BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047L17

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631638.1|  PREDICTED: proteasome subunit alpha type-6         419   6e-146   Nicotiana tomentosiformis
ref|XP_009797939.1|  PREDICTED: proteasome subunit alpha type-6         419   7e-146   Nicotiana sylvestris
ref|XP_011098408.1|  PREDICTED: proteasome subunit alpha type-6         417   3e-145   Sesamum indicum [beniseed]
gb|KDP33929.1|  hypothetical protein JCGZ_07500                         417   5e-145   Jatropha curcas
gb|KHG01950.1|  Proteasome subunit alpha type-6                         417   5e-145   Gossypium arboreum [tree cotton]
gb|KJB65226.1|  hypothetical protein B456_010G089600                    416   7e-145   Gossypium raimondii
gb|EYU19318.1|  hypothetical protein MIMGU_mgv1a012555mg                416   8e-145   Erythranthe guttata [common monkey flower]
ref|XP_002271929.1|  PREDICTED: proteasome subunit alpha type-6         416   9e-145   Vitis vinifera
gb|KJB82986.1|  hypothetical protein B456_013G223200                    416   1e-144   Gossypium raimondii
ref|XP_007012615.1|  20S proteasome subunit PAA2 isoform 1              416   1e-144   Theobroma cacao [chocolate]
gb|KDP45827.1|  hypothetical protein JCGZ_17434                         416   1e-144   Jatropha curcas
ref|XP_010269878.1|  PREDICTED: proteasome subunit alpha type-6-like    415   3e-144   Nelumbo nucifera [Indian lotus]
ref|XP_011099933.1|  PREDICTED: proteasome subunit alpha type-6-like    414   4e-144   Sesamum indicum [beniseed]
ref|XP_004251692.1|  PREDICTED: proteasome subunit alpha type-6         414   5e-144   Solanum lycopersicum
gb|ACJ11727.1|  20S proteasome subunit alpha-1                          414   6e-144   Gossypium hirsutum [American cotton]
ref|XP_009380029.1|  PREDICTED: proteasome subunit alpha type-6         413   1e-143   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006381605.1|  hypothetical protein POPTR_0006s14260g             413   1e-143   Populus trichocarpa [western balsam poplar]
ref|XP_009404175.1|  PREDICTED: proteasome subunit alpha type-6-like    413   2e-143   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010274570.1|  PREDICTED: proteasome subunit alpha type-6         413   2e-143   Nelumbo nucifera [Indian lotus]
emb|CDP03072.1|  unnamed protein product                                412   3e-143   Coffea canephora [robusta coffee]
gb|KJB65225.1|  hypothetical protein B456_010G089600                    412   4e-143   Gossypium raimondii
gb|KJB82987.1|  hypothetical protein B456_013G223200                    412   5e-143   Gossypium raimondii
ref|XP_008228175.1|  PREDICTED: proteasome subunit alpha type-6         411   1e-142   Prunus mume [ume]
ref|XP_007215872.1|  hypothetical protein PRUPE_ppa010523mg             410   1e-142   Prunus persica
gb|ABK96399.1|  unknown                                                 410   2e-142   Populus trichocarpa x Populus deltoides
ref|XP_008782714.1|  PREDICTED: proteasome subunit alpha type-6         410   3e-142   Phoenix dactylifera
ref|XP_008802476.1|  PREDICTED: proteasome subunit alpha type-6-like    409   5e-142   Phoenix dactylifera
gb|EPS63192.1|  proteasome subunit alpha type-6                         409   5e-142   Genlisea aurea
ref|XP_006592586.1|  PREDICTED: proteasome subunit alpha type-6-like    408   1e-141   Glycine max [soybeans]
ref|XP_010064020.1|  PREDICTED: proteasome subunit alpha type-6         408   2e-141   Eucalyptus grandis [rose gum]
ref|XP_002323091.1|  Proteasome subunit alpha type 6-1 family pro...    407   2e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010937324.1|  PREDICTED: proteasome subunit alpha type-6         407   2e-141   Elaeis guineensis
ref|XP_004488480.1|  PREDICTED: proteasome subunit alpha type-6-l...    407   3e-141   Cicer arietinum [garbanzo]
ref|XP_006842706.1|  hypothetical protein AMTR_s00147p00090390          407   3e-141   Amborella trichopoda
gb|KJB82988.1|  hypothetical protein B456_013G223200                    407   4e-141   Gossypium raimondii
ref|XP_009344472.1|  PREDICTED: proteasome subunit alpha type-6         407   5e-141   Pyrus x bretschneideri [bai li]
ref|XP_008391412.1|  PREDICTED: proteasome subunit alpha type-6         407   5e-141   Malus domestica [apple tree]
ref|XP_011001657.1|  PREDICTED: proteasome subunit alpha type-6-like    407   5e-141   Populus euphratica
ref|XP_007133143.1|  hypothetical protein PHAVU_011G155200g             406   6e-141   Phaseolus vulgaris [French bean]
ref|XP_008462289.1|  PREDICTED: proteasome subunit alpha type-6         406   7e-141   Cucumis melo [Oriental melon]
gb|ACJ85916.1|  unknown                                                 406   9e-141   Medicago truncatula
ref|XP_002532723.1|  proteasome subunit alpha type, putative            406   1e-140   Ricinus communis
gb|ADJ95344.1|  PAA1                                                    405   1e-140   Carica papaya [mamon]
ref|XP_010557672.1|  PREDICTED: proteasome subunit alpha type-6-B...    405   2e-140   Tarenaya hassleriana [spider flower]
ref|XP_006474716.1|  PREDICTED: proteasome subunit alpha type-6-l...    405   2e-140   Citrus sinensis [apfelsine]
ref|XP_010541996.1|  PREDICTED: proteasome subunit alpha type-6-B       405   2e-140   Tarenaya hassleriana [spider flower]
ref|XP_002308263.1|  Proteasome subunit alpha type 6-1 family pro...    405   2e-140   Populus trichocarpa [western balsam poplar]
ref|XP_004141710.1|  PREDICTED: proteasome subunit alpha type-6-like    405   3e-140   Cucumis sativus [cucumbers]
ref|NP_001238251.1|  proteasome subunit alpha type-6                    404   4e-140   
gb|ABK95322.1|  unknown                                                 404   4e-140   Populus trichocarpa [western balsam poplar]
gb|AFK47610.1|  unknown                                                 404   6e-140   Lotus japonicus
ref|XP_011018964.1|  PREDICTED: proteasome subunit alpha type-6-like    404   8e-140   Populus euphratica
ref|XP_010441957.1|  PREDICTED: proteasome subunit alpha type-6-B...    404   9e-140   Camelina sativa [gold-of-pleasure]
ref|XP_006465892.1|  PREDICTED: proteasome subunit alpha type-6-like    403   9e-140   Citrus sinensis [apfelsine]
ref|XP_003595788.1|  Proteasome subunit alpha type                      403   1e-139   Medicago truncatula
gb|ACU24622.1|  unknown                                                 403   1e-139   Glycine max [soybeans]
gb|AFK46801.1|  unknown                                                 403   2e-139   Medicago truncatula
ref|XP_010939895.1|  PREDICTED: proteasome subunit alpha type-6-like    401   5e-139   Elaeis guineensis
gb|KHG04433.1|  Proteasome subunit alpha type-6                         400   6e-139   Gossypium arboreum [tree cotton]
ref|XP_010533014.1|  PREDICTED: proteasome subunit alpha type-6-B...    401   7e-139   Tarenaya hassleriana [spider flower]
ref|XP_004303706.1|  PREDICTED: proteasome subunit alpha type-6         401   9e-139   Fragaria vesca subsp. vesca
gb|ACJ85912.1|  unknown                                                 400   1e-138   Medicago truncatula
gb|ACN66752.1|  PAA1                                                    400   1e-138   Carica papaya [mamon]
ref|XP_010494382.1|  PREDICTED: proteasome subunit alpha type-6-B       400   2e-138   Camelina sativa [gold-of-pleasure]
ref|XP_010666851.1|  PREDICTED: proteasome subunit alpha type-6         400   2e-138   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001031340.1|  20S proteasome subunit PAA2                        399   3e-138   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178641.1|  20S proteasome subunit PAA2                           399   6e-138   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46380.1|  unknown                                                 399   6e-138   Lotus japonicus
gb|KHN46954.1|  Proteasome subunit alpha type-6                         410   8e-138   Glycine soja [wild soybean]
ref|XP_009102355.1|  PREDICTED: proteasome subunit alpha type-6-B       398   9e-138   Brassica rapa
ref|XP_006396131.1|  hypothetical protein EUTSA_v10002649mg             398   1e-137   Eutrema salsugineum [saltwater cress]
gb|KFK32243.1|  hypothetical protein AALP_AA6G216400                    396   8e-137   Arabis alpina [alpine rockcress]
ref|XP_006474717.1|  PREDICTED: proteasome subunit alpha type-6-l...    395   1e-136   
ref|XP_002516258.1|  proteasome subunit alpha type, putative            395   1e-136   Ricinus communis
ref|XP_009136197.1|  PREDICTED: proteasome subunit alpha type-6-B...    395   1e-136   Brassica rapa
ref|XP_010450390.1|  PREDICTED: proteasome subunit alpha type-6-A       395   2e-136   Camelina sativa [gold-of-pleasure]
ref|XP_010435443.1|  PREDICTED: proteasome subunit alpha type-6-A...    395   2e-136   Camelina sativa [gold-of-pleasure]
ref|XP_006282775.1|  hypothetical protein CARUB_v10006215mg             395   2e-136   Capsella rubella
ref|NP_198409.1|  proteasome alpha subunit A1                           394   6e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649499.1|  PREDICTED: proteasome subunit alpha type-6-like    393   1e-135   Oryza brachyantha
ref|NP_001049162.1|  Os03g0180400                                       392   2e-135   
gb|AAM12968.1|  multicatalytic endopeptidase complex alpha subuni...    392   3e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870436.1|  hypothetical protein ARALYDRAFT_493620             392   3e-135   
emb|CAA74025.1|  multicatalytic endopeptidase complex, proteasome...    391   5e-135   Arabidopsis thaliana [mouse-ear cress]
gb|ACN33969.1|  unknown                                                 391   9e-135   Zea mays [maize]
ref|NP_001130062.1|  uncharacterized protein LOC100191154               390   1e-134   Zea mays [maize]
gb|AAC32054.1|  20S proteasome subunit PAA1                             390   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985490.1|  PREDICTED: proteasome subunit alpha type-6-like    390   3e-134   Setaria italica
ref|XP_002465753.1|  hypothetical protein SORBIDRAFT_01g045210          389   4e-134   Sorghum bicolor [broomcorn]
emb|CDY50408.1|  BnaC03g45100D                                          389   7e-134   Brassica napus [oilseed rape]
ref|NP_001105138.1|  maize 20S proteasome alpha subunit                 389   7e-134   Zea mays [maize]
gb|KDO64977.1|  hypothetical protein CISIN_1g025897mg                   387   3e-133   Citrus sinensis [apfelsine]
ref|XP_003558667.1|  PREDICTED: proteasome subunit alpha type-6         385   1e-132   Brachypodium distachyon [annual false brome]
gb|AGO97077.1|  20S proteasome alpha                                    384   5e-132   Saccharum hybrid cultivar GT28
emb|CDX93103.1|  BnaA03g38250D                                          384   1e-131   
gb|EMT09268.1|  Proteasome subunit alpha type-6                         382   2e-131   
gb|ABK22399.1|  unknown                                                 382   3e-131   Picea sitchensis
dbj|BAJ85935.1|  predicted protein                                      381   5e-131   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006452821.1|  hypothetical protein CICLE_v10010323mg             375   1e-128   
gb|ABF94306.1|  Proteasome subunit alpha type 6, putative, expressed    373   3e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001777426.1|  predicted protein                                  366   4e-125   
ref|XP_001768229.1|  predicted protein                                  363   7e-124   
ref|XP_002989745.1|  hypothetical protein SELMODRAFT_272088             361   6e-123   Selaginella moellendorffii
ref|XP_001782615.1|  predicted protein                                  361   6e-123   
ref|XP_010111992.1|  Proteasome subunit alpha type-6                    357   2e-120   
gb|KDO64982.1|  hypothetical protein CISIN_1g025897mg                   351   1e-119   Citrus sinensis [apfelsine]
gb|AFK44903.1|  unknown                                                 341   4e-116   Medicago truncatula
ref|XP_001751730.1|  predicted protein                                  340   5e-115   
gb|ACB87915.1|  20S proteasome alpha subunit A1                         330   9e-112   Malus domestica [apple tree]
gb|KDO64978.1|  hypothetical protein CISIN_1g025897mg                   328   7e-111   Citrus sinensis [apfelsine]
ref|XP_005648429.1|  proteasome subunit alpha type-6                    329   2e-110   Coccomyxa subellipsoidea C-169
gb|AFW89473.1|  hypothetical protein ZEAMMB73_334376                    321   1e-107   
