++LK L
Sbjct  6    KADRKASLDAASWLFNVVTSVGIIIVNKSLMATHGFSFATTLTGLHFATTTLLTVVLKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSC LEVVLD+V
Sbjct  66   GYIQPSQLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCFLEVVLDNV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR TKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRGTKLSIALVLLGVAVCTVTDVSVNAKGFIAALVAVWSTALQQHYVHSLQRKYSLGS  185



>ref|XP_006284088.1| hypothetical protein CARUB_v10005218mg [Capsella rubella]
 gb|EOA16986.1| hypothetical protein CARUB_v10005218mg [Capsella rubella]
Length=332

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +A  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  
Sbjct  2    TATSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTF  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQRKY
Sbjct  122  LDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_007205521.1| hypothetical protein PRUPE_ppa008448mg [Prunus persica]
 gb|EMJ06720.1| hypothetical protein PRUPE_ppa008448mg [Prunus persica]
Length=331

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNK+LMA  GFSFATTLTGLHFATTTL+T+ILK L
Sbjct  6    KADRKASLDAASWLFNVVTSVGIIIVNKSLMATHGFSFATTLTGLHFATTTLLTVILKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSC LEVVLD+V
Sbjct  66   GYIQPSQLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCFLEVVLDNV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR TKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWST+LQQ+YVH LQRKYSLGS
Sbjct  126  RYSRGTKLSITLVLLGVAVCTVTDVSVNAKGFIAALVAVWSTSLQQHYVHSLQRKYSLGS  185



>gb|AAM64952.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T
Sbjct  1    MSATTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
              L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE
Sbjct  61   TFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQR
Sbjct  121  VMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQR  180

Query  644  KYSLGS  661
            KY+LGS
Sbjct  181  KYALGS  186



>ref|XP_002866846.1| hypothetical protein ARALYDRAFT_327889 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43105.1| hypothetical protein ARALYDRAFT_327889 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T
Sbjct  1    MSATSSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
              L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE
Sbjct  61   TFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQR
Sbjct  121  VMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQR  180

Query  644  KYSLGS  661
            KYSLGS
Sbjct  181  KYSLGS  186



>ref|XP_006361615.1| PREDICTED: UDP-galactose transporter 2-like [Solanum tuberosum]
Length=327

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA  D AAW FN+VTSVGIIIVNKALMAN+GF FATTLTG+HF TTTLMT++L+ L
Sbjct  6    KADKKAAGDVAAWMFNVVTSVGIIIVNKALMANYGFFFATTLTGMHFVTTTLMTILLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  + +KFVL ANFSIVGMN+SLMWNSVGFYQIAKLSMIPVSCLLEV  D +
Sbjct  66   GYIQASHLPLLDLLKFVLCANFSIVGMNISLMWNSVGFYQIAKLSMIPVSCLLEVSFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VLLGVA+CTVTDVSVN KGFIAAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLLGVAVCTVTDVSVNTKGFIAAFVAVWSTALQQYYVHYLQRKYSLSS  185



>ref|XP_009109471.1| PREDICTED: UDP-galactose transporter 2 [Brassica rapa]
 emb|CDX90331.1| BnaA08g16530D [Brassica napus]
Length=335

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +A  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  
Sbjct  2    AATSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTF  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQRKY
Sbjct  122  LDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>dbj|BAL46503.1| putative transmembrane protein [Diospyros kaki]
Length=338

 Score =   265 bits (677),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVG+I+VNKALMA +GFSFATTLTGLHFATTT MT++L+ LGYIQ S+LP+ E
Sbjct  20   WMFNVVTSVGVILVNKALMATYGFSFATTLTGLHFATTTFMTVVLRWLGYIQASHLPFPE  79

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +RYSRDTKLSI +
Sbjct  80   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKIRYSRDTKLSIAV  139

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGVA+CTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL S
Sbjct  140  VLLGVAVCTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLSS  187



>ref|XP_007201810.1| hypothetical protein PRUPE_ppa008384mg [Prunus persica]
 ref|XP_008237484.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 ref|XP_008237485.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 ref|XP_008237486.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 ref|XP_008237487.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 gb|EMJ03009.1| hypothetical protein PRUPE_ppa008384mg [Prunus persica]
Length=334

 Score =   265 bits (677),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT++L+ LGYIQ S+LP SE
Sbjct  17   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVVLRWLGYIQPSHLPVSE  76

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KF++FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  77   LLKFMIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIGV  136

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVNAKGFIAAFIAVWST+LQQYYVHFLQRKYSLGS
Sbjct  137  VLLGVGVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHFLQRKYSLGS  184



>ref|XP_010431909.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010431910.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Camelina 
sativa]
Length=332

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +A  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  
Sbjct  2    TATSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTF  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQRKY
Sbjct  122  LDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNFNGFLAAAIAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_010906037.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
 ref|XP_010906038.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
Length=335

 Score =   265 bits (677),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  +KA +DT AW FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTT+MT ILK L
Sbjct  6    KANQKAALDTGAWLFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTIMTAILKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  E IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSC LEV+ D +
Sbjct  66   GYIQGSHLPLQELIKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCFLEVLFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GVA+CTVTDVSVN++G IAA IAVWST+LQQYYVHFLQRKYSLGS
Sbjct  126  RYSRDTKLSIVVVLIGVAVCTVTDVSVNSRGLIAAAIAVWSTSLQQYYVHFLQRKYSLGS  185



>ref|XP_010027747.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 ref|XP_010027748.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 ref|XP_010027749.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 ref|XP_010027750.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 gb|KCW54336.1| hypothetical protein EUGRSUZ_I00300 [Eucalyptus grandis]
 gb|KCW54337.1| hypothetical protein EUGRSUZ_I00300 [Eucalyptus grandis]
Length=335

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FNIVTSVGII+VNKALMA +GF FATTLTGLHFATTT MTL+ + LGYIQ +NLP SE
Sbjct  18   WMFNIVTSVGIILVNKALMATYGFRFATTLTGLHFATTTTMTLVFRWLGYIQPTNLPVSE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMN+SLMWNSVGFYQIAKLSMIPVSC LEVVLD VRYSRDTKLSI++
Sbjct  78   ILKFVLFANFSIVGMNISLMWNSVGFYQIAKLSMIPVSCFLEVVLDQVRYSRDTKLSIVV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGVA CTVTDVSVN KGF+AAFIAVWSTALQQYYVHFLQRKYS+GS
Sbjct  138  VLLGVAFCTVTDVSVNFKGFLAAFIAVWSTALQQYYVHFLQRKYSIGS  185



>ref|XP_006411742.1| hypothetical protein EUTSA_v10025667mg [Eutrema salsugineum]
 gb|ESQ53195.1| hypothetical protein EUTSA_v10025667mg [Eutrema salsugineum]
Length=335

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  113  AVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLIL  292
            A  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  L
Sbjct  3    ATSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTFL  62

Query  293  KRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVL  472
              LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVL
Sbjct  63   TWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVL  122

Query  473  DSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYS  652
            D+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQRKYS
Sbjct  123  DNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQRKYS  182

Query  653  LGS  661
            LGS
Sbjct  183  LGS  185



>ref|XP_010446483.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010446484.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010446485.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Camelina 
sativa]
Length=332

 Score =   264 bits (675),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +A  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  
Sbjct  2    TATSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTF  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L  LGYIQ S LPW +  KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LTWLGYIQPSQLPWPDLFKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQRKY
Sbjct  122  LDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNFNGFLAAAIAVWSTALQQYYVHYLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_006290034.1| hypothetical protein CARUB_v10003668mg [Capsella rubella]
 gb|EOA22932.1| hypothetical protein CARUB_v10003668mg [Capsella rubella]
Length=335

 Score =   264 bits (675),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = +2

Query  143  IDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSN  322
            +D AAW FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+L+ LGY+Q S+
Sbjct  13   LDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLVLRCLGYVQPSH  72

Query  323  LPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTK  502
            LP+ E +KF++FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTK
Sbjct  73   LPFKELLKFIVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTK  132

Query  503  LSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            LSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQ+KY L S
Sbjct  133  LSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQQKYKLSS  185



>ref|XP_007159783.1| hypothetical protein PHAVU_002G266800g [Phaseolus vulgaris]
 gb|ESW31777.1| hypothetical protein PHAVU_002G266800g [Phaseolus vulgaris]
Length=334

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 167/186 (90%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++K  ID A+W FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAT-KGDRKTAIDVASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            L LK LGYIQ S+LP  + IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   LFLKWLGYIQTSHLPLPDLIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            V+LD+VRYSRDTKLSI LVLLGVA+CTVTDVS+N KGFIAA +AVWST+LQQYYVHFLQR
Sbjct  120  VILDNVRYSRDTKLSISLVLLGVAVCTVTDVSINVKGFIAAAVAVWSTSLQQYYVHFLQR  179

Query  644  KYSLGS  661
            KYSL S
Sbjct  180  KYSLRS  185



>gb|KHG12708.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=333

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+V K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T++
Sbjct  2    SSVSKADRKAALDVASWFFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTLLTVL  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LRWLGYIQGSYLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D VRYSRDTKLSILLVL+GVA+CTVTDVSVN KGF+AA IA+WSTALQQYYVHFLQRK+
Sbjct  122  FDKVRYSRDTKLSILLVLVGVAVCTVTDVSVNLKGFLAAVIAIWSTALQQYYVHFLQRKH  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_008381856.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
 ref|XP_008381857.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
Length=334

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT++L+ LGYIQ S+LP SE
Sbjct  17   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVVLRWLGYIQPSHLPVSE  76

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KF++FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  77   LLKFMVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIGI  136

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVNAKGFIAA IAVWSTALQQYYVHFLQRKYSLGS
Sbjct  137  VLLGVGVCTVTDVSVNAKGFIAAXIAVWSTALQQYYVHFLQRKYSLGS  184



>ref|XP_007048170.1| Nucleotide-sugar transporter family protein isoform 4, partial 
[Theobroma cacao]
 gb|EOX92327.1| Nucleotide-sugar transporter family protein isoform 4, partial 
[Theobroma cacao]
Length=234

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 167/186 (90%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA +D A+W FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAS-KADRKAALDVASWFFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++L+ LGYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   VLLRWLGYIQGSYLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VV D VRYSRDTKLSI++VLLGVA+CTVTDVSVN KGF+AA IAVWSTALQQYYVHFLQR
Sbjct  120  VVFDKVRYSRDTKLSIVVVLLGVAVCTVTDVSVNFKGFLAAVIAVWSTALQQYYVHFLQR  179

Query  644  KYSLGS  661
            K+SLGS
Sbjct  180  KHSLGS  185



>ref|XP_010932887.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
 ref|XP_010932888.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
Length=336

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D  AW FN+VTSVGII+VNKALM  +GFSFATTLTGLHFATTT+MT+IL+ L
Sbjct  6    KADQKAALDAGAWFFNVVTSVGIIMVNKALMVTYGFSFATTLTGLHFATTTIMTIILRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  + IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCLLEV+ D +
Sbjct  66   GYIQTSHLPLPDLIKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCLLEVLFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GVA+CTVTDVSVN +G IAA IAVWSTALQQYYVHFLQRKYSLGS
Sbjct  126  RYSRDTKLSIVVVLIGVAVCTVTDVSVNTRGLIAAMIAVWSTALQQYYVHFLQRKYSLGS  185



>ref|XP_008777064.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008777065.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Phoenix 
dactylifera]
Length=336

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA +D  AW FN+VTSVGII+VNKALM  +GFSFATTLTGLHFATTT+MT++L+ L
Sbjct  6    KADKKAGLDAGAWLFNVVTSVGIIMVNKALMVTYGFSFATTLTGLHFATTTVMTVVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP  E IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCLLEV+LD +
Sbjct  66   GYIQASHLPLPELIKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCLLEVLLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GVA+CTVTDVSVN +G IAA IAVWST+LQQYYVHFLQR YSLGS
Sbjct  126  RYSRDTKLSIVVVLIGVAVCTVTDVSVNTRGLIAAMIAVWSTSLQQYYVHFLQRNYSLGS  185



>emb|CDY42623.1| BnaC01g00350D [Brassica napus]
Length=356

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  98   RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttl  277
            +K      K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL
Sbjct  19   KKEMGGTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTL  78

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            +T  L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL
Sbjct  79   LTTFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  138

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEVVLD VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH L
Sbjct  139  LEVVLDKVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHHL  198

Query  638  QRKYSLGS  661
            QRKYSLGS
Sbjct  199  QRKYSLGS  206



>ref|XP_009119734.1| PREDICTED: UDP-galactose transporter 2-like [Brassica rapa]
 emb|CDY41976.1| BnaA01g05480D [Brassica napus]
Length=335

 Score =   262 bits (670),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  L  L
Sbjct  6    KTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTFLTWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD V
Sbjct  66   GYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH LQRKYSLGS
Sbjct  126  RYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHHLQRKYSLGS  185



>ref|XP_011100579.1| PREDICTED: UDP-galactose transporter 2 [Sesamum indicum]
 ref|XP_011100585.1| PREDICTED: UDP-galactose transporter 2 [Sesamum indicum]
Length=335

 Score =   262 bits (670),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT +L+ LGYIQ S+LP+ E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTAVLRWLGYIQASHLPYPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFV+FANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLE++ D +RYSRDTKLSIL+
Sbjct  78   LLKFVVFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLEIMFDKIRYSRDTKLSILV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGVA+CTVTDVSVNAKGFIAAFIAVWST+LQQYYVHFLQRKYSL S
Sbjct  138  VLLGVAVCTVTDVSVNAKGFIAAFIAVWSTSLQQYYVHFLQRKYSLTS  185



>gb|KJB59485.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
Length=242

 Score =   259 bits (661),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D AAW FN+VTSVG+IIVNKALMA +GFS+ATTLTGLHFATTTLMT  L+  
Sbjct  6    KAERKAVVDVAAWMFNVVTSVGVIIVNKALMATYGFSYATTLTGLHFATTTLMTAALRWF  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S+LP SE ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV+D +
Sbjct  66   GFIQSSHLPLSELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVMDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTD+SVN +GFIAAFIAVWST+LQQYYV  LQR+Y+L S
Sbjct  126  RYSRDTKLSIAVVLLGVGVCTVTDLSVNTQGFIAAFIAVWSTSLQQYYVLHLQRRYNLSS  185



>ref|XP_008378692.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
Length=332

 Score =   262 bits (669),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNK+LMA  GFSFATTLTGLHFATTTL+T++LK L
Sbjct  6    KADRKASLDAASWLFNVVTSVGIIIVNKSLMAKHGFSFATTLTGLHFATTTLLTVVLKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSC LEVVLD+V
Sbjct  66   GYIQPSQLPLRDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCFLEVVLDNV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYS  TKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSXGTKLSITLVLLGVAVCTVTDVSVNAKGFIAALVAVWSTALQQHYVHSLQRKYSLGS  185



>ref|XP_006589484.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
 ref|XP_006589485.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
 ref|XP_006589486.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Glycine 
max]
 ref|XP_006589487.1| PREDICTED: UDP-galactose transporter 2-like isoform X4 [Glycine 
max]
 gb|KHN17037.1| UDP-galactose transporter 2 [Glycine soja]
Length=322