ref|XP_001691723.1|  20S proteasome alpha subunit A                     320   7e-107   Chlamydomonas reinhardtii
ref|XP_002949740.1|  20S proteasome alpha subunit A                     318   2e-106   Volvox carteri f. nagariensis
gb|KDD75255.1|  proteasome subunit protein                              311   2e-103   Helicosporidium sp. ATCC 50920
ref|XP_003059392.1|  predicted protein                                  305   8e-101   Micromonas pusilla CCMP1545
ref|XP_001418143.1|  predicted protein                                  299   1e-98    Ostreococcus lucimarinus CCE9901
ref|XP_005843942.1|  hypothetical protein CHLNCDRAFT_27583              296   1e-97    Chlorella variabilis
emb|CEF98211.1|  Proteasome A-type subunit                              295   5e-97    Ostreococcus tauri
gb|ESA18832.1|  hypothetical protein GLOINDRAFT_344383                  291   1e-95    
gb|KIY96698.1|  20S proteasome subunit alpha 1                          292   2e-95    Monoraphidium neglectum
ref|XP_005842332.1|  20S proteasome subunit alpha type 6                291   2e-95    Guillardia theta CCMP2712
gb|KDO64983.1|  hypothetical protein CISIN_1g025897mg                   288   6e-95    Citrus sinensis [apfelsine]
ref|XP_005717620.1|  20S core proteasome subunit alpha 1                289   1e-94    Chondrus crispus [carageen]
emb|CEG74212.1|  Putative Proteasome subunit alpha type                 288   3e-94    Rhizopus microsporus
gb|EIE83838.1|  hypothetical protein RO3G_08543                         286   1e-93    Rhizopus delemar RA 99-880
ref|XP_006835407.1|  PREDICTED: proteasome subunit alpha type-6 i...    286   1e-93    Chrysochloris asiatica
ref|NP_989113.1|  proteasome subunit alpha type-6                       286   1e-93    Xenopus tropicalis [western clawed frog]
ref|XP_003445487.1|  PREDICTED: proteasome subunit alpha type-6-like    286   1e-93    Oreochromis niloticus
ref|XP_010741287.1|  PREDICTED: proteasome subunit alpha type-6         286   2e-93    
ref|XP_004436462.1|  PREDICTED: proteasome subunit alpha type-6 i...    285   5e-93    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_009209663.1|  PREDICTED: proteasome subunit alpha type-6 i...    284   5e-93    
ref|NP_001264372.1|  proteasome subunit alpha type-6                    285   5e-93    Gallus gallus [bantam]
ref|NP_001086785.1|  proteasome alpha 6 subunit                         285   5e-93    Xenopus laevis [clawed frog]
gb|EDL36728.1|  proteasome (prosome, macropain) subunit, alpha ty...    285   5e-93    Mus musculus [mouse]
ref|XP_005656349.1|  PREDICTED: proteasome subunit alpha type-6 i...    284   5e-93    
gb|KFW08632.1|  Proteasome subunit alpha type-6                         284   5e-93    Eurypyga helias
ref|NP_001232198.1|  putative proteasome subunit alpha type 6           285   6e-93    Taeniopygia guttata
ref|XP_010153544.1|  PREDICTED: proteasome subunit alpha type-6 i...    284   7e-93    Eurypyga helias
ref|XP_009901279.1|  PREDICTED: proteasome subunit alpha type-6 i...    284   7e-93    Picoides pubescens
gb|ABM86477.1|  proteasome (prosome, macropain) subunit, alpha ty...    284   7e-93    synthetic construct
ref|XP_008300217.1|  PREDICTED: proteasome subunit alpha type-6         284   7e-93    Stegastes partitus
ref|NP_036098.1|  proteasome subunit alpha type-6                       284   7e-93    Mus musculus [mouse]
ref|XP_004698589.1|  PREDICTED: proteasome subunit alpha type-6         284   7e-93    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_537412.2|  PREDICTED: proteasome subunit alpha type-6 isof...    284   7e-93    Canis lupus familiaris [dogs]
ref|XP_007180773.1|  PREDICTED: proteasome subunit alpha type-6         284   7e-93    Balaenoptera acutorostrata scammoni
ref|NP_058979.1|  proteasome subunit alpha type-6                       284   8e-93    Rattus norvegicus [brown rat]
emb|CDS07623.1|  Putative Proteasome subunit alpha type                 284   8e-93    Lichtheimia ramosa
emb|CEP12966.1|  hypothetical protein                                   284   8e-93    Parasitella parasitica
ref|XP_004470220.1|  PREDICTED: proteasome subunit alpha type-6         284   8e-93    Dasypus novemcinctus
ref|XP_004649175.1|  PREDICTED: proteasome subunit alpha type-6         284   8e-93    Jaculus jaculus
ref|XP_004559366.1|  PREDICTED: proteasome subunit alpha type-6-like    284   9e-93    Maylandia zebra
gb|EPB88050.1|  proteasome subunit alpha type-6                         284   9e-93    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_010153543.1|  PREDICTED: proteasome subunit alpha type-6 i...    284   1e-92    Eurypyga helias
ref|XP_005149366.1|  PREDICTED: proteasome subunit alpha type-6         284   1e-92    
ref|XP_006258805.1|  PREDICTED: proteasome subunit alpha type-6         284   1e-92    Alligator mississippiensis
ref|XP_001095366.1|  PREDICTED: proteasome subunit alpha type-6-l...    284   1e-92    
ref|XP_008282309.1|  PREDICTED: proteasome subunit alpha type-6         283   1e-92    Stegastes partitus
ref|NP_001132918.1|  proteasome subunit alpha type-6                    283   1e-92    Ovis aries [domestic sheep]
ref|NP_001088418.1|  uncharacterized protein LOC495277                  283   2e-92    Xenopus laevis [clawed frog]
emb|CAG00121.1|  unnamed protein product                                283   2e-92    Tetraodon nigroviridis
dbj|GAN03133.1|  proteasome subunit alpha type-6                        283   2e-92    Mucor ambiguus
ref|XP_005865030.1|  PREDICTED: proteasome subunit alpha type-6         283   2e-92    Myotis brandtii
ref|XP_007253022.1|  PREDICTED: proteasome subunit alpha type-6-l...    283   2e-92    Astyanax mexicanus [blind cave fish]
ref|XP_006172412.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    283   2e-92    Tupaia chinensis
ref|XP_001363110.1|  PREDICTED: proteasome subunit alpha type-6         283   2e-92    Monodelphis domestica
ref|XP_004542308.1|  PREDICTED: proteasome subunit alpha type-6-like    283   2e-92    Maylandia zebra
ref|XP_003440740.1|  PREDICTED: proteasome subunit alpha type-6-like    283   2e-92    Oreochromis niloticus
emb|CDH55408.1|  proteasome subunit alpha type-6                        283   3e-92    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005798367.1|  PREDICTED: proteasome subunit alpha type-6-like    283   3e-92    Xiphophorus maculatus
ref|XP_003924255.1|  PREDICTED: proteasome subunit alpha type-6         284   4e-92    Saimiri boliviensis boliviensis
ref|XP_007530301.1|  PREDICTED: proteasome subunit alpha type-6         282   4e-92    Erinaceus europaeus [common hedgehog]
ref|XP_005810950.1|  PREDICTED: proteasome subunit alpha type-6-like    282   4e-92    Xiphophorus maculatus
ref|XP_010744453.1|  PREDICTED: proteasome subunit alpha type-6         282   4e-92    
ref|XP_007436765.1|  PREDICTED: proteasome subunit alpha type-6         282   4e-92    Python bivittatus
ref|XP_008396439.1|  PREDICTED: proteasome subunit alpha type-6         282   4e-92    Poecilia reticulata
ref|NP_001279159.1|  proteasome (prosome, macropain) subunit, alp...    282   5e-92    Callorhinchus milii [Australian ghost shark]
ref|XP_003971508.1|  PREDICTED: proteasome subunit alpha type-6-like    282   5e-92    Takifugu rubripes [tiger puffer]
ref|XP_004083706.1|  PREDICTED: proteasome subunit alpha type-6         282   5e-92    Oryzias latipes [Japanese rice fish]
ref|XP_003471921.1|  PREDICTED: proteasome subunit alpha type-6         282   5e-92    Cavia porcellus [guinea pig]
pdb|4R3O|A  Chain A, Human Constitutive 20s Proteasome                  282   6e-92    Homo sapiens [man]
ref|XP_007569003.1|  PREDICTED: proteasome subunit alpha type-6         282   6e-92    Poecilia formosa
ref|XP_005285405.1|  PREDICTED: proteasome subunit alpha type-6 i...    281   1e-91    Chrysemys picta bellii
ref|XP_010876681.1|  PREDICTED: proteasome subunit alpha type-6         281   1e-91    Esox lucius
ref|XP_007012616.1|  20S proteasome subunit PAA2 isoform 2              279   1e-91    
gb|ACI66289.1|  Proteasome subunit alpha type-6                         281   1e-91    Salmo salar
dbj|BAE36518.1|  unnamed protein product                                281   1e-91    Mus musculus [mouse]
ref|XP_007576015.1|  PREDICTED: proteasome subunit alpha type-6         281   1e-91    Poecilia formosa
ref|XP_005158685.1|  PREDICTED: proteasome subunit alpha type-6 i...    281   1e-91    
emb|CDQ90937.1|  unnamed protein product                                281   1e-91    Oncorhynchus mykiss
ref|XP_006985315.1|  PREDICTED: proteasome subunit alpha type-6         281   1e-91    Peromyscus maniculatus bairdii
ref|NP_001132944.1|  proteasome subunit alpha type-6                    281   1e-91    Sus scrofa [pigs]
ref|XP_007253021.1|  PREDICTED: proteasome subunit alpha type-6-l...    282   2e-91    
ref|XP_001511492.1|  PREDICTED: proteasome subunit alpha type-6 i...    281   2e-91    Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001002589.1|  proteasome subunit alpha type-6                    280   2e-91    Danio rerio [leopard danio]
ref|XP_008398058.1|  PREDICTED: proteasome subunit alpha type-6         280   3e-91    Poecilia reticulata
ref|XP_006632201.1|  PREDICTED: proteasome subunit alpha type-6-like    280   4e-91    Lepisosteus oculatus
gb|ACO51961.1|  Proteasome subunit alpha type-6                         280   4e-91    Rana catesbeiana [bullfrog]
ref|XP_005989234.1|  PREDICTED: proteasome subunit alpha type-6         280   5e-91    Latimeria chalumnae
ref|XP_005562133.1|  PREDICTED: proteasome subunit alpha type-6-like    279   6e-91    
gb|ERE72543.1|  proteasome subunit alpha type-6-like protein            280   6e-91    Cricetulus griseus [Chinese hamsters]
ref|XP_002824717.1|  PREDICTED: proteasome subunit alpha type-6 i...    279   7e-91    
ref|XP_006015430.1|  PREDICTED: proteasome subunit alpha type-6         284   8e-91    
ref|XP_004653726.1|  PREDICTED: proteasome subunit alpha type-6-like    279   9e-91    
gb|ETE73021.1|  Proteasome subunit alpha type-6                         280   1e-90    Ophiophagus hannah
ref|XP_002500811.1|  predicted protein                                  280   1e-90    Micromonas commoda
emb|CDQ78135.1|  unnamed protein product                                278   1e-90    Oncorhynchus mykiss
ref|XP_007513369.1|  predicted protein                                  279   1e-90    Bathycoccus prasinos
ref|NP_001150310.1|  proteasome subunit alpha type 6                    280   1e-90    Zea mays [maize]
gb|ACQ58552.1|  Proteasome subunit alpha type-6                         278   1e-90    Anoplopoma fimbria
ref|NP_705941.1|  proteasome subunit alpha type-6                       278   2e-90    
gb|AFK10987.1|  proteasome subunit alpha type-6-like protein            278   2e-90    Callorhinchus milii [Australian ghost shark]
gb|KDO64981.1|  hypothetical protein CISIN_1g025897mg                   274   2e-90    Citrus sinensis [apfelsine]
gb|ACM08640.1|  Proteasome subunit alpha type-6                         278   3e-90    Salmo salar
ref|XP_008311014.1|  PREDICTED: proteasome subunit alpha type-6         277   4e-90    Cynoglossus semilaevis [half-smooth tongue sole]
gb|ACH70968.1|  proteasome (prosome, macropain) subunit, alpha ty...    276   7e-90    Salmo salar
ref|XP_002610620.1|  hypothetical protein BRAFLDRAFT_260512             276   1e-89    Branchiostoma floridae
ref|XP_001640650.1|  predicted protein                                  276   1e-89    Nematostella vectensis
ref|XP_006932865.1|  PREDICTED: proteasome subunit alpha type-6 i...    274   2e-89    Felis catus [cat]
gb|ACH70967.1|  proteasome (prosome, macropain) subunit, alpha ty...    275   2e-89    Salmo salar
ref|XP_004637142.1|  PREDICTED: proteasome subunit alpha type-6         275   3e-89    Octodon degus
gb|ACO08806.1|  Proteasome subunit alpha type 6                         275   3e-89    Oncorhynchus mykiss
ref|XP_006793167.1|  PREDICTED: proteasome subunit alpha type-6-like    274   4e-89    Neolamprologus brichardi [lyretail cichlid]
ref|XP_010876973.1|  PREDICTED: proteasome subunit alpha type-6         274   8e-89    Esox lucius
ref|XP_010777538.1|  PREDICTED: proteasome subunit alpha type-6         273   1e-88    Notothenia coriiceps [yellowbelly rockcod]
gb|EIE87129.1|  hypothetical protein RO3G_11840                         274   1e-88    Rhizopus delemar RA 99-880
ref|XP_004333676.1|  proteasome subunit alpha type6, putative           273   1e-88    Acanthamoeba castellanii str. Neff
gb|ACI69778.1|  Proteasome subunit alpha type-6                         273   1e-88    Salmo salar
emb|CDH55409.1|  proteasome subunit alpha type-6                        273   2e-88    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011419593.1|  PREDICTED: proteasome subunit alpha type-6         273   2e-88    Crassostrea gigas
gb|ACO08382.1|  Proteasome subunit alpha type 6                         273   3e-88    Oncorhynchus mykiss
ref|XP_005703510.1|  20S proteasome subunit alpha 1                     272   4e-88    Galdieria sulphuraria
ref|XP_003388491.1|  PREDICTED: proteasome subunit alpha type-6-like    271   1e-87    Amphimedon queenslandica
ref|XP_008608969.1|  proteasome subunit alpha type-6                    271   1e-87    Saprolegnia diclina VS20
ref|XP_006065991.1|  PREDICTED: proteasome subunit alpha type-6-like    271   2e-87    
ref|XP_004349345.1|  proteasome subunit iota                            270   2e-87    Capsaspora owczarzaki ATCC 30864
ref|XP_005762775.1|  hypothetical protein EMIHUDRAFT_446206             271   3e-87    Emiliania huxleyi CCMP1516
tpg|DAA43694.1|  TPA: hypothetical protein ZEAMMB73_913533              266   3e-87    
ref|XP_006678757.1|  hypothetical protein BATDEDRAFT_88011              269   1e-86    Batrachochytrium dendrobatidis JAM81
gb|ABI13160.1|  putative proteasome alpha subunit                       268   2e-86    Emiliania huxleyi
ref|XP_008881328.1|  hypothetical protein H310_15130                    268   2e-86    Aphanomyces invadans
gb|ELU01128.1|  hypothetical protein CAPTEDRAFT_167909                  267   3e-86    Capitella teleta
ref|XP_007873808.1|  hypothetical protein PNEG_01835                    267   4e-86    Pneumocystis murina B123
ref|XP_008993532.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    267   5e-86    Callithrix jacchus [common marmoset]
ref|XP_009831249.1|  hypothetical protein H257_07425                    266   5e-86    Aphanomyces astaci
ref|XP_007688022.1|  hypothetical protein COCMIDRAFT_5367               266   9e-86    Bipolaris oryzae ATCC 44560
gb|ETI45522.1|  hypothetical protein F443_09944                         266   1e-85    Phytophthora parasitica P1569
ref|XP_009526410.1|  hypothetical protein PHYSODRAFT_285915             266   1e-85    Phytophthora sojae
ref|XP_003303796.1|  hypothetical protein PTT_16156                     266   1e-85    
ref|XP_001931683.1|  proteasome subunit alpha type-6                    266   2e-85    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_002902293.1|  proteasome subunit alpha type-6, putative          265   2e-85    Phytophthora infestans T30-4
ref|XP_005356606.1|  PREDICTED: proteasome subunit alpha type-6-like    265   2e-85    
ref|XP_003740511.1|  PREDICTED: proteasome subunit alpha type-6-like    265   2e-85    Galendromus occidentalis
emb|CDM30570.1|  Probable proteasome subunit alpha type-6               265   3e-85    Penicillium roqueforti FM164
gb|ACO08744.1|  Proteasome subunit alpha type 6                         263   3e-85    Oncorhynchus mykiss
ref|XP_009063626.1|  hypothetical protein LOTGIDRAFT_229407             265   4e-85    Lottia gigantea
ref|XP_002113578.1|  hypothetical protein TRIADDRAFT_27191              265   4e-85    Trichoplax adhaerens
ref|XP_003844849.1|  similar to proteasome subunit alpha type-6         265   4e-85    Leptosphaeria maculans JN3
gb|KGO36960.1|  Proteasome A-type subunit                               264   6e-85    Penicillium expansum
emb|CCA15401.1|  proteasome subunit alpha type6 putative                264   7e-85    Albugo laibachii Nc14
ref|XP_009019631.1|  hypothetical protein HELRODRAFT_106545             264   8e-85    Helobdella robusta
ref|XP_011314423.1|  PREDICTED: proteasome subunit alpha type-6-like    263   9e-85    Fopius arisanus
emb|CCI48184.1|  unnamed protein product                                263   1e-84    Albugo candida
ref|XP_002559377.1|  Pc13g09540                                         263   2e-84    Penicillium rubens Wisconsin 54-1255
ref|XP_011151114.1|  PREDICTED: proteasome subunit alpha type-6-like    263   2e-84    Harpegnathos saltator
gb|EPS29950.1|  hypothetical protein PDE_04900                          263   2e-84    Penicillium oxalicum 114-2
gb|EMF14550.1|  N-terminal nucleophile aminohydrolase                   263   3e-84    Sphaerulina musiva SO2202
ref|XP_005987928.1|  PREDICTED: proteasome subunit alpha type-6-l...    262   3e-84    Latimeria chalumnae
ref|XP_002480335.1|  proteasome component Prs2, putative                262   3e-84    Talaromyces stipitatus ATCC 10500
ref|XP_002143952.1|  proteasome component Prs2, putative                262   3e-84    Talaromyces marneffei ATCC 18224
tpe|CBF76587.1|  TPA: proteasome core alpha 1 component (Eurofung)      262   4e-84    Aspergillus nidulans FGSC A4
ref|XP_003216618.1|  PREDICTED: proteasome subunit alpha type-6         262   4e-84    Anolis carolinensis [Carolina anole]
ref|XP_002463176.1|  hypothetical protein SORBIDRAFT_02g039140          261   5e-84    
ref|XP_006117859.1|  PREDICTED: proteasome subunit alpha type-6         261   6e-84    
ref|XP_002411749.1|  proteasome subunit alpha type, putative            261   1e-83    Ixodes scapularis [blacklegged tick]
ref|XP_003706429.1|  PREDICTED: proteasome subunit alpha type-6-like    261   1e-83    Megachile rotundata
gb|ACI70015.1|  Proteasome subunit alpha type-6                         261   1e-83    Salmo salar
emb|CDQ77351.1|  unnamed protein product                                260   1e-83    Oncorhynchus mykiss
ref|XP_011329096.1|  PREDICTED: proteasome subunit alpha type-6-like    260   2e-83    Ooceraea biroi
ref|XP_011054784.1|  PREDICTED: proteasome subunit alpha type-6-like    260   2e-83    
emb|CDQ88726.1|  unnamed protein product                                260   2e-83    
gb|EHK16557.1|  hypothetical protein TRIVIDRAFT_75344                   260   3e-83    
gb|ACM09335.1|  Proteasome subunit alpha type-6                         260   3e-83    
ref|XP_001271130.1|  predicted protein                                  260   3e-83    
gb|EPE09739.1|  proteasome subunit alpha type 6                         260   3e-83    
ref|XP_005350320.1|  PREDICTED: proteasome subunit alpha type-6-like    258   3e-83    
ref|XP_001796064.1|  hypothetical protein SNOG_05667                    260   3e-83    
ref|XP_007731114.1|  proteasome subunit alpha type-6                    260   3e-83    
ref|XP_003449352.1|  PREDICTED: proteasome subunit alpha type-6-like    259   4e-83    
ref|XP_008712166.1|  hypothetical protein HMPREF1541_09269              259   5e-83    
ref|XP_003393493.1|  PREDICTED: proteasome subunit alpha type-6-like    259   6e-83    
gb|ACI66670.1|  Proteasome subunit alpha type-6                         258   6e-83    
ref|XP_007068323.1|  PREDICTED: proteasome subunit alpha type-6-like    259   6e-83    
ref|XP_002841029.1|  hypothetical protein                               259   7e-83    
ref|XP_001607854.1|  PREDICTED: proteasome subunit alpha type-6-like    259   7e-83    
ref|XP_011494157.1|  PREDICTED: proteasome subunit alpha type-6-like    259   8e-83    
gb|ACI69799.1|  Proteasome subunit alpha type-6                         257   9e-83    
dbj|GAM85636.1|  hypothetical protein ANO11243_036430                   259   9e-83    
ref|XP_006801196.1|  PREDICTED: proteasome subunit alpha type-6-l...    258   9e-83    
gb|KFM81155.1|  Proteasome subunit alpha type-6                         258   9e-83    
ref|XP_001843247.1|  proteasome subunit alpha type 6                    258   9e-83    
ref|XP_004075507.1|  PREDICTED: proteasome subunit alpha type-6-like    258   1e-82    
ref|XP_006963196.1|  proteasome subunit alpha 6                         259   1e-82    
ref|XP_009158794.1|  proteasome subunit alpha type-6                    259   1e-82    
ref|XP_011167410.1|  PREDICTED: proteasome subunit alpha type-6-like    258   1e-82    
gb|EME46261.1|  hypothetical protein DOTSEDRAFT_70305                   258   1e-82    
ref|XP_006696698.1|  hypothetical protein CTHT_0063920                  258   1e-82    
gb|EFX02870.1|  proteasome subunit alpha type 6                         258   1e-82    
gb|KFB46736.1|  AGAP003935-PA-like protein                              258   1e-82    
ref|XP_008543695.1|  PREDICTED: proteasome subunit alpha type-6-like    258   1e-82    
gb|EHK40697.1|  hypothetical protein TRIATDRAFT_301498                  258   2e-82    
ref|XP_009222727.1|  proteasome subunit alpha type-6                    258   2e-82    
ref|XP_005293216.1|  PREDICTED: proteasome subunit alpha type-6-l...    258   2e-82    
ref|XP_003697298.1|  PREDICTED: proteasome subunit alpha type-6-like    258   2e-82    
gb|EFX71218.1|  proteasome subunit alpha type 6-like protein            258   2e-82    
gb|KIW74909.1|  hypothetical protein Z517_11680                         258   2e-82    
ref|NP_001187798.1|  proteasome subunit alpha type-6                    257   2e-82    
ref|XP_004997606.1|  proteasome subunit alpha type-6                    257   2e-82    
gb|EFZ13292.1|  hypothetical protein SINV_14495                         258   3e-82    
gb|KIW87420.1|  hypothetical protein Z519_12056                         258   3e-82    
ref|XP_006658809.1|  PREDICTED: proteasome subunit alpha type-6-like    258   3e-82    
gb|KIX01010.1|  hypothetical protein Z518_10076                         257   3e-82    
ref|XP_318387.2|  AGAP003935-PA                                         257   4e-82    
ref|XP_001654091.1|  AAEL009898-PA                                      257   4e-82    
ref|XP_006608469.1|  PREDICTED: proteasome subunit alpha type-6-like    257   4e-82    
ref|XP_002679314.1|  predicted protein                                  257   4e-82    
ref|XP_005099053.1|  PREDICTED: proteasome subunit alpha type-6-like    256   5e-82    
ref|XP_002741353.1|  PREDICTED: proteasome subunit alpha type-6-like    256   6e-82    
gb|ETN58251.1|  proteasome subunit alpha type 6                         256   6e-82    
gb|KIL96483.1|  hypothetical protein FAVG1_01227                        256   6e-82    
ref|XP_007741776.1|  20S proteasome subunit alpha 1                     257   7e-82    
ref|XP_001819832.1|  proteasome subunit alpha type-6                    256   7e-82    
gb|ADO27866.1|  proteasome subunit alpha type-6                         256   8e-82    
gb|KIW28395.1|  hypothetical protein PV07_08062                         256   8e-82    
ref|XP_007719836.1|  proteasome subunit alpha type-6                    256   8e-82    
ref|XP_010896958.1|  PREDICTED: proteasome subunit alpha type-6-l...    256   8e-82    
ref|XP_011120711.1|  hypothetical protein AOL_s00075g98                 256   9e-82    
gb|KIV96436.1|  hypothetical protein PV10_00308                         256   9e-82    
ref|XP_011259025.1|  PREDICTED: proteasome subunit alpha type-6-like    256   1e-81    
ref|XP_011319207.1|  proteasome component C7-alpha                      256   1e-81    
ref|XP_009255010.1|  hypothetical protein FPSE_03616                    256   1e-81    
gb|EGU87091.1|  hypothetical protein FOXB_02485                         256   1e-81    
gb|KIW08744.1|  hypothetical protein PV09_00682                         256   1e-81    
ref|XP_662473.1|  hypothetical protein AN4869.2                         256   2e-81    
ref|XP_007796832.1|  putative proteasome subunit alpha type 6 pro...    256   2e-81    
gb|KEQ76497.1|  proteasome core particle subunit alpha 1                255   2e-81    
gb|KFY28594.1|  hypothetical protein V493_02857                         255   2e-81    
ref|XP_002850566.1|  proteasome subunit alpha type 6                    256   2e-81    
ref|XP_001244388.1|  hypothetical protein CIMG_03829                    255   2e-81    
gb|KIW69429.1|  hypothetical protein PV04_05306                         255   2e-81    
emb|CEJ93046.1|  Putative Proteasome subunit alpha type                 255   2e-81    
ref|XP_007926644.1|  hypothetical protein MYCFIDRAFT_188442             255   2e-81    
gb|KEQ92672.1|  hypothetical protein AUEXF2481DRAFT_31918               255   2e-81    
gb|KFY37296.1|  hypothetical protein V495_07258                         255   3e-81    
ref|XP_001749972.1|  hypothetical protein                               254   3e-81    
ref|XP_003717769.1|  proteasome subunit alpha type-6                    255   3e-81    
ref|XP_008724612.1|  hypothetical protein G647_10399                    254   3e-81    