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D AAW FN+VTSVG+IIVNKALMA +GFSFATTLTGLHFATTTLMT +L+ L
Sbjct  6    KAEKKATVDAAAWVFNVVTSVGVIIVNKALMATYGFSFATTLTGLHFATTTLMTTLLRIL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP  E +KFV FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  D++
Sbjct  66   GYVQPSHLPLPELLKFVFFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVFFDNI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTDVSVN KGF++AF+AVWST+LQQYYVHFLQRKYSL S
Sbjct  126  RYSRDTKLSIGVVLLGVGVCTVTDVSVNTKGFVSAFMAVWSTSLQQYYVHFLQRKYSLSS  185



>ref|XP_010683206.1| PREDICTED: UDP-galactose transporter 2-like [Beta vulgaris subsp. 
vulgaris]
Length=331

 Score =   261 bits (668),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +   K EKKA +D  AW FN+VTSVGIIIVNKALMA + FSFATTLTGLHF  TT+MTL+
Sbjct  2    APATKAEKKAALDAGAWMFNVVTSVGIIIVNKALMAKYEFSFATTLTGLHFTATTIMTLV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LPW + ++FVLFAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V
Sbjct  62   LRWLGYIQPSHLPWPDLLRFVLFANVSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEIV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD VRYSRDTKLSI LVL+GVA+CTVTD+SVNAKGFI A IAVW T+LQQY VH LQ+K+
Sbjct  122  LDKVRYSRDTKLSIGLVLVGVAVCTVTDISVNAKGFITALIAVWGTSLQQYSVHHLQKKF  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLNS  185



>gb|KJB59483.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
Length=264

 Score =   259 bits (662),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D AAW FN+VTSVG+IIVNKALMA +GFS+ATTLTGLHFATTTLMT  L+  
Sbjct  6    KAERKAVVDVAAWMFNVVTSVGVIIVNKALMATYGFSYATTLTGLHFATTTLMTAALRWF  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S+LP SE ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV+D +
Sbjct  66   GFIQSSHLPLSELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVMDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTD+SVN +GFIAAFIAVWST+LQQYYV  LQR+Y+L S
Sbjct  126  RYSRDTKLSIAVVLLGVGVCTVTDLSVNTQGFIAAFIAVWSTSLQQYYVLHLQRRYNLSS  185



>gb|KJB18354.1| hypothetical protein B456_003G048300 [Gossypium raimondii]
Length=333

 Score =   261 bits (668),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+V K ++KA +D A+W FN+VTSVGII+VNKALMA +GF FATTLTGLHF TTTL+T++
Sbjct  2    SSVSKADRKAALDVASWFFNVVTSVGIIMVNKALMATYGFGFATTLTGLHFGTTTLLTVL  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LRWLGYIQGSYLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D VRYSRDTKLSILLVL+GVA+CTVTDVSVN KGF+AA IA+WSTALQQYYVHFLQRK+
Sbjct  122  FDKVRYSRDTKLSILLVLVGVAVCTVTDVSVNLKGFLAAVIAIWSTALQQYYVHFLQRKH  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_003634527.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 ref|XP_010665174.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 emb|CBI18242.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTLMT IL+ LGYIQ S+LP  E
Sbjct  18   WMFNVVTSVGIILVNKALMATYGFSFATTLTGLHFVTTTLMTAILRWLGYIQPSHLPLPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  78   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSISV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGVA+CTVTDVSVN +GFIAAFIAVWST+LQQYYVHFLQRKYSL S
Sbjct  138  VLLGVAVCTVTDVSVNTRGFIAAFIAVWSTSLQQYYVHFLQRKYSLSS  185



>ref|XP_004252567.1| PREDICTED: UDP-galactose transporter 2 [Solanum lycopersicum]
Length=327

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K  KKA  D AAW FN+VTSVGIIIVNKALMAN+GF FATTLTG+HF TTTLMT++L+ L
Sbjct  6    KANKKAAGDVAAWMFNVVTSVGIIIVNKALMANYGFFFATTLTGMHFVTTTLMTIVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G IQ S+LP  + +KFVL ANFSIVGMN+SLMWNSVGFYQIAKLSMIPVSCLLEV  D +
Sbjct  66   GIIQASHLPLLDLLKFVLCANFSIVGMNISLMWNSVGFYQIAKLSMIPVSCLLEVSFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VLLGVA+CTVTDVSVN KGFIAAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLLGVAVCTVTDVSVNTKGFIAAFVAVWSTALQQYYVHYLQRKYSLSS  185



>ref|XP_004288090.1| PREDICTED: UDP-galactose transporter 2 [Fragaria vesca subsp. 
vesca]
Length=331

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNK+LMA  GFSFATTLTGLHFATTTL+TL+LK L
Sbjct  5    KGDRKATLDAASWLFNVVTSVGIIIVNKSLMAKHGFSFATTLTGLHFATTTLLTLVLKWL  64

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKL+MIPVSC LEVVLD V
Sbjct  65   GYIQPSQLPVPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCFLEVVLDKV  124

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI LVLLGVA+CTVTDVSVNAKGFIAA +AVWSTALQQYYVH LQRKYSL S
Sbjct  125  RYSRDTKLSITLVLLGVAVCTVTDVSVNAKGFIAASVAVWSTALQQYYVHHLQRKYSLSS  184



>gb|EPS62651.1| hypothetical protein M569_12141, partial [Genlisea aurea]
Length=190

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVG+IIVNKALMA++GFSFATTLTGLHFATTTLMT +L+  G+IQ S+LP+ E
Sbjct  18   WLFNVVTSVGVIIVNKALMASYGFSFATTLTGLHFATTTLMTAVLRCSGFIQASHLPFPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KF LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSIL+
Sbjct  78   LLKFALFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSILV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL GVA+CTVTDVSVN KGFIAAFIAVWST++QQYYVHFLQRKYSL S
Sbjct  138  VLFGVAVCTVTDVSVNTKGFIAAFIAVWSTSMQQYYVHFLQRKYSLTS  185



>ref|XP_010555309.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
 ref|XP_010555310.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
Length=337

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +A  K ++KA +D A+W FNIVTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T +
Sbjct  2    TATSKTDRKAALDIASWMFNIVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTTV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L  LGYIQ S LP  + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LTWLGYIQPSQLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSI++VL+GV +CT+TDV+VN KGF+AA IAVWSTALQQYYVHFLQRKY
Sbjct  122  LDNVRYSRDTKLSIMVVLVGVGVCTITDVNVNFKGFLAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SLGS
Sbjct  182  SLGS  185



>ref|XP_011074099.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011074100.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011074101.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011074102.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
Length=335

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT +L+ LGYIQ S+LP+ E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTAVLRWLGYIQVSHLPFKE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  D +RYSRDTKLSIL+
Sbjct  78   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVAFDKIRYSRDTKLSILV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGVA+CTVTDVSVN +GF+AAFIAVWST+LQQYYVHFLQRKYSL S
Sbjct  138  VLLGVAVCTVTDVSVNTRGFLAAFIAVWSTSLQQYYVHFLQRKYSLSS  185



>ref|XP_010538909.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
Length=336

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT+IL+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVILRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVL ANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +RYSRDTKLSI L
Sbjct  78   LLKFVLLANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVN KGFIAAFIAVWST+LQQYYVH+LQRKY+L S
Sbjct  138  VLLGVGVCTVTDVSVNTKGFIAAFIAVWSTSLQQYYVHYLQRKYALSS  185



>ref|XP_006647512.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647513.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Oryza 
brachyantha]
Length=335

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S LP+SE +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV CLLE++ D V
Sbjct  66   GHIQPSYLPFSELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCLLEIIFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR+TKLSI+LVL+GVA+CTVTDVSVN+KG +AA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRNTKLSIVLVLVGVAVCTVTDVSVNSKGLLAAIIAVWSTALQQHYVHLLQRKYSLGS  185



>ref|XP_006305303.1| hypothetical protein CARUB_v10009678mg [Capsella rubella]
 gb|EOA38201.1| hypothetical protein CARUB_v10009678mg [Capsella rubella]
Length=335

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFATTTLMTL+L+ LGYIQ S+LP+SE
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTLVLRCLGYIQPSHLPFSE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSI L
Sbjct  78   LLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  138  VLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSLNS  185



>ref|XP_007048167.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007048168.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOX92324.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92325.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=335

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 167/186 (90%), Gaps = 1/186 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA +D A+W FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAS-KADRKAALDVASWFFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++L+ LGYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   VLLRWLGYIQGSYLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VV D VRYSRDTKLSI++VLLGVA+CTVTDVSVN KGF+AA IAVWSTALQQYYVHFLQR
Sbjct  120  VVFDKVRYSRDTKLSIVVVLLGVAVCTVTDVSVNFKGFLAAVIAVWSTALQQYYVHFLQR  179

Query  644  KYSLGS  661
            K+SLGS
Sbjct  180  KHSLGS  185



>gb|KJB59484.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
 gb|KJB59486.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
 gb|KJB59487.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
Length=335

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D AAW FN+VTSVG+IIVNKALMA +GFS+ATTLTGLHFATTTLMT  L+  
Sbjct  6    KAERKAVVDVAAWMFNVVTSVGVIIVNKALMATYGFSYATTLTGLHFATTTLMTAALRWF  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S+LP SE ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV+D +
Sbjct  66   GFIQSSHLPLSELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVMDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTD+SVN +GFIAAFIAVWST+LQQYYV  LQR+Y+L S
Sbjct  126  RYSRDTKLSIAVVLLGVGVCTVTDLSVNTQGFIAAFIAVWSTSLQQYYVLHLQRRYNLSS  185



>ref|XP_002307141.1| transporter-related family protein [Populus trichocarpa]
 gb|ABK92883.1| unknown [Populus trichocarpa]
 gb|EEE94137.1| transporter-related family protein [Populus trichocarpa]
Length=334

 Score =   259 bits (661),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  AWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWS  334
            +W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T++L+ LGYIQ S+LP  
Sbjct  16   SWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTVVLRWLGYIQPSHLPLP  75

Query  335  ERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSIL  514
            + +KFVLFAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVVLD+VRYSRDTKLSIL
Sbjct  76   DLLKFVLFANCSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVLDNVRYSRDTKLSIL  135

Query  515  LVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            +VLLGVA+CTVTDVSVNAKGFIAA IAVWST+LQQYYVHFLQR+YSLGS
Sbjct  136  VVLLGVAVCTVTDVSVNAKGFIAAVIAVWSTSLQQYYVHFLQRRYSLGS  184



>ref|XP_004140956.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
 gb|KGN46117.1| hypothetical protein Csa_6G055380 [Cucumis sativus]
Length=335

 Score =   259 bits (661),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT+IL+ LGYIQ S+LP  E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVILRWLGYIQASHLPLPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  78   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIAV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVN +GF+AA IAVWST+LQQYYVHFLQRKYSL S
Sbjct  138  VLLGVGVCTVTDVSVNTRGFVAAIIAVWSTSLQQYYVHFLQRKYSLSS  185



>ref|XP_011021966.1| PREDICTED: UDP-galactose transporter 2-like [Populus euphratica]
Length=334

 Score =   259 bits (661),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  AWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWS  334
            +W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T++L+ LGYIQ S+LP  
Sbjct  16   SWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTVVLRWLGYIQPSHLPLP  75

Query  335  ERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSIL  514
            + +KFVLFAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVVLD+VRYSRDTKLSIL
Sbjct  76   DLLKFVLFANCSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVLDNVRYSRDTKLSIL  135

Query  515  LVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            +VLLGVA+CTVTDVSVNAKGFIAA IAVWST+LQQYYVHFLQR+YSLGS
Sbjct  136  VVLLGVAVCTVTDVSVNAKGFIAAVIAVWSTSLQQYYVHFLQRRYSLGS  184



>ref|NP_564433.1| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AAG12540.1|AC015446_21 Unknown protein [Arabidopsis thaliana]
 gb|AAG12852.1|AC079286_9 unknown protein; 21747-23353 [Arabidopsis thaliana]
 gb|ACF20469.1| At1g34020 [Arabidopsis thaliana]
 gb|AEE31658.1| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AIJ02000.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=335

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFATTTLMTL+L+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTLVLRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSI L
Sbjct  78   LLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  138  VLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSLNS  185



>ref|XP_008456746.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis melo]
Length=335

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMT+IL+ LGYIQ S+LP  E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVILRWLGYIQASHLPLPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  78   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIAV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVN +GF+AA IAVWST+LQQYYVHFLQRKYSL S
Sbjct  138  VLLGVGVCTVTDVSVNTRGFVAAVIAVWSTSLQQYYVHFLQRKYSLSS  185



>ref|XP_006842618.1| hypothetical protein AMTR_s00077p00178780 [Amborella trichopoda]
 gb|ERN04293.1| hypothetical protein AMTR_s00077p00178780 [Amborella trichopoda]
Length=333

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGIIIVNKALMA +GFSFATTLTGLHFATTTLMTL+L+ +
Sbjct  6    KADRKAALDVASWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLVLRWM  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ ++LP SE +KFVLFANFSIVGMN+SLMWNSVGFYQIAKLSMIPVSCLLEV LD +
Sbjct  66   GYIQSTHLPLSELLKFVLFANFSIVGMNISLMWNSVGFYQIAKLSMIPVSCLLEVFLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSIL+VL+GV +CTVTDVSVN KG IAA IAVWST+LQQYYVHFLQRKYS+GS
Sbjct  126  RYSRDTKLSILVVLVGVGVCTVTDVSVNTKGLIAAVIAVWSTSLQQYYVHFLQRKYSMGS  185



>ref|XP_002891071.1| hypothetical protein ARALYDRAFT_473556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67330.1| hypothetical protein ARALYDRAFT_473556 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFATTTLMT++L+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTIVLRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSI L
Sbjct  78   LLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  138  VLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSLNS  185



>gb|KDO57105.1| hypothetical protein CISIN_1g0430191mg, partial [Citrus sinensis]
Length=173

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSS     ++KA  D AAW FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTT++T
Sbjct  1    MSSTTKAADRKAATDVAAWMFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTMLT  60

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
              L+ LGYIQ S+LP+SE ++FV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  61   TFLRWLGYIQTSHLPFSELVRFVVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  120

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQY  622
            VVLD VRYSRDTKLSILLVL GV +CTVTDVSVNAKGFIAAF+AVWSTA+QQY
Sbjct  121  VVLDKVRYSRDTKLSILLVLFGVGVCTVTDVSVNAKGFIAAFVAVWSTAMQQY  173



>ref|XP_009416387.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   257 bits (657),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D AAWTFNIVTSVGII+VNKAL+A   F+FATTLTGLHFATTTL+T+I + L
Sbjct  6    KADRKAALDVAAWTFNIVTSVGIIMVNKALLATHRFTFATTLTGLHFATTTLLTIIFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP S  IKFVLFAN SIVGMN+SLMWNSVGFYQIAKLSMIPVSCLLEVV D +
Sbjct  66   GYIQPSHLPLSNLIKFVLFANLSIVGMNISLMWNSVGFYQIAKLSMIPVSCLLEVVFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSR TKLSI++VL GVAICTVTDVSVNA+G IAA IAVWSTALQQYYVHFLQ+KYSLGS
Sbjct  126  HYSRATKLSIVVVLAGVAICTVTDVSVNARGLIAATIAVWSTALQQYYVHFLQKKYSLGS  185