ref|XP_007756206.1|  proteasome subunit alpha type-6                    254   3e-81    
ref|XP_007680618.1|  hypothetical protein BAUCODRAFT_126149             256   4e-81    
gb|KEQ85758.1|  proteasome core particle subunit alpha 1                254   4e-81    
gb|EKG12338.1|  Proteasome alpha-subunit conserved site                 254   4e-81    
emb|CEF75633.1|  unnamed protein product                                254   4e-81    
dbj|GAD99016.1|  predicted protein                                      257   5e-81    
gb|KFX91072.1|  hypothetical protein V490_06088                         254   5e-81    
gb|KFA67907.1|  hypothetical protein S40285_04100                       254   5e-81    
gb|EQL00512.1|  proteasome subunit alpha type 6                         254   5e-81    
gb|KDB16148.1|  proteasome subunit alpha type 6                         254   5e-81    
ref|XP_007912348.1|  putative proteasome subunit alpha type 6 pro...    254   6e-81    
ref|XP_007807465.1|  proteasome subunit alpha type 6                    254   6e-81    
ref|XP_003051118.1|  predicted protein                                  254   6e-81    
gb|KID80249.1|  proteasome subunit alpha type 6                         254   7e-81    
gb|KFY99093.1|  hypothetical protein V500_01465                         254   7e-81    
gb|KFG86753.1|  proteasome subunit alpha type 6                         254   8e-81    
ref|XP_007586723.1|  putative proteasome subunit alpha type-6 pro...    254   8e-81    
ref|XP_007821798.1|  Proteasome A-type subunit                          254   8e-81    
gb|KID99895.1|  proteasome subunit alpha type 6                         254   8e-81    
ref|XP_003857582.1|  proteasome core particle subunit alpha 1           254   9e-81    
gb|EPQ67273.1|  hypothetical protein BGT96224_A21417                    254   9e-81    
gb|KFH45227.1|  Proteasome subunit alpha-like protein                   254   9e-81    
gb|EMT05329.1|  Proteasome subunit alpha type-6                         254   1e-80    
emb|CCG84721.1|  protein of unknown function                            253   1e-80    
gb|KEQ62212.1|  proteasome core particle subunit alpha 1                253   1e-80    
ref|XP_003649967.1|  hypothetical protein THITE_2109162                 253   1e-80    
gb|KFY13879.1|  hypothetical protein V492_03002                         253   1e-80    
gb|KFY66093.1|  hypothetical protein V496_02185                         253   1e-80    
gb|ELR02822.1|  20S proteasome subunit alpha 1                          253   2e-80    
ref|XP_007295783.1|  proteasome subunit alpha type 6                    253   2e-80    
ref|XP_003662349.1|  hypothetical protein MYCTH_2302907                 253   2e-80    
ref|XP_003177216.1|  proteasome subunit alpha type-6                    253   2e-80    
ref|XP_011396415.1|  Proteasome subunit alpha type-6                    251   2e-80    
gb|KDN66300.1|  putative proteasome A-type and B-type                   253   2e-80    
gb|EZG02619.1|  hypothetical protein H106_07457                         253   2e-80    
gb|EFA79004.1|  proteasome subunit alpha type 6                         252   2e-80    
ref|XP_001224606.1|  conserved hypothetical protein                     253   2e-80    
dbj|GAM19752.1|  hypothetical protein SAMD00019534_029270               252   3e-80    
gb|EFQ28985.1|  proteasome A-type and B-type                            252   3e-80    
ref|XP_008307633.1|  PREDICTED: proteasome subunit alpha type-6-like    252   3e-80    
emb|CCE29503.1|  probable SCL1-20S proteasome subunit YC7ALPHA/Y8...    252   3e-80    
ref|XP_001912148.1|  hypothetical protein                               252   3e-80    
gb|KFH62604.1|  proteasome subunit alpha type-6                         252   4e-80    
gb|EZF34225.1|  hypothetical protein H101_02239                         252   4e-80    
emb|CCF38339.1|  proteasome A-type and B-type                           252   4e-80    
gb|ERS99418.1|  hypothetical protein HMPREF1624_04618                   252   4e-80    
gb|KDB22734.1|  hypothetical protein H109_05356                         252   4e-80    
gb|KFA73659.1|  hypothetical protein S40288_07644                       253   4e-80    
gb|KEY66092.1|  hypothetical protein S7711_09211                        253   4e-80    
gb|KIW43338.1|  hypothetical protein PV06_04450                         252   5e-80    
gb|KGQ11560.1|  Proteasome subunit alpha type-6                         251   6e-80    
ref|XP_008599361.1|  proteasome A-type and B-type                       251   6e-80    
gb|KGO72988.1|  Proteasome A-type subunit                               252   9e-80    
ref|XP_002623465.1|  proteasome component C7-alpha                      251   9e-80    
ref|XP_007601883.1|  proteasome A-type and B-type                       251   9e-80    
ref|NP_001060261.1|  Os07g0614100                                       251   1e-79    
ref|XP_003286860.1|  proteasome subunit alpha type 6                    250   1e-79    
gb|EWM25954.1|  proteasome subunit alpha type-6                         251   1e-79    
ref|XP_010755906.1|  hypothetical protein PADG_00615                    251   1e-79    
ref|XP_001213840.1|  proteasome subunit alpha type 6                    262   1e-79    
gb|EEH39752.2|  proteasome component C7-alpha                           251   1e-79    
ref|XP_007833194.1|  Proteasome subunit alpha type-6                    251   1e-79    
emb|CCC12323.1|  unnamed protein product                                250   2e-79    
ref|XP_007234010.1|  PREDICTED: proteasome subunit alpha type-6-like    249   2e-79    
ref|XP_957907.1|  proteasome subunit alpha type 6                       250   3e-79    
gb|KIN06410.1|  hypothetical protein OIDMADRAFT_141988                  249   3e-79    
ref|XP_005177054.1|  PREDICTED: proteasome subunit alpha type-6         249   3e-79    
ref|XP_009649783.1|  proteasome subunit alpha type-6-A                  249   4e-79    
emb|CBN08618.1|  proteasome (prosome, macropain) subunit, alpha t...    249   4e-79    
gb|EEE67584.1|  hypothetical protein OsJ_25116                          248   5e-79    
gb|KHN94324.1|  proteasome subunit alpha type 6                         249   7e-79    
emb|CAK44248.1|  unnamed protein product                                248   8e-79    
gb|ENH81729.1|  proteasome subunit alpha type 6                         248   1e-78    
gb|EQB51932.1|  proteasome A-type and B-type                            249   1e-78    
gb|EEH04842.1|  proteasome subunit alpha                                248   1e-78    
gb|ABM55423.1|  proteasome subunit alpha type 6-like protein            248   1e-78    
ref|XP_001548586.1|  conserved hypothetical protein                     248   2e-78    
ref|XP_001399838.2|  proteasome subunit alpha type-6                    248   2e-78    
ref|XP_003008821.1|  proteasome subunit alpha type-6-B                  248   2e-78    
ref|XP_007778661.1|  proteasome subunit alpha type-6                    247   2e-78    
ref|XP_006665767.1|  proteasome subunit alpha type 6                    247   3e-78    
dbj|GAA88851.1|  proteasome subunit alpha type 6                        247   3e-78    
ref|XP_002796053.1|  proteasome component C7-alpha                      249   3e-78    
ref|XP_005243955.1|  PREDICTED: proteasome subunit alpha type-6         247   5e-78    
ref|XP_008085140.1|  N-terminal nucleophile aminohydrolases (Ntn ...    246   7e-78    
ref|XP_010739538.1|  PREDICTED: proteasome subunit alpha type-6-like    246   9e-78    
gb|KGR10582.1|  20S proteasome subunit alpha 1                          245   1e-77    
emb|CBJ30371.1|  conserved unknown protein                              245   1e-77    
ref|XP_001436316.1|  hypothetical protein                               245   1e-77    
gb|KHJ35771.1|  putative proteasome subunit alpha type 6                245   1e-77    
gb|EEC82437.1|  hypothetical protein OsI_26853                          244   2e-77    
ref|XP_002427127.1|  proteasome subunit alpha type, putative            245   2e-77    
gb|KEZ38816.1|  hypothetical protein SAPIO_CDS10856                     245   2e-77    
ref|XP_717661.1|  hypothetical protein CaO19.12833                      244   4e-77    
emb|CCD44572.1|  similar to proteasome subunit alpha type 6             243   5e-77    
ref|XP_717755.1|  hypothetical protein CaO19.5378                       244   5e-77    
gb|KHC64481.1|  20S proteasome subunit alpha 1                          244   6e-77    
gb|EHB05850.1|  Proteasome subunit alpha type-6                         243   7e-77    
ref|XP_002551204.1|  proteasome component C7-alpha                      244   8e-77    
gb|KHC80025.1|  20S proteasome subunit alpha 1                          243   9e-77    
ref|XP_501500.1|  YALI0C06039p                                          243   9e-77    
ref|XP_002419018.1|  alpha subunit of the 20S core complex of the...    243   1e-76    
ref|XP_642003.1|  proteasome subunit alpha type 6                       243   1e-76    
ref|XP_004535732.1|  PREDICTED: proteasome subunit alpha type-6-l...    243   2e-76    
ref|NP_595374.1|  20S proteasome component alpha 1 (predicted)          242   2e-76    
ref|XP_005804586.1|  PREDICTED: proteasome subunit alpha type-6-like    242   2e-76    
gb|ESZ92951.1|  proteasome subunit alpha type 6                         242   3e-76    
gb|KDO64985.1|  hypothetical protein CISIN_1g025897mg                   239   3e-76    
ref|XP_002127869.1|  PREDICTED: proteasome subunit alpha type-6-l...    243   3e-76    
gb|EMG46214.1|  Proteasome component C7-alpha                           242   3e-76    
ref|XP_007577895.1|  PREDICTED: proteasome subunit alpha type-6-like    242   3e-76    
gb|KIV82702.1|  hypothetical protein PV11_04792                         242   3e-76    
ref|XP_002374646.1|  proteasome component Prs2, putative                254   3e-76    
ref|XP_005751769.1|  PREDICTED: proteasome subunit alpha type-6-like    241   4e-76    
emb|CAG06433.1|  unnamed protein product                                241   4e-76    
ref|XP_001383008.1|  hypothetical protein PICST_41423                   241   4e-76    
ref|XP_004562835.1|  PREDICTED: proteasome subunit alpha type-6-like    241   5e-76    
gb|KIM60812.1|  hypothetical protein SCLCIDRAFT_1216527                 242   6e-76    
gb|KDQ65121.1|  hypothetical protein JAAARDRAFT_28780                   241   6e-76    
ref|XP_009860960.1|  PREDICTED: proteasome subunit alpha type-6-l...    241   6e-76    
ref|XP_008424335.1|  PREDICTED: proteasome subunit alpha type-6-like    241   6e-76    
gb|KFQ96181.1|  Proteasome subunit alpha type-6                         240   7e-76    
ref|XP_003026186.1|  hypothetical protein SCHCODRAFT_79949              241   7e-76    
gb|EYE94645.1|  N-terminal nucleophile aminohydrolase                   253   7e-76    
gb|AGM32386.1|  proteasome subunit alpha type-6                         241   8e-76    
ref|XP_002159995.1|  PREDICTED: proteasome subunit alpha type-6-like    240   1e-75    
ref|XP_010235676.1|  PREDICTED: proteasome subunit alpha type-6-l...    241   1e-75    
ref|XP_008353690.1|  PREDICTED: proteasome subunit alpha type-6         236   1e-75    
ref|XP_968655.1|  PREDICTED: proteasome subunit alpha type-6            240   1e-75    
ref|XP_001730989.1|  hypothetical protein MGL_1988                      241   1e-75    
gb|EPS95905.1|  hypothetical protein FOMPIDRAFT_1131639                 241   1e-75    
ref|XP_004584816.1|  PREDICTED: proteasome subunit alpha type-6         240   2e-75    
gb|EJK49516.1|  hypothetical protein THAOC_31602                        244   2e-75    
ref|XP_456708.1|  DEHA2A08734p                                          239   2e-75    
gb|KDR14657.1|  Proteasome subunit alpha type-6                         239   2e-75    
emb|CCU98368.1|  unnamed protein product                                241   2e-75    
gb|KFQ31740.1|  Proteasome subunit alpha type-6                         239   2e-75    
gb|KFZ47806.1|  Proteasome subunit alpha type-6                         239   2e-75    
ref|XP_007315239.1|  hypothetical protein SERLADRAFT_460060             240   2e-75    
ref|XP_003323788.2|  proteasome subunit alpha type-6                    239   3e-75    
ref|XP_002296891.1|  26S proteasome subunit                             239   3e-75    
ref|XP_007417761.1|  hypothetical protein MELLADRAFT_79569              239   3e-75    
gb|KFO63713.1|  Proteasome subunit alpha type-6                         238   4e-75    



>ref|XP_009631638.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana tomentosiformis]
Length=246

 Score =   419 bits (1077),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>ref|XP_009797939.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana sylvestris]
 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Nicotiana tabacum]
 emb|CAB39975.1| PRCI [Nicotiana tabacum]
Length=246

 Score =   419 bits (1077),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>ref|XP_011098408.1| PREDICTED: proteasome subunit alpha type-6 [Sesamum indicum]
Length=246

 Score =   417 bits (1073),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>gb|KDP33929.1| hypothetical protein JCGZ_07500 [Jatropha curcas]
Length=246

 Score =   417 bits (1071),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQS+
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSI  205



>gb|KHG01950.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=246

 Score =   417 bits (1071),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>gb|KJB65226.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=246

 Score =   416 bits (1070),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>gb|EYU19318.1| hypothetical protein MIMGU_mgv1a012555mg [Erythranthe guttata]
Length=246

 Score =   416 bits (1070),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 197/205 (96%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP DVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPADVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSY+ETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSV  205



>ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 [Vitis vinifera]
 emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera]
 emb|CBI35851.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   416 bits (1070),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGID+E GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDDENGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSY+ETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSV  205



>gb|KJB82986.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=246

 Score =   416 bits (1069),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>ref|XP_007012615.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
 gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
Length=246

 Score =   416 bits (1069),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+PVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>gb|KDP45827.1| hypothetical protein JCGZ_17434 [Jatropha curcas]
Length=246

 Score =   416 bits (1069),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVT+LFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTNLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQS+
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSI  205



>ref|XP_010269878.1| PREDICTED: proteasome subunit alpha type-6-like [Nelumbo nucifera]
Length=246

 Score =   415 bits (1066),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRP GV AMILGIDEE GPQLFKCDPAGHFFGHKATS G+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPFGVAAMILGIDEENGPQLFKCDPAGHFFGHKATSVGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>ref|XP_011099933.1| PREDICTED: proteasome subunit alpha type-6-like [Sesamum indicum]
Length=246

 Score =   414 bits (1065),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFS++ETVQTAISALQSV
Sbjct  181  KKMKNDPAFSFDETVQTAISALQSV  205



>ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6 [Solanum lycopersicum]
 ref|XP_006345264.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum tuberosum]
Length=246

 Score =   414 bits (1064),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMP DVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPADVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKN+PAFSYEETVQT ISALQSV
Sbjct  181  KKMKNNPAFSYEETVQTTISALQSV  205



>gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum]
Length=246

 Score =   414 bits (1064),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>ref|XP_009380029.1| PREDICTED: proteasome subunit alpha type-6 [Musa acuminata subsp. 
malaccensis]
Length=246

 Score =   413 bits (1062),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>ref|XP_006381605.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
 ref|XP_011039970.1| PREDICTED: proteasome subunit alpha type-6 [Populus euphratica]
 gb|ERP59402.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
Length=246

 Score =   413 bits (1061),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPA SYEETVQTAISALQSV
Sbjct  181  KKMKNDPALSYEETVQTAISALQSV  205



>ref|XP_009404175.1| PREDICTED: proteasome subunit alpha type-6-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   413 bits (1061),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATGITADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGITADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLG+VAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGIVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQ AISALQSV
Sbjct  181  KKMKNDPAFSYEETVQIAISALQSV  205



>ref|XP_010274570.1| PREDICTED: proteasome subunit alpha type-6 [Nelumbo nucifera]
Length=246

 Score =   413 bits (1061),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLF +TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFAITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGV AM+LGIDEE GPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVAAMVLGIDEENGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>emb|CDP03072.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   412 bits (1059),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 201/204 (99%), Gaps = 0/204 (0%)
 Frame = +3

Query  57   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  236
            SRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  3    SRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  62

Query  237  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  416
            DQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF++GYEMPVD LA+WIADK
Sbjct  63   DQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKFGYEMPVDTLAKWIADK  122

Query  417  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEK  596
            SQVYTQHAYMRPLGVVAMILGIDEE GPQLFKCDPAGHFFGHKATSAG K+QEAINFLEK
Sbjct  123  SQVYTQHAYMRPLGVVAMILGIDEEAGPQLFKCDPAGHFFGHKATSAGAKDQEAINFLEK  182

Query  597  KMKNDPAFSYEETVQTAISALQSV  668
            KMKNDPAFSYEETVQTAISALQSV
Sbjct  183  KMKNDPAFSYEETVQTAISALQSV  206



>gb|KJB65225.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=247

 Score =   412 bits (1058),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 204/206 (99%), Gaps = 1/206 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK-ATSAGVKEQEAINFL  590
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHK ATSAG KEQEAINFL
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKVATSAGSKEQEAINFL  180

Query  591  EKKMKNDPAFSYEETVQTAISALQSV  668
            EKKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  EKKMKNDPAFTYEETVQTAISALQSV  206



>gb|KJB82987.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=247

 Score =   412 bits (1058),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 204/206 (99%), Gaps = 1/206 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK-ATSAGVKEQEAINFL  590
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHK ATSAG KEQEAINFL
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKVATSAGSKEQEAINFL  180

Query  591  EKKMKNDPAFSYEETVQTAISALQSV  668
            EKKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  EKKMKNDPAFTYEETVQTAISALQSV  206



>ref|XP_008228175.1| PREDICTED: proteasome subunit alpha type-6 [Prunus mume]
Length=246

 Score =   411 bits (1056),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP F+Y+ETVQTAISALQSV
Sbjct  181  KKMKNDPLFTYDETVQTAISALQSV  205



>ref|XP_007215872.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
 gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
Length=246

 Score =   410 bits (1055),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP F+Y+ETVQTAISALQSV
Sbjct  181  KKMKNDPLFTYDETVQTAISALQSV  205



>gb|ABK96399.1| unknown [Populus trichocarpa x Populus deltoides]
Length=246

 Score =   410 bits (1054),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+K DPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKSDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPA SYEETVQTAISALQSV
Sbjct  181  KKMKNDPALSYEETVQTAISALQSV  205



>ref|XP_008782714.1| PREDICTED: proteasome subunit alpha type-6 [Phoenix dactylifera]
Length=246

 Score =   410 bits (1053),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPLTKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>ref|XP_008802476.1| PREDICTED: proteasome subunit alpha type-6-like [Phoenix dactylifera]
Length=246

 Score =   409 bits (1052),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP F YEETVQTAISALQSV
Sbjct  181  KKMKNDPKFLYEETVQTAISALQSV  205



>gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea]
Length=246

 Score =   409 bits (1051),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLF VTKYLGLL TGITADARTLVQQARN+AA+FRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFHVTKYLGLLTTGITADARTLVQQARNKAADFRFRYGYEMPVDVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLG++AM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGIIAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGSKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>ref|XP_006592586.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max]
 gb|KHN16010.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=246

 Score =   408 bits (1049),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+YEETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSV  205



>ref|XP_010064020.1| PREDICTED: proteasome subunit alpha type-6 [Eucalyptus grandis]
 gb|KCW71315.1| hypothetical protein EUGRSUZ_F04398 [Eucalyptus grandis]
Length=246

 Score =   408 bits (1048),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFR GYEMPVD LA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRNGYEMPVDALAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GP+L+KCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPRLYKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSY+ETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSV  205



>ref|XP_002323091.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|ABK93034.1| unknown [Populus trichocarpa]
 gb|EEF04852.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   407 bits (1047),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPA SYEETVQTAISALQSV
Sbjct  181  KKMKNDPALSYEETVQTAISALQSV  205



>ref|XP_010937324.1| PREDICTED: proteasome subunit alpha type-6 [Elaeis guineensis]
Length=246

 Score =   407 bits (1047),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFGHKATS+G+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFGHKATSSGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP FSYEETVQTAISALQSV
Sbjct  181  KKMKNDPKFSYEETVQTAISALQSV  205



>ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Cicer 
arietinum]
 ref|XP_004488481.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Cicer 
arietinum]
 ref|XP_004488482.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Cicer 
arietinum]
Length=246

 Score =   407 bits (1047),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR +YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH++GHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYYGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+YEETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSV  205



>ref|XP_006842706.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
 gb|ERN04381.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
Length=246

 Score =   407 bits (1046),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQAR+EAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARHEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLG+ AM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGIAAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQT ISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTTISALQSV  205



>gb|KJB82988.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=244

 Score =   407 bits (1045),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 2/205 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK--DKL  58

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  59   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  118

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  178

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  179  KKMKNDPAFTYEETVQTAISALQSV  203



>ref|XP_009344472.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
 ref|XP_009344473.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
Length=246

 Score =   407 bits (1045),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEELGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKN+P+FSY+ETVQT ISALQSV
Sbjct  181  KKMKNEPSFSYDETVQTCISALQSV  205



>ref|XP_008391412.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=246

 Score =   407 bits (1045),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEVGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKN+P+FSY+ETVQT ISALQSV
Sbjct  181  KKMKNEPSFSYDETVQTCISALQSV  205



>ref|XP_011001657.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
 ref|XP_011015647.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   407 bits (1045),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPA SYEETVQTAISALQSV
Sbjct  181  KKMKNDPALSYEETVQTAISALQSV  205



>ref|XP_007133143.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
 gb|ESW05137.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
Length=246

 Score =   406 bits (1044),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF  GYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTNGYEMPVDVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK DPAF+YEETVQTAISALQSV
Sbjct  181  KKMKGDPAFTYEETVQTAISALQSV  205



>ref|XP_008462289.1| PREDICTED: proteasome subunit alpha type-6 [Cucumis melo]
Length=246

 Score =   406 bits (1044),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAA+FRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAADFRFRYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>gb|ACJ85916.1| unknown [Medicago truncatula]
 gb|AFK46669.1| unknown [Medicago truncatula]
 gb|KEH19590.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
Length=246

 Score =   406 bits (1043),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATGITADARTLVQQARNEAAE+RFRYGYEMPVDVL++W+AD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGITADARTLVQQARNEAAEYRFRYGYEMPVDVLSKWVAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDELGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+Y ETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYAETVQTAISALQSV  205



>ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   406 bits (1043),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+G+TSIGV GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGVTSIGVCGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+YEETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSV  205



>gb|ADJ95344.1| PAA1 [Carica papaya]
Length=246

 Score =   405 bits (1042),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+GHKATSAG K+QEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYGHKATSAGSKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>ref|XP_010557672.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
 ref|XP_010557673.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   405 bits (1041),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SV+HLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVSHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK++P F+Y ETVQTAISALQSV
Sbjct  181  KKMKDNPTFTYNETVQTAISALQSV  205



>ref|XP_006474716.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Citrus 
sinensis]
 gb|KDO73881.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=246

 Score =   405 bits (1041),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTA+SALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAVSALQSV  205



>ref|XP_010541996.1| PREDICTED: proteasome subunit alpha type-6-B [Tarenaya hassleriana]
Length=246

 Score =   405 bits (1041),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATS G+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSVGMKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|XP_002308263.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|EEE91786.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   405 bits (1040),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+ SYEETVQTAISALQSV
Sbjct  181  KKMKNDPSLSYEETVQTAISALQSV  205



>ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 gb|KGN45477.1| hypothetical protein Csa_7G448880 [Cucumis sativus]
Length=246

 Score =   405 bits (1040),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+G+DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGRDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAAEFRFQYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKNDPAFTYDETVQTAISALQSV  205



>ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max]
 sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1; AltName: Full=Proteasome iota subunit [Glycine 
max]
 gb|AAC28135.1| proteasome IOTA subunit [Glycine max]
Length=246

 Score =   404 bits (1039),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGY+RHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVT KKVPDKL
Sbjct  1    MSRGSGGGYNRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTHKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+YEETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSV  205



>gb|ABK95322.1| unknown [Populus trichocarpa]
Length=246

 Score =   404 bits (1039),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRY YEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYWYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPA SYEETVQTAISALQSV
Sbjct  181  KKMKNDPALSYEETVQTAISALQSV  205



>gb|AFK47610.1| unknown [Lotus japonicus]
Length=246

 Score =   404 bits (1038),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+YEETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSV  205



>ref|XP_011018964.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   404 bits (1037),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV+HLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVSHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+ SYEETVQTAISALQSV
Sbjct  181  KKMKNDPSLSYEETVQTAISALQSV  205



>ref|XP_010441957.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X1 
[Camelina sativa]
 ref|XP_010441958.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X2 
[Camelina sativa]
Length=246

 Score =   404 bits (1037),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVTHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|XP_006465892.1| PREDICTED: proteasome subunit alpha type-6-like [Citrus sinensis]
 gb|KDO64976.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=246

 Score =   403 bits (1036),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+++ETVQTAIS LQSV
Sbjct  181  KKMKNDPAFTFQETVQTAISTLQSV  205



>ref|XP_003595788.1| Proteasome subunit alpha type [Medicago truncatula]
 gb|AES66039.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
 gb|AFK48993.1| unknown [Medicago truncatula]
Length=246

 Score =   403 bits (1035),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+Y+ETVQTAI+ALQSV
Sbjct  181  KKMKNDPSFTYDETVQTAIAALQSV  205



>gb|ACU24622.1| unknown [Glycine max]
Length=246

 Score =   403 bits (1035),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYE+PVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEIPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGLQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+YEETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSV  205



>gb|AFK46801.1| unknown [Medicago truncatula]
Length=246

 Score =   403 bits (1035),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+Y+ETVQTAI+ALQSV
Sbjct  181  KKMKNDPSFTYDETVQTAIAALQSV  205



>ref|XP_010939895.1| PREDICTED: proteasome subunit alpha type-6-like [Elaeis guineensis]
Length=246

 Score =   401 bits (1031),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKATGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEF F++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFHFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLG+VAMILGIDEEKGPQL KCDPAGHFFGHKATSAGVKEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGLVAMILGIDEEKGPQLLKCDPAGHFFGHKATSAGVKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP FSY ETVQTAISALQSV
Sbjct  181  KKMKNDPKFSYGETVQTAISALQSV  205