>ref|NP_001150661.1| integral membrane protein like [Zea mays]
 gb|ACG39923.1| integral membrane protein like [Zea mays]
Length=332

 Score =   256 bits (655),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            SA+ K +KKA +D AAW+FN+ TSVG+I+VNKALMA +GFSFATTLTGLHF TTTLMT++
Sbjct  2    SALKKSDKKAALDFAAWSFNVTTSVGLIMVNKALMATYGFSFATTLTGLHFVTTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
             + LG  Q S+LP ++ +KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV
Sbjct  62   FRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D V YSRDTKLSI++VL+GVA+CTVTDVSVNA+G IAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  FDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLNS  185



>ref|XP_006415048.1| hypothetical protein EUTSA_v10008144mg [Eutrema salsugineum]
 gb|ESQ33401.1| hypothetical protein EUTSA_v10008144mg [Eutrema salsugineum]
Length=335

 Score =   257 bits (656),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFATTTLMT++L+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTIVLRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSI L
Sbjct  78   LMRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL+GV +CTVTDVSVN+KGF+AAF+AVWST+LQQYYVH+LQRKYSL S
Sbjct  138  VLVGVGVCTVTDVSVNSKGFLAAFVAVWSTSLQQYYVHYLQRKYSLSS  185



>ref|XP_003575354.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
 ref|XP_010235698.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
Length=335

 Score =   256 bits (655),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA ID  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL+++ L
Sbjct  6    KAERKAAIDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMQWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++ D V
Sbjct  66   GYIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRDTKLSIMLVLVGVAVCTVTDVSVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS  185



>gb|AFW64703.1| integral membrane protein like protein isoform 1 [Zea mays]
 gb|AFW64704.1| integral membrane protein like protein isoform 2 [Zea mays]
Length=332

 Score =   256 bits (655),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            SA+ K +KKA +D AAW+FN+ TSVG+I+VNKALMA +GFSFATTLTGLHF TTTLMT++
Sbjct  2    SALKKSDKKAALDFAAWSFNVTTSVGLIMVNKALMATYGFSFATTLTGLHFVTTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
             + LG  Q S+LP ++ +KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV
Sbjct  62   FRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D V YSRDTKLSI++VL+GVA+CTVTDVSVNA+G IAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  FDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLNS  185



>ref|XP_010530127.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
 ref|XP_010530128.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
Length=336

 Score =   256 bits (655),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTLMT IL+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTLMTAILRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +RYSRDTKLSI L
Sbjct  78   LLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CT+TDVSVN KG IAAFIAVWST+LQQYYVH+LQRKY+L S
Sbjct  138  VLLGVGVCTITDVSVNTKGVIAAFIAVWSTSLQQYYVHYLQRKYALSS  185



>ref|XP_010531423.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
 ref|XP_010531424.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
 ref|XP_010531425.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
Length=334

 Score =   256 bits (655),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHFATTTL+T  L  L
Sbjct  8    KTDRKAALDIASWMFNVVTSVGIILVNKALMATYGFSFATTLTGLHFATTTLLTTSLTWL  67

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD+V
Sbjct  68   GYIQPSQLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDNV  127

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GV +CTVTDVSVN  GF+AA IAV STALQQYYVHFLQRKYSLGS
Sbjct  128  RYSRDTKLSIMVVLVGVGVCTVTDVSVNFNGFLAAAIAVCSTALQQYYVHFLQRKYSLGS  187



>ref|XP_004953102.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=335

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++LD V
Sbjct  66   GYIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILLDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRDTKLSIVLVLVGVAVCTVTDVSVNSQGLLAAAIAVWSTALQQHYVHHLQRKYSLGS  185



>ref|XP_002450200.1| hypothetical protein SORBIDRAFT_05g001870 [Sorghum bicolor]
 gb|EES09188.1| hypothetical protein SORBIDRAFT_05g001870 [Sorghum bicolor]
Length=332

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S + K +KKA +D AAW+FN+ TSVGII+VNKALMA +GFSFATTLTGLHF TTTLMT++
Sbjct  2    STLKKSDKKAALDFAAWSFNVTTSVGIIMVNKALMATYGFSFATTLTGLHFVTTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
             + LG  Q S+LP ++ +KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV
Sbjct  62   FRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D V YSRDTKLSI++VL+GVA+CTVTDVSVNA+G IAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  FDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLNS  185



>ref|XP_004982861.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=332

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S++ K +KKA +D AAW+FN+ TSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++
Sbjct  2    SSLKKSDKKAALDFAAWSFNVTTSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
             + LG  Q S+LP ++ IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV
Sbjct  62   FRWLGLSQPSHLPLADLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D V YSRDTKLSI++VL+GVA+CTVTDVSVNA+G IAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  FDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLNS  185



>ref|XP_006654160.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006654161.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Oryza 
brachyantha]
Length=335

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAQRKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E IKFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++ D V
Sbjct  66   GYIQPSYLPVPELIKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRDTKLSIMLVLVGVAVCTVTDVSVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS  185



>gb|AAM66068.1| unknown [Arabidopsis thaliana]
Length=335

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFATTTLMTL+L+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTLVLRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSI L
Sbjct  78   LLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL+GV +CTVTDVSVN K F+AAF+AVWSTALQQYYVH+LQRKYSL S
Sbjct  138  VLVGVGVCTVTDVSVNTKRFVAAFVAVWSTALQQYYVHYLQRKYSLNS  185



>ref|XP_006434522.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
 ref|XP_006473110.1| PREDICTED: UDP-galactose transporter 2-like [Citrus sinensis]
 gb|ESR47762.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
Length=336

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGII+VNKALMA +GFSFATTLTG+HFATTTLMT +L+ LGYIQ S+LP+ E
Sbjct  20   WMFNVVTSVGIILVNKALMATYGFSFATTLTGMHFATTTLMTGVLRWLGYIQPSHLPFRE  79

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  80   LLKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIAV  139

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGV +CTVTDVSVNA+GFIAA IAVWST++QQYYVH LQRKYSL S
Sbjct  140  VLLGVGVCTVTDVSVNARGFIAALIAVWSTSIQQYYVHHLQRKYSLTS  187



>ref|NP_001148538.1| integral membrane protein like [Zea mays]
 gb|ACG31895.1| integral membrane protein like [Zea mays]
 gb|ACL53944.1| unknown [Zea mays]
 gb|ACN32141.1| unknown [Zea mays]
 tpg|DAA39269.1| TPA: putative integral membrane protein isoform 1 [Zea mays]
 tpg|DAA39270.1| TPA: putative integral membrane protein isoform 2 [Zea mays]
Length=332

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S + K +KKA +D AAW+FN+ TSVG+I+VNKALMA +GFSFATTLTGLHF TTTLMT++
Sbjct  2    STLKKSDKKAALDFAAWSFNVTTSVGLIMVNKALMATYGFSFATTLTGLHFVTTTLMTIL  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
             + LG  Q S+LP ++ +KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV
Sbjct  62   FRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D V YSRDTKLSI++VL+GVA+CTVTDVSVNA+G IAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  FDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLNS  185



>ref|XP_010461221.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
 ref|XP_010478820.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=335

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFATTTLMT++L+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTIVLRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSI L
Sbjct  78   LLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL+GV +CTVTDVSVN KGF+AA +AVWSTALQQYYVH+LQRKYSL S
Sbjct  138  VLVGVGVCTVTDVSVNTKGFVAAVVAVWSTALQQYYVHYLQRKYSLNS  185



>gb|ACF86881.1| unknown [Zea mays]
Length=332

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            SA+ K +KKA +D AAW+FN+ TSVG+I+VNKALMA +GFSFATTLTGLHF TTTLMT++
Sbjct  2    SALKKSDKKAALDFAAWSFNVTTSVGLIMVNKALMATYGFSFATTLTGLHFVTTTLMTIV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
             + LG  Q S+LP ++ +KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV
Sbjct  62   FRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D V YSRDTKLSI++VL+GVA+CTVTDVSVN +G IAA IAVWSTALQQYYVHFLQRKY
Sbjct  122  FDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNTRGLIAAVIAVWSTALQQYYVHFLQRKY  181

Query  650  SLGS  661
            SL S
Sbjct  182  SLNS  185



>ref|XP_010096478.1| hypothetical protein L484_006725 [Morus notabilis]
 gb|EXB64488.1| hypothetical protein L484_006725 [Morus notabilis]
Length=260

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S+  K EKKA ID A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T +
Sbjct  2    SSTGKAEKKAAIDAASWMFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTSV  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L+ LGYIQ S+LP S+ +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV
Sbjct  62   LRWLGYIQPSHLPLSDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQY  622
            LD VRYSRDTKLSILLVL+GV +CTVTDVSVNAKGFIAA +AVWSTALQQY
Sbjct  122  LDHVRYSRDTKLSILLVLIGVGVCTVTDVSVNAKGFIAALVAVWSTALQQY  172



>ref|XP_010499941.1| PREDICTED: UDP-galactose transporter 2 [Camelina sativa]
Length=335

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA +G+SFATTLTGLHFATTTLMT++L+ LGYIQ S+LP++E
Sbjct  18   WMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTIVLRCLGYIQPSHLPFTE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D +RYSRDTKLSI L
Sbjct  78   LLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFDKIRYSRDTKLSIGL  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VL+GV +CTVTDVSVN KGF+AA +AVWSTALQQYYVH+LQRKYSL S
Sbjct  138  VLVGVGVCTVTDVSVNTKGFVAAVVAVWSTALQQYYVHYLQRKYSLNS  185



>gb|EEE62758.1| hypothetical protein OsJ_17561 [Oryza sativa Japonica Group]
Length=332

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FNIVTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNIVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E IKFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++ D V
Sbjct  66   GYIQPSYLPVPELIKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTK SI++VL+GVA+CTVTDVSVN++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRDTKFSIMVVLVGVAVCTVTDVSVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS  185



>ref|NP_001054935.1| Os05g0215800 [Oryza sativa Japonica Group]
 gb|AAT47018.1| putative transmembrane protein [Oryza sativa Japonica Group]
 dbj|BAF16849.1| Os05g0215800 [Oryza sativa Japonica Group]
 dbj|BAG89240.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78725.1| hypothetical protein OsI_18907 [Oryza sativa Indica Group]
Length=335

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FNIVTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNIVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E IKFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++ D V
Sbjct  66   GYIQPSYLPVPELIKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTK SI++VL+GVA+CTVTDVSVN++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  126  RYSRDTKFSIMVVLVGVAVCTVTDVSVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS  185



>ref|XP_009406813.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406814.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406815.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406816.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406817.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D  AW FN+VTSVGII+VNKALMA   FSFATTLTGLHFA TT+MTL+ K L
Sbjct  6    KADRKAALDVTAWMFNVVTSVGIIMVNKALMAMHRFSFATTLTGLHFAMTTIMTLLFKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP S  IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCLLEVV D +
Sbjct  66   GYIQPSHLPVSNLIKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCLLEVVFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSR TKLSI++VL+GVAICTVTDVSVNAKG +AA IAVWST+LQQYYVHFLQ+KYSLGS
Sbjct  126  HYSRATKLSIVVVLVGVAICTVTDVSVNAKGLMAAIIAVWSTSLQQYYVHFLQKKYSLGS  185



>ref|XP_009419689.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   254 bits (649),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D AAW FNI+TSVG+I+VNKALMA   FSFATTLTGLHF  TTLMT++ K L
Sbjct  6    KSDRKAPLDAAAWMFNILTSVGVIMVNKALMATHQFSFATTLTGLHFVATTLMTIVFKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S+LP SE IK+V FAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D +
Sbjct  66   GYIQTSHLPLSELIKYVFFANLSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR TKLSI++VL+GVAICTVTDVSVN++G IAA IAVWST+LQQYYVH LQ+KYSLGS
Sbjct  126  RYSRATKLSIVVVLVGVAICTVTDVSVNSRGLIAATIAVWSTSLQQYYVHSLQKKYSLGS  185



>ref|XP_002441741.1| hypothetical protein SORBIDRAFT_08g001580 [Sorghum bicolor]
 gb|EES15579.1| hypothetical protein SORBIDRAFT_08g001580 [Sorghum bicolor]
Length=336

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            S++ K +KKA +D AAW+FN+ TSVGII+VNKALMA  GFSFATTLTGLHFATTTLMT++
Sbjct  6    SSLKKSDKKAALDFAAWSFNVTTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTIV  65

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
             + LG  Q S LP ++ IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV
Sbjct  66   FRWLGLSQPSQLPVADLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVV  125

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
             D V YSRDTKLSI++VL GVA+CTVTDVSVNA+G IAA IAVWSTALQQYYVHFLQRKY
Sbjct  126  FDHVHYSRDTKLSIMVVLTGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRKY  185

Query  650  SLGS  661
            SL S
Sbjct  186  SLNS  189



>ref|NP_001047426.1| Os02g0614500 [Oryza sativa Japonica Group]
 dbj|BAD19452.1| transmembrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD19727.1| transmembrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF09340.1| Os02g0614500 [Oryza sativa Japonica Group]
 dbj|BAG93009.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57369.1| hypothetical protein OsJ_07519 [Oryza sativa Japonica Group]
Length=331

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GHIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEILFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR+TKLSI+LVL+GVA+CTVTDVSVN+KG +AA IAVWSTALQQ+YVH LQ+KYSLGS
Sbjct  126  RYSRNTKLSIVLVLVGVAVCTVTDVSVNSKGLLAAVIAVWSTALQQHYVHHLQKKYSLGS  185



>gb|EEC73595.1| hypothetical protein OsI_08063 [Oryza sativa Indica Group]
Length=331

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GHIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEILFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR+TKLSI+LVL+GVA+CTVTDVSVN+KG +AA IAVWSTALQQ+YVH LQ+KYSLGS
Sbjct  126  RYSRNTKLSIVLVLVGVAVCTVTDVSVNSKGLLAAVIAVWSTALQQHYVHHLQKKYSLGS  185



>ref|XP_002969143.1| hypothetical protein SELMODRAFT_170422 [Selaginella moellendorffii]
 ref|XP_002973919.1| hypothetical protein SELMODRAFT_100527 [Selaginella moellendorffii]
 gb|EFJ24874.1| hypothetical protein SELMODRAFT_100527 [Selaginella moellendorffii]
 gb|EFJ30259.1| hypothetical protein SELMODRAFT_170422 [Selaginella moellendorffii]
Length=338

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +2

Query  128  EKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGY  307
            ++KA+ D  AW FN+ TSVGII+VNK LM ++GFSFATTLTGLHF  TTLMTL+L+ LG+
Sbjct  8    DRKAVADVGAWLFNVTTSVGIIMVNKKLMDHYGFSFATTLTGLHFGMTTLMTLVLRFLGF  67

Query  308  IQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRY  487
            IQ ++LP+ +  KF L ANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV+ D +RY
Sbjct  68   IQPTHLPFVDLAKFALCANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVLFDKIRY  127

Query  488  SRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            SRDTKLSI++VLLGV ICTV+DVSVN KGF+AA IAVWSTALQQYYVHFLQ+KY+LGS
Sbjct  128  SRDTKLSIVVVLLGVGICTVSDVSVNTKGFVAAAIAVWSTALQQYYVHFLQKKYALGS  185



>gb|KHG03706.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=335

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D AAW FN+VTSVG+IIVNKALMA +GFS+ATTLTGLHFATTTLMT  L+  
Sbjct  6    KAERKAVVDVAAWMFNVVTSVGVIIVNKALMATYGFSYATTLTGLHFATTTLMTTALRWF  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S+LP SE +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV+D +
Sbjct  66   GFIQSSHLPLSELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVMDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI +VLLGV +CTVTD+SVN +GFIAAFIAVWST+LQQYYV  LQR+Y+L S
Sbjct  126  RYSRDTKLSIAVVLLGVGVCTVTDLSVNTQGFIAAFIAVWSTSLQQYYVLHLQRRYNLSS  185



>ref|XP_004978448.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=332

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA++D AAW+FN+ TSVGII+VNKALMA +GFSFATTLTGLHF TTTLMTL+ + L
Sbjct  6    KSDKKAVLDFAAWSFNVTTSVGIIMVNKALMATYGFSFATTLTGLHFVTTTLMTLVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP ++ IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLADLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDHV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GV +CTVTDVSVNA+G +AA IAVWSTA QQYYVHFLQ+KY+L S
Sbjct  126  HYSRDTKLSIMVVLIGVGVCTVTDVSVNARGLVAAVIAVWSTAFQQYYVHFLQKKYALNS  185



>gb|AAK50365.1| putative transmembrane protein [Oryza sativa Japonica Group]
Length=331

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA++D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GHIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEILFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSR+TKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+YVH LQ+KYSLGS
Sbjct  126  RYSRNTKLSIVLVLVGVAVCTVTDVSVNSRGLLAAVIAVWSTALQQHYVHHLQKKYSLGS  185



>gb|EMS67795.1| hypothetical protein TRIUR3_18539 [Triticum urartu]
Length=337

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+ NKALMA  GFSFATTLTGLHF TTTLMT ++K L
Sbjct  8    KAERKAALDAGAWMFNVVTSVGIIMANKALMATHGFSFATTLTGLHFLTTTLMTSVMKWL  67

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++ D V
Sbjct  68   GYIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFDKV  127

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  128  RYSRDTKLSIMLVLVGVAVCTVTDVSVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS  187



>ref|XP_004977451.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=332

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA +D AAW+FN+ TSVGII+VNKALMA +GFSFATTLTGLHF TTTLMT++ + L
Sbjct  6    KSDKKAALDFAAWSFNVTTSVGIIMVNKALMATYGFSFATTLTGLHFVTTTLMTIVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP ++ IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLADLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDHV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GVA+CTVTDVSVNA+G IAA IAVWSTA QQYYVHFLQ+KY+L S
Sbjct  126  HYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTAFQQYYVHFLQKKYALNS  185



>gb|KDP36558.1| hypothetical protein JCGZ_08325 [Jatropha curcas]
Length=335

 Score =   251 bits (641),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGIIIVNKALMA + FS+ATTLTGLHF TTTL+  +L+ LGYIQ S+LP+SE
Sbjct  18   WMFNVVTSVGIIIVNKALMATYDFSYATTLTGLHFTTTTLLAFVLRWLGYIQASHLPFSE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFV FANFSIVGMNVSLMWNSVGFYQ+AKLSMIPVSCLLEV+ D +RYSRDTKLSI +
Sbjct  78   LLKFVFFANFSIVGMNVSLMWNSVGFYQVAKLSMIPVSCLLEVLFDKIRYSRDTKLSIAV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGVA+CTVTDVSVNAKG IAAF+AVWST+LQQYYVH+LQRKYSL S
Sbjct  138  VLLGVAVCTVTDVSVNAKGCIAAFVAVWSTSLQQYYVHYLQRKYSLSS  185



>ref|XP_003602508.1| Membrane protein, putative [Medicago truncatula]
Length=182

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTG+HFATTTL+T
Sbjct  1    MSSAS-KGDRKASLDAASWLFNVVTSVGIILVNKALMATYGFSFATTLTGMHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++LK LGYIQ S+LP S+ IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL+MIPVSCLLE
Sbjct  60   VVLKSLGYIQTSHLPKSDIIKFVLFANCSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQY  622
            VVLD+VRYSRDTKLSI+LVL GVA+CTVTDVSVN KGFIAA IAV STALQQY
Sbjct  120  VVLDNVRYSRDTKLSIILVLAGVAVCTVTDVSVNTKGFIAAVIAVCSTALQQY  172



>ref|XP_010678762.1| PREDICTED: UDP-galactose transporter 2-like [Beta vulgaris subsp. 
vulgaris]
Length=330

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K + KA +D  AW FN VTSVGIIIVNKALMA +GFSFATTLTGLHF  TTLMTL+L+ L
Sbjct  6    KAKMKAAVDVGAWMFNAVTSVGIIIVNKALMATYGFSFATTLTGLHFVATTLMTLVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G+IQ S+LP  E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLS+IPV CL E+V D++
Sbjct  66   GFIQYSHLPLLELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSIIPVLCLFEIVFDNL  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            RYSRDTKLSI LVL+GV +CTVTDVSVN KG +AA IAVWSTALQQYYVHFLQ+KYSL
Sbjct  126  RYSRDTKLSIGLVLIGVGVCTVTDVSVNMKGLVAASIAVWSTALQQYYVHFLQKKYSL  183



>ref|XP_006663829.1| PREDICTED: UDP-galactose transporter 2-like [Oryza brachyantha]
Length=332

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KK ++D AAW FNI TSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++ + L
Sbjct  6    KSDKKKVLDFAAWGFNISTSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP  +  KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLPDLAKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDHV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GVA+CTVTDVSVNAKG  AA IAVWSTALQQYYVHFLQRKYSL S
Sbjct  126  RYSRDTKLSIMVVLIGVAVCTVTDVSVNAKGLAAAVIAVWSTALQQYYVHFLQRKYSLNS  185



>gb|EMT04054.1| hypothetical protein F775_26901 [Aegilops tauschii]
Length=337

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT ++K L
Sbjct  8    KAKRKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFLTTTLMTSVMKWL  67

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++ D V
Sbjct  68   GYIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFDKV  127

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVS+N++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  128  RYSRDTKLSIMLVLVGVAVCTVTDVSMNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS  187



>ref|NP_001149060.1| integral membrane protein like [Zea mays]
 gb|ACG34037.1| integral membrane protein like [Zea mays]
 gb|ACR38715.1| unknown [Zea mays]
 tpg|DAA63393.1| TPA: putative integral membrane protein [Zea mays]
Length=335

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFA TTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFAMTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KF  FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GYIQPSYLPLPELVKFAFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEIMFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+YVH LQ KYSLGS
Sbjct  126  RYSRDTKLSIVLVLVGVAVCTVTDVSVNSQGLLAAVIAVWSTALQQHYVHHLQWKYSLGS  185



>ref|XP_003578985.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
Length=332

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA +D AAW+FNI +SVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++ + L
Sbjct  6    KSDKKAALDLAAWSFNITSSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDRV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GVA+CTVTDVSVNAKG +AA IAVWSTA QQYYVH+LQRKYSL S
Sbjct  126  HYSRDTKLSIMVVLVGVAVCTVTDVSVNAKGMLAAVIAVWSTAFQQYYVHYLQRKYSLNS  185



>gb|ACG35759.1| integral membrane protein like [Zea mays]
Length=335

 Score =   249 bits (636),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNK LMA  GFSFATTLTGLHFA TTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNVVTSVGIIMVNKGLMATHGFSFATTLTGLHFAMTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KF  FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GYIQPSYLPLPELVKFAFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEIIFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+YVH LQ KYSLGS
Sbjct  126  RYSRDTKLSIVLVLIGVAVCTVTDVSVNSQGLLAAVIAVWSTALQQHYVHHLQWKYSLGS  185



>ref|NP_001131725.1| integral membrane protein like protein isoform 1 [Zea mays]
 ref|XP_008667139.1| PREDICTED: integral membrane protein like protein isoform 1 isoform 
X1 [Zea mays]
 gb|ACF80257.1| unknown [Zea mays]
 gb|ACF87135.1| unknown [Zea mays]
 tpg|DAA41282.1| TPA: integral membrane protein like protein isoform 1 [Zea mays]
 tpg|DAA41283.1| TPA: integral membrane protein like protein isoform 2 [Zea mays]
Length=335

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNK LMA  GFSFATTLTGLHFA TTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNVVTSVGIIMVNKGLMATHGFSFATTLTGLHFAMTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KF  FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GYIQPSYLPLPELVKFAFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEIIFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+YVH LQ KYSLGS
Sbjct  126  RYSRDTKLSIVLVLIGVAVCTVTDVSVNSQGLLAAVIAVWSTALQQHYVHHLQWKYSLGS  185



>ref|XP_006663828.1| PREDICTED: UDP-galactose transporter 2-like [Oryza brachyantha]
Length=332

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KK  +D AAW+FNI TSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++ + L
Sbjct  6    KSDKKRALDFAAWSFNISTSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP  +  KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLPDLAKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDHV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GVA+CTVTDVSVNAKG  AA IAVWSTALQQYYVHFLQRKYSL S
Sbjct  126  HYSRDTKLSIMVVLIGVAVCTVTDVSVNAKGLAAAVIAVWSTALQQYYVHFLQRKYSLNS  185



>tpg|DAA63396.1| TPA: putative integral membrane protein [Zea mays]
Length=372

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFA TTLMTL++K L
Sbjct  43   KAERKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFAMTTLMTLVMKWL  102

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KF  FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  103  GYIQPSYLPLPELVKFAFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEIMFDKV  162

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+YVH LQ KYSLGS
Sbjct  163  RYSRDTKLSIVLVLVGVAVCTVTDVSVNSQGLLAAVIAVWSTALQQHYVHHLQWKYSLGS  222



>dbj|BAJ99966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNKALMA  G SFATTLTGLHF TTTLMT ++K L
Sbjct  8    KAERKAALDAGAWMFNVVTSVGIIMVNKALMATHGSSFATTLTGLHFVTTTLMTSVMKWL  67

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++   V
Sbjct  68   GYIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFGKV  127

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct  128  RYSRDTKLSIMLVLVGVAVCTVTDVSVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS  187



>emb|CAN72212.1| hypothetical protein VITISV_012257 [Vitis vinifera]
Length=1102

 Score =   261 bits (668),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  WTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSE  337
            W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTLMT IL+ LGYIQ S+LP  E
Sbjct  18   WMFNVVTSVGIILVNKALMATYGFSFATTLTGLHFVTTTLMTAILRWLGYIQPSHLPLPE  77

Query  338  RIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL  517
             +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD +RYSRDTKLSI +
Sbjct  78   LLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSISV  137

Query  518  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VLLGVA+CTVTDVSVN +GFIAAFIAVWST+LQQYYVHFLQRKYSL S
Sbjct  138  VLLGVAVCTVTDVSVNTRGFIAAFIAVWSTSLQQYYVHFLQRKYSLSS  185



>ref|NP_001066187.1| Os12g0154600 [Oryza sativa Japonica Group]
 gb|ABA95853.1| transporter, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29206.1| Os12g0154600 [Oryza sativa Japonica Group]
 gb|EAY82305.1| hypothetical protein OsI_37515 [Oryza sativa Indica Group]
 gb|EAZ19687.1| hypothetical protein OsJ_35262 [Oryza sativa Japonica Group]
 dbj|BAG93243.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  140  IIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDS  319
            ++D AAW+FNI TSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++ + LG  Q S
Sbjct  13   VLDFAAWSFNITTSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIVFRWLGLSQPS  72

Query  320  NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDT  499
            +LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V YSRDT
Sbjct  73   HLPLPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDHVHYSRDT  132

Query  500  KLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            KLSI++VL+GVA+CTVTDVSVNAKG  AA IAVWSTALQQYYVHFLQRKYSL S
Sbjct  133  KLSIMVVLIGVAVCTVTDVSVNAKGLAAAVIAVWSTALQQYYVHFLQRKYSLNS  186



>gb|ABG21891.1| transporter, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG95016.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68875.1| hypothetical protein OsI_37497 [Oryza sativa Indica Group]
 gb|EEE52788.1| hypothetical protein OsJ_35260 [Oryza sativa Japonica Group]
Length=333

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  140  IIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDS  319
            ++D AAW+FNI TSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++ + LG  Q S
Sbjct  13   VLDFAAWSFNITTSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIVFRWLGLSQPS  72

Query  320  NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDT  499
            +LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V YSRDT
Sbjct  73   HLPIPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDRVHYSRDT  132

Query  500  KLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            KLSI++VL+GVA+CTVTDVSVNAKG  AA IAVWSTALQQYYVHFLQRKYSL S
Sbjct  133  KLSIMVVLIGVAVCTVTDVSVNAKGLAAAVIAVWSTALQQYYVHFLQRKYSLNS  186



>ref|NP_001066185.1| Os12g0154000 [Oryza sativa Japonica Group]
 dbj|BAF29204.1| Os12g0154000 [Oryza sativa Japonica Group]
Length=334

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  140  IIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDS  319
            ++D AAW+FNI TSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++ + LG  Q S
Sbjct  13   VLDFAAWSFNITTSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIVFRWLGLSQPS  72

Query  320  NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDT  499
            +LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V YSRDT
Sbjct  73   HLPIPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDRVHYSRDT  132

Query  500  KLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            KLSI++VL+GVA+CTVTDVSVNAKG  AA IAVWSTALQQYYVHFLQRKYSL S
Sbjct  133  KLSIMVVLIGVAVCTVTDVSVNAKGLAAAVIAVWSTALQQYYVHFLQRKYSLNS  186



>gb|ABA95848.2| transporter, putative, expressed [Oryza sativa Japonica Group]
Length=333

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  140  IIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDS  319
            ++D AAW+FNI TSVGII+VNKALMA  GFSFATTLTGLHF TTTLMT++ + LG  Q S
Sbjct  13   VLDFAAWSFNITTSVGIIMVNKALMATHGFSFATTLTGLHFVTTTLMTIVFRWLGLSQPS  72

Query  320  NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDT  499
            +LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V YSRDT
Sbjct  73   HLPIPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDRVHYSRDT  132

Query  500  KLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            KLSI++VL+GVA+CTVTDVSVNAKG  AA IAVWSTALQQYYVHFLQRKYSL S
Sbjct  133  KLSIMVVLIGVAVCTVTDVSVNAKGLAAAVIAVWSTALQQYYVHFLQRKYSLNS  186