>gb|KHG04433.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=226

 Score =   400 bits (1029),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAI  650
            KKMKNDPAF+YEETVQ  +
Sbjct  181  KKMKNDPAFTYEETVQVGV  199



>ref|XP_010533014.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   401 bits (1031),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLF +TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFQITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATS G+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSVGMKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|XP_004303706.1| PREDICTED: proteasome subunit alpha type-6 [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   401 bits (1030),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TK+LGLLATG+TADARTLV QARNEAA+FRF+ GYEMPVDVLA WIA+
Sbjct  61   LDQSSVTHLFPITKFLGLLATGMTADARTLVSQARNEAADFRFKNGYEMPVDVLANWIAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LG+DEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEETGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+Y+ETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYDETVQTAISALQSV  205



>gb|ACJ85912.1| unknown [Medicago truncatula]
Length=246

 Score =   400 bits (1029),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVAHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+Y+ETVQTAI+ALQSV
Sbjct  181  KKMKNDPSFTYDETVQTAIAALQSV  205



>gb|ACN66752.1| PAA1 [Carica papaya]
Length=246

 Score =   400 bits (1029),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVV QKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVPQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEA EFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEATEFRFRYGYEMPVDALAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+GHKATSAG K+QEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYGHKATSAGSKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSV  205



>ref|XP_010494382.1| PREDICTED: proteasome subunit alpha type-6-B [Camelina sativa]
Length=246

 Score =   400 bits (1028),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SV+HLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|XP_010666851.1| PREDICTED: proteasome subunit alpha type-6 [Beta vulgaris subsp. 
vulgaris]
Length=246

 Score =   400 bits (1027),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK++GITSI VRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKSSGITSIAVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV+HLF VTKYLGLLATG+TADAR LVQQARNEAAEFR +YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVSHLFQVTKYLGLLATGMTADARNLVQQARNEAAEFRHKYGYEMPVDVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP LFKCDPAGHF+GHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLFKCDPAGHFYGHKATSAGAKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSY+ETVQTAISALQSV
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSV  205



>ref|NP_001031340.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AEC05980.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=220

 Score =   399 bits (1024),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|NP_178641.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 ref|XP_002883713.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O81147.1|PSA6B_ARATH RecName: Full=Proteasome subunit alpha type-6-B; AltName: Full=20S 
proteasome subunit alpha A-2; AltName: Full=Proteasome 
subunit alpha type-1 [Arabidopsis thaliana]
 gb|AAC32055.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AAC95161.1| 20S proteasome alpha subunit A2 (PAA2) [Arabidopsis thaliana]
 gb|AAK96583.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|AAN28768.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|EFH59972.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC05979.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=246

 Score =   399 bits (1025),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>gb|AFK46380.1| unknown [Lotus japonicus]
Length=246

 Score =   399 bits (1025),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGV GKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVCGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSV+HLFP+TKYLGLLATG+TADARTL QQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLAQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+YEETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSV  205



>gb|KHN46954.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=560

 Score =   410 bits (1053),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP+F+YEETVQTAISALQSV
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSV  205



>ref|XP_009102355.1| PREDICTED: proteasome subunit alpha type-6-B [Brassica rapa]
 emb|CDY33398.1| BnaA07g04410D [Brassica napus]
 emb|CDY18045.1| BnaC07g04250D [Brassica napus]
Length=246

 Score =   398 bits (1023),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|XP_006396131.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
 gb|ESQ36910.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
Length=246

 Score =   398 bits (1022),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>gb|KFK32243.1| hypothetical protein AALP_AA6G216400 [Arabis alpina]
Length=246

 Score =   396 bits (1017),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +SV+HLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDASSVSHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFSYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|XP_006474717.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Citrus 
sinensis]
 gb|KDO73882.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=244

 Score =   395 bits (1016),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 197/205 (96%), Gaps = 2/205 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKK--DKL  58

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  59   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  118

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  178

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAFSYEETVQTA+SALQSV
Sbjct  179  KKMKNDPAFSYEETVQTAVSALQSV  203



>ref|XP_002516258.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF46260.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   395 bits (1016),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA +TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV+AM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVIAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKND AF+YEETVQTAISALQSV
Sbjct  181  KKMKNDRAFTYEETVQTAISALQSV  205



>ref|XP_009136197.1| PREDICTED: proteasome subunit alpha type-6-B-like [Brassica rapa]
Length=246

 Score =   395 bits (1016),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KKMKENPAFTYDETVQTAISALQSV  205



>ref|XP_010450390.1| PREDICTED: proteasome subunit alpha type-6-A [Camelina sativa]
Length=246

 Score =   395 bits (1015),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYVGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+++ETVQTAISALQSV
Sbjct  181  KKMKENPAFTFDETVQTAISALQSV  205



>ref|XP_010435443.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
 ref|XP_010440739.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
Length=246

 Score =   395 bits (1014),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF++ ETVQTAISALQSV
Sbjct  181  KKMKENPAFTFNETVQTAISALQSV  205



>ref|XP_006282775.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
 gb|EOA15673.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
Length=246

 Score =   395 bits (1014),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TK++GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKFIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+++ETVQTAISALQSV
Sbjct  181  KKMKENPAFTFDETVQTAISALQSV  205



>ref|NP_198409.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
 sp|O81146.2|PSA6A_ARATH RecName: Full=Proteasome subunit alpha type-6-A; AltName: Full=20S 
proteasome subunit alpha A-1; AltName: Full=Proteasome 
component 1; AltName: Full=Proteasome subunit alpha type-1 
[Arabidopsis thaliana]
 dbj|BAB09993.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 dbj|BAF00393.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AED93984.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
Length=246

 Score =   394 bits (1011),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +P+F+++ETVQTAISALQSV
Sbjct  181  KKMKENPSFTFDETVQTAISALQSV  205



>ref|XP_006649499.1| PREDICTED: proteasome subunit alpha type-6-like [Oryza brachyantha]
Length=246

 Score =   393 bits (1009),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP FSY+ETVQ AISALQSV
Sbjct  181  KKMKDDPQFSYDETVQIAISALQSV  205



>ref|NP_001049162.1| Os03g0180400 [Oryza sativa Japonica Group]
 sp|Q9LSU3.1|PSA6_ORYSJ RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Oryza sativa Japonica Group]
 dbj|BAA96829.1| alpha 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 gb|AAN65435.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|AAO13479.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|ABF94305.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11076.1| Os03g0180400 [Oryza sativa Japonica Group]
 gb|EAY88785.1| hypothetical protein OsI_10259 [Oryza sativa Indica Group]
 gb|EAZ25813.1| hypothetical protein OsJ_09653 [Oryza sativa Japonica Group]
 dbj|BAG94887.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87220.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   392 bits (1008),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP FSYEETVQ AISALQSV
Sbjct  181  KKMKDDPQFSYEETVQIAISALQSV  205



>gb|AAM12968.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AAM47883.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
Length=246

 Score =   392 bits (1007),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQK+VPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKEVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +P+F+++ETVQTAISALQSV
Sbjct  181  KKMKENPSFTFDETVQTAISALQSV  205



>ref|XP_002870436.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46695.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   392 bits (1007),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV AM+LG+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVGAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+++ETVQTAISALQSV
Sbjct  181  KKMKENPAFTFDETVQTAISALQSV  205



>emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome component, alpha 
subunit [Arabidopsis thaliana]
Length=245

 Score =   391 bits (1005),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = +3

Query  57   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  236
            SRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  1    SRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLL  60

Query  237  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  416
            DQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIADK
Sbjct  61   DQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIADK  120

Query  417  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEK  596
            SQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLEK
Sbjct  121  SQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEK  180

Query  597  KMKNDPAFSYEETVQTAISALQSV  668
            KMK +P+F+++ETVQTAISALQSV
Sbjct  181  KMKENPSFTFDETVQTAISALQSV  204



>gb|ACN33969.1| unknown [Zea mays]
 tpg|DAA43695.1| TPA: proteasome subunit alpha type [Zea mays]
Length=246

 Score =   391 bits (1004),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSV  205



>ref|NP_001130062.1| uncharacterized protein LOC100191154 [Zea mays]
 gb|ACF78183.1| unknown [Zea mays]
 gb|ACG28463.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG40310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACL54338.1| unknown [Zea mays]
Length=246

 Score =   390 bits (1003),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSV  205



>gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana]
Length=246

 Score =   390 bits (1003),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            ++MK +P+F+++ETVQTAISALQSV
Sbjct  181  EEMKGNPSFTFDETVQTAISALQSV  205



>ref|XP_004985490.1| PREDICTED: proteasome subunit alpha type-6-like [Setaria italica]
Length=246

 Score =   390 bits (1001),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKKAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDDPQFTYDETVQIAISALQSV  205



>ref|XP_002465753.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
 gb|EER92751.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
Length=246

 Score =   389 bits (1000),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSV  205



>emb|CDY50408.1| BnaC03g45100D [Brassica napus]
Length=244

 Score =   389 bits (998),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 199/205 (97%), Gaps = 2/205 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPL  VAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPL--VAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  178

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK +PAF+Y+ETVQTAISALQSV
Sbjct  179  KKMKENPAFTYDETVQTAISALQSV  203



>ref|NP_001105138.1| maize 20S proteasome alpha subunit [Zea mays]
 emb|CAC19494.1| maize 20S proteasome alpha subunit [Zea mays]
Length=246

 Score =   389 bits (998),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKY+GLLATG+TAD R+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADGRSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSV  205



>gb|KDO64977.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=241

 Score =   387 bits (993),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 5/205 (2%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQV     AVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQV-----AVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  55

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  56   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  115

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  116  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  175

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDPAF+++ETVQTAIS LQSV
Sbjct  176  KKMKNDPAFTFQETVQTAISTLQSV  200



>ref|XP_003558667.1| PREDICTED: proteasome subunit alpha type-6 [Brachypodium distachyon]
Length=246

 Score =   385 bits (990),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD+TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAE+R ++GYEMPVDVLA+WIAD
Sbjct  61   LDETSVTHLFPITKYIGLLATGLTADARSLVSQARNEAAEYRKKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+ P F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDSPQFTYDETVQIAISALQSV  205



>gb|AGO97077.1| 20S proteasome alpha [Saccharum hybrid cultivar GT28]
Length=246

 Score =   384 bits (985),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEG L+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGHLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHL P+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLLPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+DP F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSV  205



>emb|CDX93103.1| BnaA03g38250D [Brassica napus]
Length=263

 Score =   384 bits (985),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/222 (82%), Positives = 200/222 (90%), Gaps = 17/222 (8%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD++SVTHLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVTHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  414  KSQVYTQHAYMRPLGV-----------------VAMILGIDEEKGPQLFKCDPAGHFFGH  542
            KSQVYTQHAYMRPLGV                  AM+LG+DEE+GP L+KCDPAGHF+GH
Sbjct  121  KSQVYTQHAYMRPLGVGKFCTHFPTYLHIYTSTFAMVLGMDEERGPLLYKCDPAGHFYGH  180

Query  543  KATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSV  668
            KATSAG+KEQEAINFLEKKMK +PAF+Y+ETVQTAISALQSV
Sbjct  181  KATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISALQSV  222



>gb|EMT09268.1| Proteasome subunit alpha type-6 [Aegilops tauschii]
Length=246

 Score =   382 bits (982),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+ P FSY+ETVQ AISALQSV
Sbjct  181  KKMKDSPQFSYDETVQIAISALQSV  205



>gb|ABK22399.1| unknown [Picea sitchensis]
 gb|ABK25916.1| unknown [Picea sitchensis]
Length=246

 Score =   382 bits (981),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK++GLLATG+TADAR+LVQ ARNEAAEFRF++GYEMPVDVLAR +AD
Sbjct  61   LDQTSVTHLFPITKFIGLLATGMTADARSLVQHARNEAAEFRFKWGYEMPVDVLARRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV A++LGIDEE GPQLFKCDPAGHF G+KAT+AGVKE EA++FLE
Sbjct  121  KSQVYTQHAYMRPLGVAAIVLGIDEESGPQLFKCDPAGHFVGYKATAAGVKESEAVSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+KN+P  SYEETVQTA+SALQSV
Sbjct  181  KKLKNNPELSYEETVQTAVSALQSV  205



>dbj|BAJ85935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   381 bits (979),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMK+ P F+Y+ETVQ AISALQSV
Sbjct  181  KKMKDSPQFTYDETVQIAISALQSV  205



>ref|XP_006452821.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
 gb|ESR66061.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
Length=235

 Score =   375 bits (962),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 187/205 (91%), Gaps = 11/205 (5%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV           GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGV-----------GPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  169

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP FSYEETVQTA+SALQSV
Sbjct  170  KKMKNDPTFSYEETVQTAVSALQSV  194



>gb|ABF94306.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
Length=286

 Score =   373 bits (958),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/245 (74%), Positives = 197/245 (80%), Gaps = 40/245 (16%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  224
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVP   
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPVSS  60

Query  225  -------------------------------------DKLLDQTSVTHLFPVTKYLGLLA  293
                                                 DKLLD TSVTHLFP+TKY+GLLA
Sbjct  61   LRFDLKRSRLYAVYTAIRDQERRLICLAPCDVILILQDKLLDHTSVTHLFPITKYIGLLA  120