>gb|EMS65678.1| hypothetical protein TRIUR3_32365 [Triticum urartu]
Length=333

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA +D AAW FNI +SVGII+VNKALMA  GFSFATTLTGLH  TTTLMT++ + L
Sbjct  6    KSDKKAALDFAAWGFNITSSVGIIMVNKALMATHGFSFATTLTGLHLLTTTLMTIVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDRV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GVA+CTVTDVSVNAKG +AA IAVWSTA QQYYVH+LQRKYSL S
Sbjct  126  HYSRDTKLSIMVVLIGVAVCTVTDVSVNAKGMLAAVIAVWSTAFQQYYVHYLQRKYSLNS  185



>dbj|BAJ95945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA +D AAW+FNI +SVGII+VNKALMA  GFSFATTLTGLH  TTTLMT++ + L
Sbjct  6    KSDKKAALDFAAWSFNITSSVGIIMVNKALMATHGFSFATTLTGLHLLTTTLMTIVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDRV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GVA+CTVTDVSVNAKG +AA IAVWSTA QQYYVH+LQRKYSL S
Sbjct  126  HYSRDTKLSIMVVLVGVAVCTVTDVSVNAKGMLAAVIAVWSTAFQQYYVHYLQRKYSLNS  185



>ref|XP_008672973.1| PREDICTED: integral membrane protein like isoform X1 [Zea mays]
 gb|ACF84710.1| unknown [Zea mays]
 tpg|DAA59205.1| TPA: integral membrane protein like protein [Zea mays]
Length=337

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K + KA +D A+W+FN+ TSVG+I+VNKALMA +GF+FATTLTGLHFATTT+MTL+ + +
Sbjct  16   KPDSKAALDLASWSFNVTTSVGLIMVNKALMATYGFTFATTLTGLHFATTTVMTLVFRWV  75

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S LP  +  KFV+F+N SIVGMNVSLMWNSVGFYQ+AKL MIP SCLLEVVLD V
Sbjct  76   GLSQPSQLPLPDLAKFVVFSNLSIVGMNVSLMWNSVGFYQVAKLCMIPASCLLEVVLDRV  135

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDT+LSI +VL GVA+CTVTDVSVNA+G +AA +AVWSTALQQYYVHFLQRK+SL S
Sbjct  136  HYSRDTRLSIAVVLAGVAVCTVTDVSVNARGLVAAVVAVWSTALQQYYVHFLQRKHSLNS  195



>ref|NP_001150996.1| integral membrane protein like [Zea mays]
 gb|ACG41208.1| integral membrane protein like [Zea mays]
Length=337

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K + KA +D A+W+FN+ TSVG+I+VNKALMA +GF+FATTLTGLHFATTT+MTL+ + +
Sbjct  16   KPDSKAALDLASWSFNVTTSVGLIMVNKALMATYGFTFATTLTGLHFATTTVMTLVFRWV  75

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S LP  +  KFV+F+N SIVGMNVSLMWNSVGFYQ+AKL MIP SCLLEVVLD V
Sbjct  76   GLSQPSQLPLPDLAKFVVFSNLSIVGMNVSLMWNSVGFYQVAKLCMIPASCLLEVVLDRV  135

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDT+LSI +VL GVA+CTVTDVSVNA+G +AA +AVWSTALQQYYVHFLQRK+SL S
Sbjct  136  HYSRDTRLSIAVVLAGVAVCTVTDVSVNARGLVAAVVAVWSTALQQYYVHFLQRKHSLNS  195



>ref|XP_010444889.1| PREDICTED: UDP-galactose transporter 2 [Camelina sativa]
Length=278

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +2

Query  110  SAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLI  289
            +A  K ++KA +D A+W FN+VTSVGII+VNKALMA +GFSFATTLTGLHF TTTL+T  
Sbjct  2    TATSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLTTF  61

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
            L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV
Sbjct  62   LTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  121

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQY+   L    
Sbjct  122  LDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNFNGFLAAAIAVWSTALQQYFFLILSCSI  181

Query  650  SLGS  661
            ++G+
Sbjct  182  AVGT  185



>gb|EMT23032.1| hypothetical protein F775_28662 [Aegilops tauschii]
Length=385

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K +KKA +D AAW FNI +SVGII+VNKALMA  GFSFATTLTGLH  TTTLMT++ + L
Sbjct  6    KSDKKAALDFAAWGFNITSSVGIIMVNKALMATHGFSFATTLTGLHLLTTTLMTIVFRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G  Q S+LP  + IKFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCLLEVV D V
Sbjct  66   GLSQPSHLPLPDLIKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEVVFDRV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GVA+CTVTDVSVNAKG +AA IAVWSTA QQYYVH+LQRKYSL S
Sbjct  126  HYSRDTKLSIMVVLVGVAVCTVTDVSVNAKGMLAAVIAVWSTAFQQYYVHYLQRKYSLNS  185



>gb|ACN28219.1| unknown [Zea mays]
 tpg|DAA63394.1| TPA: hypothetical protein ZEAMMB73_444488 [Zea mays]
 tpg|DAA63395.1| TPA: hypothetical protein ZEAMMB73_444488 [Zea mays]
Length=182

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTGLHFA TTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFAMTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KF  FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GYIQPSYLPLPELVKFAFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEIMFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYY  625
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ++
Sbjct  126  RYSRDTKLSIVLVLVGVAVCTVTDVSVNSQGLLAAVIAVWSTALQQHW  173



>gb|ACN34680.1| unknown [Zea mays]
 tpg|DAA41281.1| TPA: hypothetical protein ZEAMMB73_114742 [Zea mays]
Length=174

 Score =   228 bits (581),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K E+KA +D  AW FN+VTSVGII+VNK LMA  GFSFATTLTGLHFA TTLMTL++K L
Sbjct  6    KAERKAALDAGAWMFNVVTSVGIIMVNKGLMATHGFSFATTLTGLHFAMTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GYIQ S LP  E +KF  FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct  66   GYIQPSYLPLPELVKFAFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEIIFDKV  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQY  622
            RYSRDTKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+
Sbjct  126  RYSRDTKLSIVLVLIGVAVCTVTDVSVNSQGLLAAVIAVWSTALQQH  172



>ref|XP_010904726.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Elaeis 
guineensis]
Length=335

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K ++KA +D AAW FNIVTSVG+I+VNKALMA  GFSFATTLTGLHFATTTL T++L+ L
Sbjct  6    KADRKAALDVAAWMFNIVTSVGLIMVNKALMATHGFSFATTLTGLHFATTTLTTVVLRWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            G +Q S+LP  E +KFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCLLEV+LD +
Sbjct  66   GLVQASHLPLPELLKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCLLEVLLDKI  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
             YSRDTKLSI++VL+GVA+CTVTDVSVN KG IAA IAV ST+LQQYYVHFLQRKYSLGS
Sbjct  126  HYSRDTKLSIVVVLVGVAVCTVTDVSVNTKGLIAATIAVCSTSLQQYYVHFLQRKYSLGS  185



>gb|EMT00653.1| hypothetical protein F775_29393 [Aegilops tauschii]
Length=329

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTG+HFATTTLMTL++K L
Sbjct  6    KAEKKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGMHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP SE +KFV FAN SIVGMNVSLMWNSVGFYQIAKLS+IP+ C++EV+ ++ 
Sbjct  66   GYVQPSHLPLSELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLSIIPLLCIMEVLFENF  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GV +CTV+DVSVNA+G +AA IAV  TALQQ+YV++LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLVGVGVCTVSDVSVNAQGLVAAVIAVCGTALQQHYVNYLQRKYSLNS  185



>dbj|BAJ85267.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTG+HFATTTLMTL++K L
Sbjct  6    KAEKKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGMHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP SE +KFV FAN SIVGMNVSLMWNSVGFYQIAKLS+IP+ C++EV+ ++ 
Sbjct  66   GYVQPSHLPLSELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLSIIPLLCIMEVLFENF  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GV +CTV+DVSVNA+G +AA IAV  TALQQ+YV++LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLVGVGVCTVSDVSVNAQGLVAAVIAVCGTALQQHYVNYLQRKYSLNS  185



>ref|XP_004976151.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=337

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            +   KA  D AAW FNIVTSVGII+VNKALMA  GF F T L G+HFATT L TLILK L
Sbjct  8    RPVNKAAGDAAAWVFNIVTSVGIIMVNKALMATHGFGFVTILPGIHFATTALATLILKSL  67

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY++ S LP  E IK+V FAN S+VGMN SLMWNSVGFYQI+KLSM+PV C+LEV+ DSV
Sbjct  68   GYLEPSYLPLPELIKYVAFANISVVGMNASLMWNSVGFYQISKLSMVPVLCMLEVLFDSV  127

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            RYSR TKLSI++VL GVAICTVTDV+VN KG IAA +AV STA QQ+Y+H LQ+KYSL
Sbjct  128  RYSRGTKLSIMVVLGGVAICTVTDVTVNTKGLIAAAVAVCSTAFQQHYIHHLQKKYSL  185



>ref|XP_003580096.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
Length=329

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D  AW FN+VTSVG+I+VNKALMA  GFSFATTLTGLHFATTTLMTL++K L
Sbjct  6    KAEKKAALDAGAWMFNVVTSVGVIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP SE +KFV FAN SIVGMNVSLMWNSVGFYQIAKLS+IP+ C++EV+ ++ 
Sbjct  66   GYVQPSHLPLSELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLSIIPLLCVMEVLFENF  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GV +CTV+DVSVNA+G +AA +AV  TALQQ+YV++LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLVGVGVCTVSDVSVNAQGLMAAIVAVCGTALQQHYVNYLQRKYSLNS  185



>gb|AFK39529.1| unknown [Medicago truncatula]
Length=300

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  212  MANFGFSfattltglhfatttlMTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVS  391
            MA +GFSFATTLTG+HFATTTL+T++LK LGYIQ S+LP S+ IKFVLFAN SIVGMNVS
Sbjct  1    MATYGFSFATTLTGMHFATTTLLTVVLKSLGYIQTSHLPKSDIIKFVLFANCSIVGMNVS  60

Query  392  LMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAK  571
            LMWNSVGFYQIAKL+MIPVSCLLEVVLD+VRYSRDTKLSI+LVL GVA+CTVTDVSVN K
Sbjct  61   LMWNSVGFYQIAKLTMIPVSCLLEVVLDNVRYSRDTKLSIILVLAGVAVCTVTDVSVNTK  120

Query  572  GFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            GFIAA IAV STALQQYYVHFLQRKYS+GS
Sbjct  121  GFIAAVIAVCSTALQQYYVHFLQRKYSIGS  150



>gb|EMS68535.1| hypothetical protein TRIUR3_30184 [Triticum urartu]
Length=472

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTG+HFATTTLMTL++K L
Sbjct  6    KAEKKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGMHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP SE +KFV FAN SIVGMNVSLMWNSVGFYQIAKLS+IP+ C++EV+ ++ 
Sbjct  66   GYVQPSHLPLSELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLSIIPLLCIMEVLFENF  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            RYSRDTKLSI++VL+GV +CTV+DVSVNA+G +AA IAV  TALQQ+YV++LQRKYSL S
Sbjct  126  RYSRDTKLSIVVVLVGVGVCTVSDVSVNAQGLVAAVIAVCGTALQQHYVNYLQRKYSLNS  185



>gb|AES72759.2| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=286

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            +T++LK LGYIQ S+LP S+ IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL+MIPVSCL
Sbjct  9    LTVVLKSLGYIQTSHLPKSDIIKFVLFANCSIVGMNVSLMWNSVGFYQIAKLTMIPVSCL  68

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEVVLD+VRYSRDTKLSI+LVL GVA+CTVTDVSVN KGFIAA IAV STALQQYYVHFL
Sbjct  69   LEVVLDNVRYSRDTKLSIILVLAGVAVCTVTDVSVNTKGFIAAVIAVCSTALQQYYVHFL  128

Query  638  QRKYSLGS  661
            QRKYS+GS
Sbjct  129  QRKYSIGS  136



>ref|XP_006434521.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
 gb|ESR47761.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
Length=285

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MT +L+ LGYIQ S+LP+ E +KFV+FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL
Sbjct  9    MTGVLRWLGYIQPSHLPFRELLKFVIFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  68

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEVVLD +RYSRDTKLSI +VLLGV +CTVTDVSVNA+GFIAA IAVWST++QQYYVH L
Sbjct  69   LEVVLDKIRYSRDTKLSIAVVLLGVGVCTVTDVSVNARGFIAALIAVWSTSIQQYYVHHL  128

Query  638  QRKYSLGS  661
            QRKYSL S
Sbjct  129  QRKYSLTS  136



>gb|KHG20906.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=303

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MT +L+ LGYIQ S+LP +E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC 
Sbjct  26   MTAVLRWLGYIQSSHLPMAELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCF  85

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEVV+D +RYSRDTKLSI +VLLGV +CTVTDVSVN KGFIAAFIAVWST+LQQYYVH L
Sbjct  86   LEVVMDKIRYSRDTKLSIAVVLLGVGVCTVTDVSVNTKGFIAAFIAVWSTSLQQYYVHHL  145

Query  638  QRKYSLGS  661
            QR+Y+L S
Sbjct  146  QRRYNLSS  153



>ref|XP_008777067.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MT++L+ LGYIQ S+LP  E IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCL
Sbjct  1    MTVVLRWLGYIQASHLPLPELIKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCL  60

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEV+LD +RYSRDTKLSI++VL+GVA+CTVTDVSVN +G IAA IAVWST+LQQYYVHFL
Sbjct  61   LEVLLDKIRYSRDTKLSIVVVLIGVAVCTVTDVSVNTRGLIAAMIAVWSTSLQQYYVHFL  120

Query  638  QRKYSLGS  661
            QR YSLGS
Sbjct  121  QRNYSLGS  128



>dbj|BAJ88240.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRL  301
            K EKKA +D  AW FN+VTSVGII+VNKALMA  GFSFATTLTG+HFATTTLMTL++K L
Sbjct  6    KAEKKAALDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGMHFATTTLMTLVMKWL  65

Query  302  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV  481
            GY+Q S+LP SE +KFV FAN SIVGMNVSLMWNSVGFYQIAKLS+IP+ C++EV+ ++ 
Sbjct  66   GYVQPSHLPLSELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLSIIPLLCIMEVLFENF  125

Query  482  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQY  622
            RYSRDTKLSI++VL+GV +CTV+DVSVNA+G +AA IAV  TALQQ+
Sbjct  126  RYSRDTKLSIVVVLVGVGVCTVSDVSVNAQGLVAAVIAVCGTALQQH  172



>gb|KJB18357.1| hypothetical protein B456_003G048300 [Gossypium raimondii]
Length=296

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  299  LGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDS  478
            LGYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LEVV D 
Sbjct  28   LGYIQGSYLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVFDK  87

Query  479  VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLG  658
            VRYSRDTKLSILLVL+GVA+CTVTDVSVN KGF+AA IA+WSTALQQYYVHFLQRK+SLG
Sbjct  88   VRYSRDTKLSILLVLVGVAVCTVTDVSVNLKGFLAAVIAIWSTALQQYYVHFLQRKHSLG  147

Query  659  S  661
            S
Sbjct  148  S  148



>ref|XP_006647514.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Oryza 
brachyantha]
Length=295

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MTL++K LG+IQ S LP+SE +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV CL
Sbjct  18   MTLVMKWLGHIQPSYLPFSELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCL  77

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LE++ D VRYSR+TKLSI+LVL+GVA+CTVTDVSVN+KG +AA IAVWSTALQQ+YVH L
Sbjct  78   LEIIFDKVRYSRNTKLSIVLVLVGVAVCTVTDVSVNSKGLLAAIIAVWSTALQQHYVHLL  137

Query  638  QRKYSLGS  661
            QRKYSLGS
Sbjct  138  QRKYSLGS  145



>ref|XP_007048169.1| Nucleotide-sugar transporter family protein isoform 3 [Theobroma 
cacao]
 gb|EOX92326.1| Nucleotide-sugar transporter family protein isoform 3 [Theobroma 
cacao]
Length=312

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 146/186 (78%), Gaps = 24/186 (13%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMT  283
            MSSA  K ++KA +D A+W FN+VTSVGII+VNKALMA  GFSFATTLTGLHFATTTL+T
Sbjct  1    MSSAS-KADRKAALDVASWFFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLLT  59

Query  284  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE  463
            ++L+ LGYIQ S LP  E +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSC LE
Sbjct  60   VLLRWLGYIQGSYLPLPELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLE  119

Query  464  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR  643
            VV D VRYSRDTKLSI++VLLGVA+CTVTD                       YVHFLQR
Sbjct  120  VVFDKVRYSRDTKLSIVVVLLGVAVCTVTD-----------------------YVHFLQR  156

Query  644  KYSLGS  661
            K+SLGS
Sbjct  157  KHSLGS  162



>ref|XP_008667952.1| PREDICTED: integral membrane protein like isoform X1 [Zea mays]
Length=275

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MT++ + LG  Q S+LP ++ +KFV+F+N SIVGMNVSLMWNSVGFYQIAKL MIP SCL
Sbjct  1    MTILFRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCL  60

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEVV D V YSRDTKLSI++VL+GVA+CTVTDVSVNA+G IAA IAVWSTALQQYYVHFL
Sbjct  61   LEVVFDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFL  120

Query  638  QRKYSLGS  661
            QRKYSL S
Sbjct  121  QRKYSLNS  128



>ref|XP_009407105.1| PREDICTED: uncharacterized protein LOC103989887 [Musa acuminata 
subsp. malaccensis]
Length=1638

 Score =   216 bits (551),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 105/128 (82%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MTL+ K LGYIQ S+LP S  IKFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCL
Sbjct  416  MTLLFKWLGYIQPSHLPVSNLIKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCL  475

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            LEVV D + YSR TKLSI++VL+GVAICTVTDVSVNAKG +AA IAVWST+LQQYYVHFL
Sbjct  476  LEVVFDKIHYSRATKLSIVVVLVGVAICTVTDVSVNAKGLMAAIIAVWSTSLQQYYVHFL  535

Query  638  QRKYSLGS  661
            Q+KYSLGS
Sbjct  536  QKKYSLGS  543



>ref|XP_006397142.1| hypothetical protein EUTSA_v10029422mg, partial [Eutrema salsugineum]
 gb|ESQ38595.1| hypothetical protein EUTSA_v10029422mg, partial [Eutrema salsugineum]
Length=191

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 108/128 (84%), Gaps = 9/128 (7%)
 Frame = +2

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            MT++L+ LGYIQ S+LP++E +K +LFANFSI GMNVSLMWNSVGFYQIAKLSMIP SCL
Sbjct  1    MTVVLRCLGYIQPSHLPFTELLKIILFANFSIAGMNVSLMWNSVGFYQIAKLSMIPESCL  60

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            L+VVLD +RYSRDTKLSI LVL+GV +CTVT++SVN KGF+AAFIA         YVHFL
Sbjct  61   LDVVLDKIRYSRDTKLSIGLVLVGVGVCTVTNLSVNTKGFVAAFIA---------YVHFL  111

Query  638  QRKYSLGS  661
            QRKYSL S
Sbjct  112  QRKYSLSS  119



>ref|XP_010904727.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Elaeis 
guineensis]
Length=313

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  299  LGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDS  478
            LG +Q S+LP  E +KFVLFAN SIVGMNVSLMWNSVGFYQIAKL MIPVSCLLEV+LD 
Sbjct  43   LGLVQASHLPLPELLKFVLFANLSIVGMNVSLMWNSVGFYQIAKLCMIPVSCLLEVLLDK  102

Query  479  VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLG  658
            + YSRDTKLSI++VL+GVA+CTVTDVSVN KG IAA IAV ST+LQQYYVHFLQRKYSLG
Sbjct  103  IHYSRDTKLSIVVVLVGVAVCTVTDVSVNTKGLIAATIAVCSTSLQQYYVHFLQRKYSLG  162

Query  659  S  661
            S
Sbjct  163  S  163



>ref|XP_009124383.1| PREDICTED: UDP-galactose transporter 2-like, partial [Brassica 
rapa]
Length=111

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  380  MNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVS  559
            MNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD VRYSRDTKLSILLVL GVA+CTVTDVS
Sbjct  1    MNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKVRYSRDTKLSILLVLAGVAVCTVTDVS  60

Query  560  VNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VN  GF+AA IAVWSTALQQYYVH LQRKYSLGS
Sbjct  61   VNLNGFLAAAIAVWSTALQQYYVHHLQRKYSLGS  94



>gb|KJB18355.1| hypothetical protein B456_003G048300 [Gossypium raimondii]
Length=242

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  380  MNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVS  559
            MNVSLMWNSVGFYQIAKLSMIPVSC LEVV D VRYSRDTKLSILLVL+GVA+CTVTDVS
Sbjct  1    MNVSLMWNSVGFYQIAKLSMIPVSCFLEVVFDKVRYSRDTKLSILLVLVGVAVCTVTDVS  60

Query  560  VNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            VN KGF+AA IA+WSTALQQYYVHFLQRK+SLGS
Sbjct  61   VNLKGFLAAVIAIWSTALQQYYVHFLQRKHSLGS  94



>ref|XP_010090745.1| hypothetical protein L484_013767 [Morus notabilis]
 gb|EXB40464.1| hypothetical protein L484_013767 [Morus notabilis]
Length=335

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALM--ANFGFSfattltglhfatttlMTLILK  295
            K  K  + D  AWT N+V+SVGII+ NK LM    F F FATTLTG HF+ T+L+ L+  
Sbjct  4    KKSKFEVCDFGAWTMNVVSSVGIIMANKLLMNPQGFAFGFATTLTGFHFSATSLVGLVSN  63

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              GY    ++P  E I F + AN SI GMN SLM NSVGFYQI++LSMIPV C++E +L 
Sbjct  64   AAGYSTSKHVPLWELIWFSIVANTSIAGMNFSLMLNSVGFYQISRLSMIPVVCIMEWILH  123

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
               YSR+ K+++ +V++GV +CTVTDV VNAKGF+ A +AV+ST+LQQ  +  LQ+KYS+
Sbjct  124  GKHYSREVKMAVAMVVIGVGVCTVTDVKVNAKGFLCACVAVFSTSLQQITIGSLQKKYSI  183

Query  656  GS  661
            GS
Sbjct  184  GS  185



>ref|XP_001754835.1| predicted protein [Physcomitrella patens]
 gb|EDQ80289.1| predicted protein [Physcomitrella patens]
Length=345

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (71%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTLILK  295
            K+EKKA+ D  AW  NI++SVGII+ NK +M+  G  F FATTLT  HFA T  +  +  
Sbjct  8    KEEKKAVSDVGAWAMNIISSVGIIMANKQVMSKGGYDFRFATTLTAFHFAVTAGVGYVSS  67

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
             +GY    ++P+ +   F L +N SIV MN+SLM NSVGFYQIAKLSMIP   +LE ++ 
Sbjct  68   AMGYSVSKHVPFKDLFLFSLVSNTSIVSMNLSLMLNSVGFYQIAKLSMIPTVSILEWIIH  127

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            +  Y+R+ K+SI +V++GV +CTVTDVSVN KGF+AA  AV ST+LQQ Y+  LQ+K+S 
Sbjct  128  NKNYTREVKISIFIVMIGVGVCTVTDVSVNLKGFLAAVTAVISTSLQQIYIGALQKKHSC  187

Query  656  GS  661
            GS
Sbjct  188  GS  189



>ref|XP_010684399.1| PREDICTED: UDP-galactose transporter 2-like [Beta vulgaris subsp. 
vulgaris]
Length=345

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 133/185 (72%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKKA--IIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTL  286
            ++ EK++  + D  AW  NI++SVG+I+ NK LM++ G  FSFATTLTG HF  T L+ L
Sbjct  1    MESEKRSSSVSDVGAWAMNIISSVGLIMANKQLMSSNGYAFSFATTLTGFHFTVTALVGL  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    GY    ++P  E + F L AN SI GMN+SLM NSVGFYQI+KLSMIPV C+LE 
Sbjct  61   VSNATGYSVSKHVPAWELLWFSLVANMSITGMNLSLMLNSVGFYQISKLSMIPVVCVLEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            ++    YS++ K+S++ V++GV ICTVTDV VNAKGFI A +AV ST+LQQ  +  LQ+K
Sbjct  121  IIHYKHYSKEVKMSVIFVVIGVGICTVTDVKVNAKGFICAVVAVLSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



>ref|XP_001762353.1| predicted protein [Physcomitrella patens]
 gb|EDQ72820.1| predicted protein [Physcomitrella patens]
Length=345

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 127/182 (70%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALM--ANFGFSfattltglhfatttlMTLILK  295
            K+EKKA+ D  AW  NI++SVGII+ NK +M  A + F FATTLT  HFA T  +     
Sbjct  8    KEEKKAVSDVGAWAMNIISSVGIIMANKQVMSKAGYDFRFATTLTAFHFAVTAGVGYASA  67

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
             +GY    ++P+ +   F L +N SIV MN+SLM NSVGFYQIAKLSMIP   +LE ++ 
Sbjct  68   AMGYSVSKHVPFKDLFLFSLVSNTSIVSMNLSLMLNSVGFYQIAKLSMIPTVSVLEWLIH  127

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            S  Y+R+ K +I +V++GV +CTVTDVSVN KGF+AA  AV ST+LQQ Y+  LQ+K+S 
Sbjct  128  SKTYTREVKTAIFVVMIGVGVCTVTDVSVNLKGFLAALTAVISTSLQQIYIGALQKKHSC  187

Query  656  GS  661
            GS
Sbjct  188  GS  189



>ref|XP_002865527.1| hypothetical protein ARALYDRAFT_917531 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41786.1| hypothetical protein ARALYDRAFT_917531 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 137/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  122  KDEKK---AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTL  286
            ++E+K   A+ D  AW  N+++SVGII+ NK LM++  F FSFATTLTG HFA T L+ +
Sbjct  4    ENERKSPSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFAFSFATTLTGFHFALTALVGM  63

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G+    ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  64   VSNATGFSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEW  123

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S RYSR+ K+S+++V++GV ICTVTDV VNAKGFI AF+A++S++LQQ  +  LQ+K
Sbjct  124  ILHSKRYSREVKISVVVVVVGVGICTVTDVKVNAKGFICAFVAIFSSSLQQILIGSLQKK  183

Query  647  YSLGS  661
            YS+GS
Sbjct  184  YSIGS  188



>gb|KHN12124.1| UDP-galactose transporter 2 [Glycine soja]
Length=345

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 134/185 (72%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTL  286
            ++ EKK  AI D  AW  N+V+SVGII+ NK LM+N G  FSFA++LTG HFA T L+ L
Sbjct  1    MESEKKSSAISDVGAWAMNVVSSVGIIMANKQLMSNNGYAFSFASSLTGFHFAVTALVGL  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    GY    ++P  E I F L AN SI GMN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNATGYSASKHVPMWELIWFSLVANMSITGMNFSLMLNSVGFYQISKLSMIPVVCVMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L +  YSR+ K+S+++V++GV +CTVTDV VN KGF+ A IAV ST+LQQ  +  LQ+K
Sbjct  121  ILHNKHYSREVKMSVVVVVIGVGVCTVTDVKVNLKGFMCACIAVLSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



>ref|XP_006590383.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max]
Length=345

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 134/185 (72%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTL  286
            ++ EKK  AI D  AW  N+V+SVGII+ NK LM+N G  FSFA++LTG HFA T L+ L
Sbjct  1    MESEKKSSAISDVGAWAMNVVSSVGIIMANKQLMSNNGYAFSFASSLTGFHFAVTALVGL  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    GY    ++P  E I F L AN SI GMN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNATGYSASKHVPMWELIWFSLVANMSITGMNFSLMLNSVGFYQISKLSMIPVVCVMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L +  YSR+ K+S+++V++GV +CTVTDV VN KGF+ A IAV ST+LQQ  +  LQ+K
Sbjct  121  ILHNKHYSREVKMSVVVVVIGVGVCTVTDVKVNLKGFMCACIAVLSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



>ref|XP_008235850.1| PREDICTED: UDP-galactose transporter 2-like [Prunus mume]
Length=339

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 131/182 (72%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTLILK  295
            K++K ++ D  AW  NIV+SVGII+ NK LM+   FGF FATTLTG HF+ T L+ L+  
Sbjct  3    KEKKSSVSDVGAWGMNIVSSVGIIMANKQLMSPHGFGFGFATTLTGFHFSVTALVGLVSN  62

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              GY    ++P  E + F L AN SI GMN+SLM NSVGFYQI+KLSMIPV C+LE +L 
Sbjct  63   ATGYSASKHVPLWELVWFSLVANASITGMNLSLMLNSVGFYQISKLSMIPVVCVLEWILH  122

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
               ++R+ KL++ +V++GV ICTVTDV VNAKGF+ A +A+  T+LQQ  +  LQ+KYS+
Sbjct  123  GKHFAREVKLAVGVVVVGVGICTVTDVKVNAKGFLCACVAILCTSLQQISIGSLQKKYSI  182

Query  656  GS  661
            GS
Sbjct  183  GS  184



>ref|XP_001754967.1| predicted protein [Physcomitrella patens]
 gb|EDQ80421.1| predicted protein [Physcomitrella patens]
Length=350

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +2

Query  146  DTAAWTFNIVTSVGIIIVNKALMANFGFSf--attltglhfatttlMTLILKRLGYIQDS  319
            D  AW  NI++SVGII+ NK +M+  G+++  ATTLT  HF  T  +  I   LGY    
Sbjct  21   DVGAWAMNIISSVGIIMANKQVMSAGGYNYRFATTLTAFHFTVTAAVGYISSSLGYSVSK  80

Query  320  NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDT  499
            ++P+ +   F L +N SIV MN+SLM NSVGFYQIAKLSMIP  C+LE +L +  Y+R+ 
Sbjct  81   HVPFRDLFLFSLVSNTSIVSMNLSLMLNSVGFYQIAKLSMIPTVCILEWILHNKTYTREV  140

Query  500  KLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            KLS+ +V++GV +CTVTDV+VN KGF++A +AV ST+LQQ Y+  LQ+K+S GS
Sbjct  141  KLSVFVVMIGVGVCTVTDVNVNFKGFMSAVVAVISTSLQQIYIGALQKKHSCGS  194