Query  294  TGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMI  473
            TG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIADK+QVYTQHAYMRPLGVVAM+
Sbjct  121  TGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIADKAQVYTQHAYMRPLGVVAMV  180

Query  474  LGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAIS  653
            LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLEKKMK+DP FSYEETVQ AIS
Sbjct  181  LGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPQFSYEETVQIAIS  240

Query  654  ALQSV  668
            ALQSV
Sbjct  241  ALQSV  245



>ref|XP_001777426.1| predicted protein [Physcomitrella patens]
 gb|EDQ57713.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   366 bits (940),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGNDSVCFVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLF VTKY+GLLATG+TADA++L+  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQTSVTHLFAVTKYIGLLATGMTADAKSLLAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG+KATS+G KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKNDP  S+E+TVQTAISALQS+
Sbjct  181  KKMKNDPQLSFEDTVQTAISALQSI  205



>ref|XP_001768229.1| predicted protein [Physcomitrella patens]
 gb|EDQ66843.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   363 bits (932),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLF VTK++GLLATG+TADA++L+  ARNEAA F+F  GYE+PVD LA+ IAD
Sbjct  61   LDQTSVTHLFAVTKFIGLLATGMTADAKSLIAHARNEAANFKFDLGYEIPVDYLAKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG+KATS+G KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+KN+P  SY+ETVQTAISALQS+
Sbjct  181  KKIKNNPQLSYDETVQTAISALQSI  205



>ref|XP_002989745.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
 ref|XP_002991751.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ07155.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ09222.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
Length=246

 Score =   361 bits (926),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K+ GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKSPGITSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ+SVTHL+ +T Y+GLLATG+TADAR+LVQ ARNEAAEFR + GYE+PVD L++ +AD
Sbjct  61   LDQSSVTHLYAITPYIGLLATGMTADARSLVQHARNEAAEFRHKNGYEIPVDFLSKRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV AMI+ IDEEKGPQLFKCDPAGH+ G++ATSAG+KEQEA+N LE
Sbjct  121  KSQVYTQHAYMRPLGVAAMIIAIDEEKGPQLFKCDPAGHYVGYRATSAGLKEQEAVNILE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KKMKN+P  SY+ETVQTAISALQS+
Sbjct  181  KKMKNNPQLSYDETVQTAISALQSI  205



>ref|XP_001782615.1| predicted protein [Physcomitrella patens]
 gb|EDQ52604.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   361 bits (926),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQ SVTHLF +TKY+GLLATG+TADA++LV  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQASVTHLFAITKYIGLLATGMTADAKSLVAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            +SQVYTQHAYMRPLGV AM++GID+E GPQL+KCDPAGH+FG+KATS+G KEQEA+NFLE
Sbjct  121  ESQVYTQHAYMRPLGVSAMLIGIDDELGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK K++P FSYEETVQ AISALQS+
Sbjct  181  KKCKSNPQFSYEETVQIAISALQSI  205



>ref|XP_010111992.1| Proteasome subunit alpha type-6 [Morus notabilis]
 gb|EXC32303.1| Proteasome subunit alpha type-6 [Morus notabilis]
Length=299

 Score =   357 bits (915),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  129  EYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLLATGITA  308
            +YAFKAVKAAGITSIGV+GKDSVCVVTQKKVPDKLLDQTSVTHLFP+TKYLGLLATG+TA
Sbjct  79   KYAFKAVKAAGITSIGVKGKDSVCVVTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTA  138

Query  309  DARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDE  488
            DARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+
Sbjct  139  DARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDD  198

Query  489  EKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSV  668
            E GP+L+KCDPAGHFFGHKATSAG+KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSV
Sbjct  199  EFGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTYEETVQTAISALQSV  258



>gb|KDO64982.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=225

 Score =   351 bits (901),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  117  LFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLLAT  296
            +  +EYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKLLD TSVTHLFP+TKYLGLLAT
Sbjct  1    MILIEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKLLDHTSVTHLFPITKYLGLLAT  60

Query  297  GITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMIL  476
            G+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+L
Sbjct  61   GMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVL  120

Query  477  GIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISA  656
             IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLEKKMKNDPAF+++ETVQTAIS 
Sbjct  121  SIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAIST  180

Query  657  LQSV  668
            LQSV
Sbjct  181  LQSV  184



>gb|AFK44903.1| unknown [Medicago truncatula]
Length=176

 Score =   341 bits (874),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEM VDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMLVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEA  578
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QE 
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEG  175



>ref|XP_001751730.1| predicted protein [Physcomitrella patens]
 gb|EDQ83165.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   340 bits (873),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK++GITSIGVRG+DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSSGITSIGVRGRDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD++SVTHLF VTK +GLLATG+T DA++LV  AR EAAEFRF+ GYE+PVD LA+ +AD
Sbjct  61   LDRSSVTHLFVVTKRIGLLATGMTGDAKSLVAGARAEAAEFRFKMGYEIPVDYLAKRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQVYTQHAYMRPLGV AM +G+D+E GP+L+KCDPAGHF G+KATS+G KEQEA+N L+
Sbjct  121  KSQVYTQHAYMRPLGVSAMFIGMDDEHGPRLYKCDPAGHFVGYKATSSGAKEQEAVNILD  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K++P  SY+ETVQTAI ALQS+
Sbjct  181  KKLKHNPQLSYDETVQTAICALQSI  205



>gb|ACB87915.1| 20S proteasome alpha subunit A1 [Malus domestica]
Length=187

 Score =   330 bits (846),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK++GLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FG +     ++  EAIN   
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEELGPQLYKCDPAGHYFGQR-LQCWIERAEAINSWR  179

Query  594  KK  599
            K 
Sbjct  180  KN  181



>gb|KDO64978.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64979.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64980.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=210

 Score =   328 bits (842),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK  545
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHK
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHK  164



>ref|XP_005648429.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
 gb|EIE23885.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
Length=247

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSI VRGKDSV VVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIAVRGKDSVAVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D +SVTH+F +TK++G+LATG  ADAR+LVQ++R+ AAEFR  YGYE+PVD LA  +AD
Sbjct  61   IDPSSVTHMFKITKFIGMLATGQRADARSLVQKSRSIAAEFRHTYGYEIPVDYLAARLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            ++QVYTQHAYMRPL VV ++ GIDEE GPQLFK DPAG++ G+KATSAG K+QEA NFLE
Sbjct  121  QAQVYTQHAYMRPLAVVLILAGIDEEAGPQLFKVDPAGYYVGYKATSAGAKDQEADNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            K+ K +P FS+EET QTAI+ALQSV
Sbjct  181  KRFKGNPEFSFEETAQTAIAALQSV  205



>gb|AFW89473.1| hypothetical protein ZEAMMB73_334376 [Zea mays]
Length=214

 Score =   321 bits (822),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK  545
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHK
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHK  164



>ref|XP_001691723.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
 gb|EDP04831.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
Length=249

 Score =   320 bits (820),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSIGVRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIGVRGKDSVVFVTQKKVQDKL  59

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D TSVT LF +TK++G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKFIGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGVV+M++G+DEE+GPQLFK DPAG++ G+KATS GVKE EA NFLE
Sbjct  120  KAQVYTQHAYMRPLGVVSMLIGVDEERGPQLFKVDPAGYYVGYKATSVGVKETEANNFLE  179

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK K++P F+Y+E V TAI+ALQ V
Sbjct  180  KKFKSNPQFTYDEAVTTAIAALQGV  204



>ref|XP_002949740.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
 gb|EFJ49292.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
Length=249

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSI VRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIAVRGKDSVVFVTQKKVQDKL  59

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D TSVT LF +TKY+G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKYVGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            K+QVYTQHAYMRPLGV++M++GIDEE+GPQLFK DPAG++ G+KAT+ GVKE EA NFLE
Sbjct  120  KAQVYTQHAYMRPLGVISMLIGIDEERGPQLFKVDPAGYYVGYKATAVGVKETEAHNFLE  179

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +PA SY+E V TAISALQ V
Sbjct  180  KKLKGNPALSYDEAVITAISALQGV  204



>gb|KDD75255.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=248

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K +G+TS+ VRG DSV  V+QKKVPDK+
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKTSGLTSVAVRGADSVVFVSQKKVPDKM  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D +S+T+++ +T   GLL TG+  DAR+LV +AR+EAAEFRF+YGYEMPVDVLAR +AD
Sbjct  61   VDASSITNIYKITACTGLLVTGMHGDARSLVHKARSEAAEFRFKYGYEMPVDVLARVLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            ++QV+TQHAYMRPLGV+A I+G+DEE+GPQLFK DPAG+F G+KAT+AGVKEQEAIN LE
Sbjct  121  QAQVHTQHAYMRPLGVIATIIGVDEERGPQLFKVDPAGYFVGYKATAAGVKEQEAINALE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            K+ K++P ++ ++T+Q AI  LQ V
Sbjct  181  KRFKSNPEYTLDQTIQAAIEILQDV  205



>ref|XP_003059392.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56524.1| predicted protein [Micromonas pusilla CCMP1545]
Length=249

 Score =   305 bits (780),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 173/208 (83%), Gaps = 3/208 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLYQVEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D   VTH+F +TK +G+ ATG + D R +VQ+AR++AAEFR  +GYE+PVD L+  +AD
Sbjct  61   VDPADVTHMFKITKVIGMCATGKSPDIRNVVQKARHKAAEFRHEFGYEIPVDFLSTRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            + QVYTQHAYMRP+  + M +GIDEEKGP LFK DPAG+  G+KATSAGVKEQEAINFLE
Sbjct  121  EFQVYTQHAYMRPMAAMCMFVGIDEEKGPCLFKNDPAGYCVGYKATSAGVKEQEAINFLE  180

Query  594  KKMKND---PAFSYEETVQTAISALQSV  668
            KK+K +    AF   ET+QTAIS LQSV
Sbjct  181  KKVKGENAGNAFDETETIQTAISCLQSV  208



>ref|XP_001418143.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96436.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=246

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHIT+FSPEGRL+QVEYAFKA+K+ G+T+IGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGAGAGYDRHITVFSPEGRLYQVEYAFKAIKSVGVTTIGVRGKDSVCVVTQKKIPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D + VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGYE+PVDVLA  +AD
Sbjct  61   IDASDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQHYGYEVPVDVLANILAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            + QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG+F G+ ATSAG KE EA+NFLE
Sbjct  121  EFQVYTQHAYMRPLAVMVILIAVDEDRGPSLFKCDPAGYFVGYSATSAGAKEVEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K+  +F   +T Q AISALQ V
Sbjct  181  KKVKSGASFDVNQTAQLAISALQHV  205



>ref|XP_005843942.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
 gb|EFN51840.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
Length=246

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MS GSGG YDRHITIFSPEGRL+QVEYAFKA K+ G+T+I VRG DSVC VTQ+KVPDKL
Sbjct  1    MSHGSGG-YDRHITIFSPEGRLYQVEYAFKAAKSNGLTAIAVRGTDSVCFVTQRKVPDKL  59

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
             D +SVT +  +TK +G+L TG+  DAR+L+Q+AR+EAAEFRF++GYEMPV  LAR +AD
Sbjct  60   TDPSSVTQIHSITKNIGMLLTGMHGDARSLMQKARSEAAEFRFKFGYEMPVHYLARVLAD  119

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            ++QVYTQHAYMRPLGV+ +++ IDEE+GPQLFK DPAG+F G+KAT+AGVKE EA+N LE
Sbjct  120  QAQVYTQHAYMRPLGVIPILIAIDEERGPQLFKVDPAGYFVGYKATAAGVKETEAVNMLE  179

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK K  P +S +E V+ AIS LQ V
Sbjct  180  KKFKTGPQYSQKEVVELAISTLQHV  204



>emb|CEF98211.1| Proteasome A-type subunit [Ostreococcus tauri]
Length=246

 Score =   295 bits (755),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  GYDRHIT+FSP+GRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSTAGYDRHITVFSPDGRLYQVEYAFKAIKSVGMTSIGVRGKDSVCVVTQKKIPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D T VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGY++PVDVLA  +AD
Sbjct  61   IDPTDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQNYGYDVPVDVLANILAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            + QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG++ G++ATSAG KE EA+NFLE
Sbjct  121  EFQVYTQHAYMRPLAVMVILVSMDEDRGPSLFKCDPAGYYVGYRATSAGSKEVEAVNFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K   +F   ET Q AISALQ V
Sbjct  181  KKVKAGSSFDANETAQLAISALQHV  205



>gb|ESA18832.1| hypothetical protein GLOINDRAFT_344383 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71315.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=245

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            M+R S G YDRHITIFSPEGRL+QVEYAFKA+  +G+TS+GVRGKDSV +VTQKK+PDKL
Sbjct  1    MNRSSAG-YDRHITIFSPEGRLYQVEYAFKAISNSGVTSVGVRGKDSVVIVTQKKIPDKL  59

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTH+F ++ Y+G + TG+ ADAR  V +AR EAAEFR+++GY MP D+LA+ +A+
Sbjct  60   LDPSTVTHMFQLSPYVGCVMTGLIADARAQVTRARQEAAEFRYKFGYYMPSDMLAKRVAN  119

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQHA MRPLGV  +++G D+E+GPQLFKCDPAG++ G+KAT+AG K+QEA+N LE
Sbjct  120  INQVYTQHAAMRPLGVSMILIGYDDERGPQLFKCDPAGYYVGYKATAAGAKQQEALNHLE  179