>ref|XP_002969958.1| hypothetical protein SELMODRAFT_92835 [Selaginella moellendorffii]
 ref|XP_002981428.1| hypothetical protein SELMODRAFT_178861 [Selaginella moellendorffii]
 gb|EFJ17616.1| hypothetical protein SELMODRAFT_178861 [Selaginella moellendorffii]
 gb|EFJ29082.1| hypothetical protein SELMODRAFT_92835 [Selaginella moellendorffii]
Length=358

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 125/172 (73%), Gaps = 0/172 (0%)
 Frame = +2

Query  146  DTAAWTFNIVTSVGIIIVNKALMANFGFSfattltglhfatttlMTLILKRLGYIQDSNL  325
            D  +W  N+VTSVG+I VNK +M+++GF FATTLT  HF  T+L       LGY     +
Sbjct  12   DVGSWALNVVTSVGLIFVNKVVMSSYGFRFATTLTACHFGVTSLAGFASAALGYTTLKPI  71

Query  326  PWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKL  505
            P+ +   F L AN SIVGMN+SL+ NSVGFYQIAKLSMIPV C+LE VL++  YSR   L
Sbjct  72   PFWDLFWFSLVANVSIVGMNLSLLLNSVGFYQIAKLSMIPVVCVLERVLNAKTYSRPVIL  131

Query  506  SILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            S+++V+ GVAI TVTDV+VN KGF+AA +AV +TALQQ ++  LQ+K+++ S
Sbjct  132  SVIMVVFGVAIVTVTDVTVNFKGFMAAVMAVLATALQQIFIGSLQKKHNVSS  183



>ref|XP_006305238.1| hypothetical protein CARUB_v10009605mg [Capsella rubella]
 gb|EOA38136.1| hypothetical protein CARUB_v10009605mg [Capsella rubella]
Length=348

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 131/184 (71%), Gaps = 4/184 (2%)
 Frame = +2

Query  122  KDEKK--AIIDTAAWTFNIVTSVGIIIVNKALM--ANFGFSfattltglhfatttlMTLI  289
            ++EKK  A+ D  AW  N+ +SVGII+ NK LM  A FGFSFATTLTG HFA T L+ ++
Sbjct  5    ENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSTAGFGFSFATTLTGFHFALTALVGMV  64

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
                G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C++E V
Sbjct  65   SNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWV  124

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            L S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KY
Sbjct  125  LHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKY  184

Query  650  SLGS  661
            S+GS
Sbjct  185  SIGS  188



>ref|NP_199057.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 dbj|BAB10483.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABF19012.1| At5g42420 [Arabidopsis thaliana]
 dbj|BAF00644.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED94808.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AIJ01997.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=350

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 136/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  122  KDEKK---AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTL  286
            ++E+K   A+ D  AW  N+++SVGII+ NK LM++  F FSFATTLTG HFA T L+ +
Sbjct  4    ENERKSPSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFAFSFATTLTGFHFALTALVGM  63

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G+    ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  64   VSNATGFSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEW  123

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S RYSR+ K+S+++V++GV ICTVTDV VNAKGFI A +A++S++LQQ  +  LQ+K
Sbjct  124  ILHSKRYSREVKISVVVVVVGVGICTVTDVKVNAKGFICACVAIFSSSLQQILIGSLQKK  183

Query  647  YSLGS  661
            YS+GS
Sbjct  184  YSIGS  188



>ref|XP_008778573.1| PREDICTED: UDP-galactose transporter 2-like [Phoenix dactylifera]
Length=344

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +2

Query  119  VKDEKKAII-DTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTLI  289
            +K EKK ++ DT AW  N+V+SVG+I+ NK LM+   +GFSFATTLTG HF  T ++  +
Sbjct  1    MKMEKKVVVSDTGAWAMNVVSSVGLIMANKQLMSAGGYGFSFATTLTGFHFTLTGIIGYV  60

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
                G     ++P+ E + F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E +
Sbjct  61   SNASGLSMSKHVPFWELLWFSIVANLSITGMNLSLMLNSVGFYQISKLSMIPVVCMMEWL  120

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            L+S  YS    +S+++V  GV +CTVTDV +NAKGF+ A +AV+ T+LQQ  +   Q+KY
Sbjct  121  LNSKNYSPRVIMSVIVVAFGVGVCTVTDVEINAKGFLCACVAVFCTSLQQITIGSFQKKY  180

Query  650  SLGS  661
            ++GS
Sbjct  181  NIGS  184



>gb|KHN05614.1| UDP-galactose transporter 2 [Glycine soja]
Length=342

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 135/185 (73%), Gaps = 7/185 (4%)
 Frame = +2

Query  119  VKDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTL  286
            ++ EKK  AI D  AW  N+V+SVGII+ NK LM+N G  FSFA++LTG HFA T L+ L
Sbjct  1    MESEKKSSAISDVGAWAMNVVSSVGIIMANKQLMSNNGYAFSFASSLTGFHFAVTALVGL  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    GY   S++P  E I F L AN SI GMN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNATGY---SHVPMWELIWFSLVANMSITGMNFSLMLNSVGFYQISKLSMIPVVCVMEW  117

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L +  YSR+ K+S+++V++GV +CTVTDV VN KGF+ A IAV ST+LQQ  +  LQ+K
Sbjct  118  ILHNKHYSREVKMSVVVVVIGVGVCTVTDVKVNLKGFMCACIAVLSTSLQQISIGSLQKK  177

Query  647  YSLGS  661
            YS+GS
Sbjct  178  YSIGS  182



>ref|NP_564133.1| nucleotide-sugar transporter-like protein [Arabidopsis thaliana]
 gb|AAF80654.1|AC012190_10 Strong similarity to a hypothetical protein F28O16.4 gi|6143887 
from Arabidopsis thaliana gb|AC010718. It contains a integral 
membrane protein domain PF|00892 [Arabidopsis thaliana]
 gb|ABD59064.1| At1g21070 [Arabidopsis thaliana]
 gb|AEE30059.1| nucleotide-sugar transporter-like protein [Arabidopsis thaliana]
Length=348

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 132/184 (72%), Gaps = 4/184 (2%)
 Frame = +2

Query  122  KDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTLI  289
            ++EKK  A+ D  AW  N+ +SVGII+ NK LM++  FGFSFATTLTG HFA T L+ ++
Sbjct  5    ENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMV  64

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
                G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C++E V
Sbjct  65   SNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWV  124

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            L S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KY
Sbjct  125  LHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKY  184

Query  650  SLGS  661
            S+GS
Sbjct  185  SIGS  188



>ref|XP_010270661.1| PREDICTED: UDP-galactose transporter 2-like [Nelumbo nucifera]
Length=347

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKKA--IIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTL  286
            ++DEKKA  + D  AW  N+++SVGII+ NK LM+   + FSFATTLTG HFA T L+  
Sbjct  1    MEDEKKASAVSDMGAWAMNVISSVGIIMANKQLMSPSGYAFSFATTLTGFHFAVTALVGF  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    GY    ++P  E + F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNVSGYSASKHVPLWELLWFSVVANMSITGMNLSLMLNSVGFYQISKLSMIPVVCVMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S  YSR+ K+++++V++GV +CTVTDV VNAKGF+ A IAV ST+LQQ  +  LQ+K
Sbjct  121  ILHSKHYSREVKMAVVVVVVGVGVCTVTDVKVNAKGFLCACIAVLSTSLQQITIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



>ref|XP_001762447.1| predicted protein [Physcomitrella patens]
 gb|EDQ72914.1| predicted protein [Physcomitrella patens]
Length=350

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +2

Query  146  DTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTLILKRLGYIQDS  319
            +  AW  NI++SVGII+ NK +M+   + + FATTLT  HF  T  +  I   LGY    
Sbjct  21   NVGAWAMNIISSVGIIMANKQVMSVGGYNYRFATTLTAFHFTVTAAVGYISSSLGYSVSK  80

Query  320  NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDT  499
            +LP+ +   F L +N SIV MN+SLM NSVGFYQIAKLSMIP  C+LE +L +  Y+R+ 
Sbjct  81   HLPFRDLFLFSLVSNTSIVSMNLSLMLNSVGFYQIAKLSMIPTVCILEWILHNKTYTREV  140

Query  500  KLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS  661
            K+S+ +V++GV +CTVTDV+VN KGF AA +AV ST+LQQ Y+  LQ+K++ GS
Sbjct  141  KMSVFVVMIGVGVCTVTDVNVNFKGFTAAVVAVISTSLQQIYIGALQKKHNCGS  194



>ref|XP_009607659.1| PREDICTED: UDP-galactose transporter 2 [Nicotiana tomentosiformis]
 ref|XP_009781477.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
Length=341

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTL  286
            ++ EKK   + D  AW  N+V+SVGII+ NK LM+   + F+FATTLTG HFA T L+ +
Sbjct  1    MESEKKVSPVSDVGAWAMNVVSSVGIIMANKQLMSANGYSFTFATTLTGFHFAVTALVGM  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G+    ++P  E I F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNATGFSSSKHVPLWELIWFSIVANMSITGMNLSLMLNSVGFYQISKLSMIPVVCVMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S RYS++ K+S+++V++GV +CTVTDV VNAKGFI A +AV ST+LQQ  +  LQ+K
Sbjct  121  ILHSKRYSKEVKMSVVVVVIGVGVCTVTDVKVNAKGFICACVAVLSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



>ref|XP_010481989.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=351

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +2

Query  122  KDEKK---AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTL  286
            ++EKK   A+ D  AW  N+++SVGII+ NK LM++  F FSFATTLTG HFA T L+ +
Sbjct  4    ENEKKSSSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFAFSFATTLTGFHFALTALVGM  63

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G     ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  64   VSNATGLSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEW  123

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S RYSR+ K+++++V++GV ICTVTDV VNAKGFI A +A++S++LQQ  +  LQ+K
Sbjct  124  ILHSKRYSREVKIAVVVVVVGVGICTVTDVKVNAKGFICACVAIFSSSLQQILIGSLQKK  183

Query  647  YSLGS  661
            YS+GS
Sbjct  184  YSIGS  188



>emb|CDX88307.1| BnaC06g37510D [Brassica napus]
Length=347

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 130/182 (71%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTLILK  295
            K +  ++ D  AW  NIV+SVGII+ NK LM++  FGFSFATTLTG HFA T L+ ++  
Sbjct  5    KKQSSSVSDVGAWGMNIVSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMVSN  64

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C++E +L 
Sbjct  65   ATGLSASKHIPLWELLWFSLVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWILH  124

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KYS+
Sbjct  125  SKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKYSV  184

Query  656  GS  661
            GS
Sbjct  185  GS  186



>ref|XP_010442167.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=351

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +2

Query  122  KDEKK---AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTL  286
            ++EKK   A+ D  AW  N+++SVGII+ NK LM++  F FSFATTLTG HFA T L+ +
Sbjct  4    ENEKKSSSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFAFSFATTLTGFHFALTALVGM  63

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G     ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  64   VSNATGLSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEW  123

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S RYSR+ K+++++V++GV ICTVTDV VNAKGFI A +A++S++LQQ  +  LQ+K
Sbjct  124  ILHSKRYSREVKIAVVVVVVGVGICTVTDVKVNAKGFICACVAIFSSSLQQILIGSLQKK  183

Query  647  YSLGS  661
            YS+GS
Sbjct  184  YSIGS  188



>gb|KFK44204.1| hypothetical protein AALP_AA1G228100 [Arabis alpina]
Length=349

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 132/184 (72%), Gaps = 4/184 (2%)
 Frame = +2

Query  122  KDEKKA--IIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTLI  289
            ++EKKA  + D  AW  NI +SVGII+ NK LM++  FGFSFATTLTG HFA T L+ ++
Sbjct  5    ENEKKASAVSDVGAWAMNITSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMV  64

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
                G     ++P  E + F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E V
Sbjct  65   SNATGLSASKHVPLWELLWFSIVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWV  124

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            L S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KY
Sbjct  125  LHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKY  184

Query  650  SLGS  661
            S+GS
Sbjct  185  SVGS  188



>ref|XP_010494178.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=351

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +2

Query  122  KDEKK---AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTL  286
            ++EKK   A+ D  AW  N+++SVGII+ NK LM++  F FSFATTLTG HFA T L+ +
Sbjct  4    ENEKKSSSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFAFSFATTLTGFHFALTALVGM  63

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G     ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  64   VSNATGLSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEW  123

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S RYSR+ K+++++V++GV ICTVTDV VNAKGFI A +A++S++LQQ  +  LQ+K
Sbjct  124  ILHSKRYSREVKIAVVVVVVGVGICTVTDVKVNAKGFICACVAIFSSSLQQILIGSLQKK  183

Query  647  YSLGS  661
            YS+GS
Sbjct  184  YSIGS  188



>emb|CDP07234.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 2/181 (1%)
 Frame = +2

Query  125  DEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTLILKR  298
             +K A+ D  AW  N+V+SVGII+ NK LM+  G  FSFATTLTG HFA T L+ ++   
Sbjct  4    QKKSAVSDVGAWAMNVVSSVGIIMANKQLMSTSGYAFSFATTLTGFHFAVTALVGMVSNA  63

Query  299  LGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDS  478
             G+    ++P  E + F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E +L S
Sbjct  64   TGFSASKHVPLWELLWFSVVANMSITGMNLSLMLNSVGFYQISKLSMIPVVCVMEWILHS  123

Query  479  VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLG  658
              Y+R+ K+S+++V++GV +CTVTDV VNAKGFI A +A+ ST+LQQ  +  LQ+KYS+G
Sbjct  124  KHYTREVKMSVVVVVIGVGVCTVTDVKVNAKGFICACVAILSTSLQQISIGSLQKKYSIG  183

Query  659  S  661
            S
Sbjct  184  S  184



>ref|XP_006279494.1| hypothetical protein CARUB_v10026693mg [Capsella rubella]
 gb|EOA12392.1| hypothetical protein CARUB_v10026693mg [Capsella rubella]
Length=350

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +2

Query  122  KDEKK---AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTL  286
            ++EKK   A+ D  AW  N+++SVGII+ NK LM++  F FSFATTLTG HFA T L+ +
Sbjct  4    ENEKKSSSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFAFSFATTLTGFHFALTALVGM  63

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G     ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  64   VSNATGLSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEW  123

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S RYSR+ K+++++V++GV ICTVTDV VNAKGFI A +A++S++LQQ  +  LQ+K
Sbjct  124  ILHSKRYSREVKIAVVVVVVGVGICTVTDVKVNAKGFICACVAIFSSSLQQILIGSLQKK  183

Query  647  YSLGS  661
            YS+GS
Sbjct  184  YSIGS  188



>gb|EYU41229.1| hypothetical protein MIMGU_mgv1a009117mg [Erythranthe guttata]
Length=352

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTL  286
            ++ EKK  A+ D  AW  N+V+SVGII+VNK LM+   + FS+ATTLTG HFA T L+ +
Sbjct  1    MEGEKKSLAVSDVGAWAMNVVSSVGIIMVNKQLMSANGYAFSYATTLTGFHFAVTALVGM  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            I    G+    ++P  E + F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   ISNATGFSASKHIPLWELLWFSIVANMSITGMNLSLMLNSVGFYQISKLSMIPVVCVMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L S +++++ KL++++V++GV +CTVTDV VNAKGFI A +AV+ST+LQQ  +  LQ+K
Sbjct  121  ILHSKQFTKEVKLAVVVVVIGVGVCTVTDVKVNAKGFICACVAVFSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSVGS  185



>ref|XP_010498559.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
 ref|XP_010498560.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=348

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 132/184 (72%), Gaps = 4/184 (2%)
 Frame = +2

Query  122  KDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTLI  289
            ++EKK  A+ D  AW  N+ +SVGII+ NK LM++  FGFSFATTLTG HFA T L+ ++
Sbjct  5    ENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMV  64

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
                G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C++E V
Sbjct  65   SNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWV  124

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            L S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KY
Sbjct  125  LHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKY  184

Query  650  SLGS  661
            ++GS
Sbjct  185  AIGS  188



>ref|XP_010477366.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
 ref|XP_010477367.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=348

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 132/184 (72%), Gaps = 4/184 (2%)
 Frame = +2

Query  122  KDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTLI  289
            ++EKK  A+ D  AW  N+ +SVGII+ NK LM++  FGFSFATTLTG HFA T L+ ++
Sbjct  5    ENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMV  64

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
                G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C++E V
Sbjct  65   SNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWV  124

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            L S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KY
Sbjct  125  LHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKY  184

Query  650  SLGS  661
            ++GS
Sbjct  185  AIGS  188



>ref|NP_001242197.1| uncharacterized protein LOC100780365 [Glycine max]
 gb|ACU23022.1| unknown [Glycine max]
Length=345

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 133/185 (72%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTL  286
            ++ EK+  AI D  AW  N+V+SVGII+ NK LM+N G  FSFA++LTG HFA T L+ L
Sbjct  1    MESEKRSSAISDVGAWAMNVVSSVGIIMANKQLMSNNGYAFSFASSLTGFHFAVTALVGL  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    GY    ++P  E I F L AN SI GMN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNATGYSASKHVPMWELIWFSLVANMSITGMNFSLMLNSVGFYQISKLSMIPVVCVMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L +   SR+ K+S+++V++GV +CTVTDV VN KGF+ A IAV ST+LQQ  +  LQ+K
Sbjct  121  ILHNKHCSREVKMSVVVVVIGVGVCTVTDVKVNLKGFMCACIAVLSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



>ref|XP_008346270.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
Length=339

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 130/182 (71%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTLILK  295
            K++K  + D  AW  NIV+SVGII+ NK LM+   F F FATTLTG HF+ T L+ L+  
Sbjct  3    KEKKSPVSDVGAWGMNIVSSVGIIMANKQLMSPHGFAFGFATTLTGFHFSVTALVGLVSN  62

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              GY    ++P  E + F L AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E +L 
Sbjct  63   ATGYSASKHVPLWELVWFSLVANASITGMNLSLMLNSVGFYQISKLSMIPVVCVMEWILH  122

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
               +SR+ K+++ +V++GV ICTVTDV VNAKGF+ AF+A+  T+LQQ  +  LQ+KYS+
Sbjct  123  GKHFSREVKIAVAVVVVGVGICTVTDVKVNAKGFLCAFVAILCTSLQQISIGSLQKKYSI  182

Query  656  GS  661
            GS
Sbjct  183  GS  184



>ref|XP_002893149.1| hypothetical protein ARALYDRAFT_889562 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69408.1| hypothetical protein ARALYDRAFT_889562 [Arabidopsis lyrata subsp. 
lyrata]
Length=348

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 131/184 (71%), Gaps = 4/184 (2%)
 Frame = +2

Query  122  KDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTLI  289
            ++EKK  A+ D  AW  N+ +SVGII+ NK LM++  FGF FATTLTG HFA T L+ ++
Sbjct  5    ENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFGFATTLTGFHFALTALVGMV  64

Query  290  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV  469
                G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C++E V
Sbjct  65   SNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWV  124

Query  470  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY  649
            L S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KY
Sbjct  125  LHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKY  184

Query  650  SLGS  661
            S+GS
Sbjct  185  SIGS  188



>emb|CDX87574.1| BnaA07g32990D [Brassica napus]
Length=347

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 130/182 (71%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttlMTLILK  295
            K +  ++ D  AW  NIV+SVGII+ NK LM++  FGFSFATTLTG HFA T L+ ++  
Sbjct  5    KKQSSSVSDVGAWGMNIVSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMVSN  64

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              G     ++P  E + F + AN SI  MN SLM NSVGFYQI+KLSMIPV C++E +L 
Sbjct  65   ATGLSASKHIPLWELLWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWILH  124

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KYS+
Sbjct  125  SKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKYSV  184

Query  656  GS  661
            GS
Sbjct  185  GS  186



>gb|AAM61035.1| unknown [Arabidopsis thaliana]
Length=348

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttl  277
            M  A  +++  A+ D  AW  N+ +SVGII+ NK LM++  FGFSFATTLTG HFA T L
Sbjct  1    MEKAENENKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTAL  60

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            + ++    G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C+
Sbjct  61   VGMVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCV  120

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            +E VL S  YSR+ K S+++V++GV ICTVTDV  NAKGFI A  AV+ST+LQQ  +  L
Sbjct  121  MEWVLHSKHYSREVKASVMVVVVGVGICTVTDVKFNAKGFICACTAVFSTSLQQISIGSL  180

Query  638  QRKYSLGS  661
            Q+KYS+GS
Sbjct  181  QKKYSIGS  188



>ref|XP_010927488.1| PREDICTED: UDP-galactose transporter 2 isoform X2 [Elaeis guineensis]
Length=326

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 131/182 (72%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALM--ANFGFSfattltglhfatttlMTLILK  295
            + +K A+ D  AW  N+V+SVGII+ NK LM  A + FSFATTLTG HFA T  +  +  
Sbjct  3    EGKKSAVSDAGAWAMNVVSSVGIIMANKQLMSPAGYAFSFATTLTGFHFAVTAFVGFVSN  62

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              G+    ++P  E + F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E +L 
Sbjct  63   ATGFSSSKHVPLWELLWFSIVANTSITGMNLSLMLNSVGFYQISKLSMIPVVCVMEWILH  122

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            S  YS++ K+++++V++GV +CTVTDV VNAKGF+ A IAV ST+LQQ  +  LQ+KYS+
Sbjct  123  SKHYSKEVKMAVVVVVVGVGVCTVTDVKVNAKGFLCACIAVLSTSLQQISIGSLQKKYSI  182

Query  656  GS  661
            GS
Sbjct  183  GS  184



>gb|KFK32924.1| hypothetical protein AALP_AA6G307000 [Arabis alpina]
Length=350

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttl  277
            M++   +    A+ D  AW  N+++SVGII+ NK LM++  FGFSFATTLTG HFA T L
Sbjct  1    MATESERRSSSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTAL  60

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            + ++    G+    ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C+
Sbjct  61   VGVVSNATGFSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCV  120

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            +E +L S RYSR+ K+S+++V+LGV ICTVTDV VNAKGFI A +A++S++LQQ  +  L
Sbjct  121  MEWILHSKRYSREVKVSVVVVVLGVGICTVTDVKVNAKGFICACVAIFSSSLQQILIGSL  180

Query  638  QRKYSLGS  661
            Q+KYS+GS
Sbjct  181  QKKYSIGS  188



>ref|XP_010459808.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
 ref|XP_010459809.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=348

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttl  277
            M  A  + +  A+ D  AW  N+ +SVGII+ NK LM++  FGFSFATTLTG HFA T L
Sbjct  1    MEKAENERKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTAL  60

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            + ++    G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C+
Sbjct  61   VGMVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCV  120

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            +E VL S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  L
Sbjct  121  MEWVLHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSL  180

Query  638  QRKYSLGS  661
            Q+KY++GS
Sbjct  181  QKKYAIGS  188



>ref|XP_008235851.1| PREDICTED: UDP-galactose transporter 2-like [Prunus mume]
Length=342

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 129/182 (71%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTLILK  295
            K++K  + D  AW  NIV+SVGII+ NK LM+   F F FATTLTG HF+ T L+ L+  
Sbjct  3    KEKKSPVSDVGAWGMNIVSSVGIIMANKQLMSPHGFAFGFATTLTGFHFSVTALVGLVSN  62

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              GY    ++P  E + F L AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E ++ 
Sbjct  63   ATGYSASKHVPLWELVWFSLVANASITGMNLSLMLNSVGFYQISKLSMIPVVCMMEWIIH  122

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
               +SR+ K+++ +V++GV ICTVTDV VNAKGF+ A +A+  T+LQQ  +  LQ+KYS+
Sbjct  123  GKHFSREVKMAVAVVVVGVGICTVTDVKVNAKGFLCACVAILCTSLQQISIGSLQKKYSI  182

Query  656  GS  661
            GS
Sbjct  183  GS  184



>ref|XP_007200355.1| hypothetical protein PRUPE_ppa008188mg [Prunus persica]
 gb|EMJ01554.1| hypothetical protein PRUPE_ppa008188mg [Prunus persica]
Length=342

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 129/182 (71%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTLILK  295
            K++K  + D  AW  NIV+SVGII+ NK LM+   F F FATTLTG HF+ T L+ L+  
Sbjct  3    KEKKSPVSDVGAWGMNIVSSVGIIMANKQLMSPHGFAFGFATTLTGFHFSVTALVGLVSN  62

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              GY    ++P  E + F L AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E ++ 
Sbjct  63   ATGYSASKHVPLWELVWFSLVANASITGMNLSLMLNSVGFYQISKLSMIPVVCMMEWIIH  122

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
               +SR+ K+++ +V++GV ICTVTDV VNAKGF+ A +A+  T+LQQ  +  LQ+KYS+
Sbjct  123  GKHFSREVKMAVAVVVVGVGICTVTDVKVNAKGFLCACVAILCTSLQQISIGSLQKKYSI  182

Query  656  GS  661
            GS
Sbjct  183  GS  184



>ref|XP_006416334.1| hypothetical protein EUTSA_v10008081mg [Eutrema salsugineum]
 gb|ESQ34687.1| hypothetical protein EUTSA_v10008081mg [Eutrema salsugineum]
Length=348

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = +2

Query  104  MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSfattltglhfatttl  277
            M  A  + +  A+ D  AW  N+ +SVGII+ NK LM++  FGFSFATTLTG HFA T L
Sbjct  1    MEKADSEKKASAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFAFTAL  60

Query  278  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL  457
            + L+    G     ++P  E + F + AN SI  MN SLM NSVGFYQI+KLSMIPV C+
Sbjct  61   VGLVSNATGLSASKHVPLWELLWFSIVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCV  120

Query  458  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL  637
            +E VL S  YSR+ K S+++V++GV ICTVTDV VNAKGF+ A  AV+ST+LQQ  +  L
Sbjct  121  MEWVLHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFVCACTAVFSTSLQQISIGSL  180

Query  638  QRKYSLGS  661
            Q+KYS+GS
Sbjct  181  QKKYSVGS  188



>ref|XP_004253110.1| PREDICTED: UDP-galactose transporter 2 [Solanum lycopersicum]
Length=342

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKKA--IIDTAAWTFNIVTSVGIIIVNKALMA--NFGFSfattltglhfatttlMTL  286
            ++ EKK+  + D  AW  N+V+SVGII+ NK LM+   + F+FATTLTG HFA T L+ +
Sbjct  1    MESEKKSSHVSDMGAWAMNVVSSVGIIMANKQLMSANGYAFTFATTLTGFHFAVTALVGM  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    G     ++P  E I F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNATGLSSSKHVPLWELIWFSVVANMSITGMNLSLMLNSVGFYQISKLSMIPVVCIMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            VL + RYS++ K+S+++V++GV +CTVTDV VNAKGFI A +AV ST+LQQ  +  LQ+K
Sbjct  121  VLHNKRYSKEVKMSVVVVVIGVGVCTVTDVKVNAKGFICACVAVLSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



>ref|XP_010927487.1| PREDICTED: UDP-galactose transporter 2 isoform X1 [Elaeis guineensis]
Length=343

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 131/182 (72%), Gaps = 2/182 (1%)
 Frame = +2

Query  122  KDEKKAIIDTAAWTFNIVTSVGIIIVNKALM--ANFGFSfattltglhfatttlMTLILK  295
            + +K A+ D  AW  N+V+SVGII+ NK LM  A + FSFATTLTG HFA T  +  +  
Sbjct  3    EGKKSAVSDAGAWAMNVVSSVGIIMANKQLMSPAGYAFSFATTLTGFHFAVTAFVGFVSN  62

Query  296  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD  475
              G+    ++P  E + F + AN SI GMN+SLM NSVGFYQI+KLSMIPV C++E +L 
Sbjct  63   ATGFSSSKHVPLWELLWFSIVANTSITGMNLSLMLNSVGFYQISKLSMIPVVCVMEWILH  122

Query  476  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL  655
            S  YS++ K+++++V++GV +CTVTDV VNAKGF+ A IAV ST+LQQ  +  LQ+KYS+
Sbjct  123  SKHYSKEVKMAVVVVVVGVGVCTVTDVKVNAKGFLCACIAVLSTSLQQISIGSLQKKYSI  182

Query  656  GS  661
            GS
Sbjct  183  GS  184



>ref|XP_007157247.1| hypothetical protein PHAVU_002G054900g [Phaseolus vulgaris]
 ref|XP_007157248.1| hypothetical protein PHAVU_002G054900g [Phaseolus vulgaris]
 gb|ESW29241.1| hypothetical protein PHAVU_002G054900g [Phaseolus vulgaris]
 gb|ESW29242.1| hypothetical protein PHAVU_002G054900g [Phaseolus vulgaris]
Length=346

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 134/185 (72%), Gaps = 4/185 (2%)
 Frame = +2

Query  119  VKDEKKA--IIDTAAWTFNIVTSVGIIIVNKALMANFG--FSfattltglhfatttlMTL  286
            ++ EKKA  I +  AW  N+V+SVGII+ NK LM+N G  F+FA++LTG HFA T L+ L
Sbjct  1    MESEKKASSISNVGAWAMNVVSSVGIIMANKQLMSNNGYAFTFASSLTGFHFAVTALVGL  60

Query  287  ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV  466
            +    GY    ++P  E I F L AN SI GMN SLM NSVGFYQI+KLSMIPV C++E 
Sbjct  61   VSNATGYSASKHVPLWELIWFSLVANMSITGMNFSLMLNSVGFYQISKLSMIPVVCVMEW  120

Query  467  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK  646
            +L +  YSR+ K+++++V++GV +CTVTDV VN KGF+ A +AV ST+LQQ  +  LQ+K
Sbjct  121  ILHNKHYSREVKMAVVVVVIGVGVCTVTDVKVNLKGFMCACLAVLSTSLQQISIGSLQKK  180

Query  647  YSLGS  661
            YS+GS
Sbjct  181  YSIGS  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140