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K DP   +EETV+ AI+ L SV
Sbjct  180  KKLKKDPVLDFEETVELAINTLSSV  204



>gb|KIY96698.1| 20S proteasome subunit alpha 1 [Monoraphidium neglectum]
Length=290

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 178/244 (73%), Gaps = 39/244 (16%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAV+ +GITSI +RGKD VC VTQKKV DKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVRQSGITSIAIRGKDCVCFVTQKKVQDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D  +VT +F +TKY+G+L TG+ AD+R++VQQAR +AAEFRF YGYE+PVD LA+ +AD
Sbjct  61   IDPGTVTRIFKITKYIGMLVTGLPADSRSVVQQARQQAAEFRFTYGYEVPVDYLAKVLAD  120

Query  414  KSQVYT-------------------------------------QHAYMRPLGVVAMILGI  482
            K+QVYT                                     QHAYMRPLGV++M++ +
Sbjct  121  KAQVYTQVGAGMLAGRGPPPADWGCPLTPPAGARWLAPPTALSQHAYMRPLGVISMLVSV  180

Query  483  DEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPA--FSYEETVQTAISA  656
            DEE+GP LFK DPAG++ G+KAT+ G KE EA+NFLEKK++  PA   SY++T QTAISA
Sbjct  181  DEERGPSLFKVDPAGYYVGYKATAVGTKETEAVNFLEKKVRAMPAEGASYDDTCQTAISA  240

Query  657  LQSV  668
            LQSV
Sbjct  241  LQSV  244



>ref|XP_005842332.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
 gb|EKX55352.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
Length=252

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 168/210 (80%), Gaps = 5/210 (2%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  224
            MSR S  GYDR IT+FSPEGRL+Q+EYAFKAVKAAGIT++GVRG DSVC+VTQKKV    
Sbjct  1    MSRNSSSGYDRLITVFSPEGRLYQIEYAFKAVKAAGITTVGVRGADSVCIVTQKKVAQGH  60

Query  225  --DKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLA  398
              DKLLD +SVTH++ VT+ +G + TG  ADAR  +Q+ R EAA+FR++YGY+MP +VLA
Sbjct  61   SQDKLLDPSSVTHMYRVTETIGCVQTGHQADARAQIQRVRQEAAQFRYKYGYDMPPEVLA  120

Query  399  RWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEA  578
            + +AD +QVYTQHA MRP GV  M+ G+D+EKGPQLF CDPAGH+ G+KA +AG K+ EA
Sbjct  121  KRVADMNQVYTQHAGMRPYGVTMMLCGMDDEKGPQLFMCDPAGHYLGYKAVAAGQKDLEA  180

Query  579  INFLEKKMKNDPAFSYEETVQTAISALQSV  668
             N LEKK+KN P  SY+ET+Q AI+ LQSV
Sbjct  181  KNMLEKKLKNSPTLSYDETIQMAITVLQSV  210



>gb|KDO64983.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64984.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=191

 Score =   288 bits (736),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  225  DKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARW  404
            DKLLD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+W
Sbjct  3    DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW  62

Query  405  IADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAIN  584
            IADKSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAIN
Sbjct  63   IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN  122

Query  585  FLEKKMKNDPAFSYEETVQTAISALQSV  668
            FLEKKMKNDPAF+++ETVQTAIS LQSV
Sbjct  123  FLEKKMKNDPAFTFQETVQTAISTLQSV  150



>ref|XP_005717620.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
 emb|CDF37749.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
Length=251

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 169/210 (80%), Gaps = 5/210 (2%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  GYDRHITIFSPEGRLFQVEYAFKAVK  GIT+I VRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLFQVEYAFKAVKGPGITAIAVRGKDSVCAVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D +SV+  F +++  G +ATGI  DA+ +VQ+ R+EAAEF+F Y YE+PV+ LAR +AD
Sbjct  61   IDPSSVSSAFRLSENHGCIATGIITDAKAMVQRTRSEAAEFKFNYAYEIPVEYLARRVAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            ++Q+YTQHAYMRPLGV   I+G+DEE+GP L+KCDPAGH+ G++A +AG KEQEA+NFL+
Sbjct  121  ENQIYTQHAYMRPLGVSLTIIGMDEEEGPALYKCDPAGHYVGYRACAAGAKEQEALNFLQ  180

Query  594  KKMKNDPA-----FSYEETVQTAISALQSV  668
             K K+         S ++T+QT I+ALQ+V
Sbjct  181  NKFKSGDGSIGVELSEKDTIQTTIAALQNV  210



>emb|CEG74212.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEJ00907.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEI93442.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
Length=246

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKK+PDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQKKIPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G+KAT+AG K+QEA+N+LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYFVGYKATAAGAKQQEALNYLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L +V
Sbjct  181  KKLKKNPELNMEDTIELAITTLSNV  205



>gb|EIE83838.1| hypothetical protein RO3G_08543 [Rhizopus delemar RA 99-880]
Length=246

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G   TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LAR +A+
Sbjct  61   LDPSTITHVFKLTPKIGCAMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLARRVAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G+KAT+AG K+QEA+N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDEFGPQLYKCDPAGYFVGYKATAAGAKQQEALNHLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L SV
Sbjct  181  KKLKKNPELNMEDTIELAITTLSSV  205



>ref|XP_006835407.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysochloris 
asiatica]
Length=246

 Score =   286 bits (732),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+I+FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESISFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|NP_989113.1| proteasome subunit alpha type-6 [Xenopus (Silurana) tropicalis]
 gb|AAH61438.1| proteasome (prosome, macropain) subunit, alpha type 6 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81265.1| proteasome (prosome macropain) subunit alpha type 6 [Xenopus 
(Silurana) tropicalis]
Length=246

 Score =   286 bits (732),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+T++TAIS L +V
Sbjct  181  KKVKKKLDWTYEQTLETAISCLSTV  205



>ref|XP_003445487.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
 ref|XP_005738779.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005933943.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
 ref|XP_006799416.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=246

 Score =   286 bits (732),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+T++TAIS L +V
Sbjct  181  KKVKKKLDWTYEQTIETAISCLSTV  205



>ref|XP_010741287.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T  +G + TG+TAD+++ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDALTVTHLFRITDNIGCVMTGMTADSKSQVQRARYEAANWMYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YEET++TAIS L +V
Sbjct  181  KKVKKKQDWTYEETIETAISCLSTV  205



>ref|XP_004436462.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Ceratotherium 
simum simum]
Length=246

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF VT+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKVTENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_009209663.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Papio 
anubis]
 gb|EFB18466.1| hypothetical protein PANDA_011892 [Ailuropoda melanoleuca]
Length=228

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|NP_001264372.1| proteasome subunit alpha type-6 [Gallus gallus]
 ref|XP_003206625.1| PREDICTED: proteasome subunit alpha type-6 [Meleagris gallopavo]
Length=246

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFSITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTV  205



>ref|NP_001086785.1| proteasome alpha 6 subunit [Xenopus laevis]
 gb|AAH77442.1| Psma6-prov protein [Xenopus laevis]
 dbj|BAD42870.1| 20S proteasome alpha1 subunit [Xenopus laevis]
Length=246

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+T++TAIS L +V
Sbjct  181  KKVKKKLDWTYEQTLETAISCLSTV  205



>gb|EDL36728.1| proteasome (prosome, macropain) subunit, alpha type 6, isoform 
CRA_b [Mus musculus]
Length=251

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  6    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  65

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  66   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  125

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  126  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  185

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  186  KKVKKKFDWTFEQTVETAITCLSTV  210



>ref|XP_005656349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Sus scrofa]
Length=230

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>gb|KFW08632.1| Proteasome subunit alpha type-6, partial [Eurypyga helias]
Length=229

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  2    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  61

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  62   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  121

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  122  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  181

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  182  KKVKKKFDWTYEQTVETAITCLSTV  206



>ref|NP_001232198.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
 ref|XP_005479894.1| PREDICTED: proteasome subunit alpha type-6 [Zonotrichia albicollis]
 ref|XP_005520349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pseudopodoces 
humilis]
 gb|ACH43691.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
Length=246

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTV  205



>ref|XP_010153544.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Eurypyga 
helias]
Length=230

 Score =   284 bits (726),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTV  205



>ref|XP_009901279.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Picoides 
pubescens]
 gb|KFV69230.1| Proteasome subunit alpha type-6 [Picoides pubescens]
Length=246

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTV  205



>gb|ABM86477.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
Length=246

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_008300217.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGY++PVD+L + +AD
Sbjct  61   LDAMTVTHLFRITESIGCVMTGMTADGRSQVQRARYEAANWKYKYGYDIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGLDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+T++TAIS L +V
Sbjct  181  KKVKKKLDWTYEQTIETAISCLSTV  205



>ref|NP_036098.1| proteasome subunit alpha type-6 [Mus musculus]
 ref|XP_010383847.1| PREDICTED: proteasome subunit alpha type-6 [Rhinopithecus roxellana]
 sp|Q9QUM9.1|PSA6_MOUSE RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Mus musculus]
 pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|U Chain U, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|II Chain i, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|WW Chain w, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|G Chain G, Mouse Constitutive 20s Proteasome
 pdb|3UNE|U Chain U, Mouse Constitutive 20s Proteasome
 pdb|3UNE|II Chain i, Mouse Constitutive 20s Proteasome
 pdb|3UNE|WW Chain w, Mouse Constitutive 20s Proteasome
 pdb|3UNF|G Chain G, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|U Chain U, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|G Chain G, Mouse 20s Immunoproteasome
 pdb|3UNH|U Chain U, Mouse 20s Immunoproteasome
 gb|AAD50532.1|AF060087_1 proteasome subunit iota [Mus musculus]
 gb|AAF21459.1|U60288_1 proteasome subunit iota [Mus musculus]
 dbj|BAC40169.1| unnamed protein product [Mus musculus]
 dbj|BAE31592.1| unnamed protein product [Mus musculus]
 gb|AAH86685.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Mus musculus]
Length=246

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_004698589.1| PREDICTED: proteasome subunit alpha type-6 [Echinops telfairi]
 ref|XP_006085896.1| PREDICTED: proteasome subunit alpha type-6 [Myotis lucifugus]
 ref|XP_006759764.1| PREDICTED: proteasome subunit alpha type-6 [Myotis davidii]
 ref|XP_008157203.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eptesicus 
fuscus]
 gb|ELK33263.1| Proteasome subunit alpha type-6 [Myotis davidii]
Length=246

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_537412.2| PREDICTED: proteasome subunit alpha type-6 isoformX2 [Canis lupus 
familiaris]
 ref|XP_002922862.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_004399857.1| PREDICTED: proteasome subunit alpha type-6 [Odobenus rosmarus 
divergens]
 ref|XP_004773396.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_004820513.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_005080563.1| PREDICTED: proteasome subunit alpha type-6 [Mesocricetus auratus]
 ref|XP_005343781.1| PREDICTED: proteasome subunit alpha type-6 [Microtus ochrogaster]
 ref|XP_006732281.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006891612.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Elephantulus 
edwardii]
 ref|XP_003509963.2| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Cricetulus 
griseus]
 ref|XP_007632099.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Cricetulus 
griseus]
 ref|XP_008692325.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ursus 
maritimus]
 gb|ERE72544.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=246

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_007180773.1| PREDICTED: proteasome subunit alpha type-6 [Balaenoptera acutorostrata 
scammoni]
Length=246

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|NP_058979.1| proteasome subunit alpha type-6 [Rattus norvegicus]
 ref|NP_002782.1| proteasome subunit alpha type-6 isoform a [Homo sapiens]
 ref|NP_001039427.1| proteasome subunit alpha type-6 [Bos taurus]
 ref|NP_001180482.1| proteasome subunit alpha type-6 [Macaca mulatta]
 ref|NP_001233586.1| proteasome subunit alpha type-6 [Pan troglodytes]
 ref|NP_001271993.1| uncharacterized protein LOC101866963 [Macaca fascicularis]
 ref|NP_001272627.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Capra 
hircus]
 ref|XP_001491320.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Equus caballus]
 ref|XP_002718187.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_003408905.1| PREDICTED: proteasome subunit alpha type-6 [Loxodonta africana]
 ref|XP_003792017.1| PREDICTED: proteasome subunit alpha type-6 [Otolemur garnettii]
 ref|XP_003821244.1| PREDICTED: proteasome subunit alpha type-6 [Pan paniscus]
 ref|XP_003987590.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Felis 
catus]
 ref|XP_004270016.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Orcinus 
orca]
 ref|XP_004319607.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Tursiops 
truncatus]
 ref|XP_004376568.1| PREDICTED: proteasome subunit alpha type-6 [Trichechus manatus 
latirostris]
 ref|XP_004681993.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Condylura 
cristata]
 ref|XP_004884716.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_004867614.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_005376980.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005891864.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Bos mutus]
 ref|XP_006186437.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Camelus 
ferus]
 ref|XP_006212818.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Vicugna 
pacos]
 ref|XP_006913536.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus alecto]
 ref|XP_007073792.1| PREDICTED: proteasome subunit alpha type-6 [Panthera tigris altaica]
 ref|XP_007119012.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Physeter 
catodon]
 ref|XP_006043909.1| PREDICTED: proteasome subunit alpha type-6 [Bubalus bubalis]
 ref|XP_007464884.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007936738.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Orycteropus 
afer afer]
 ref|XP_007984674.1| PREDICTED: proteasome subunit alpha type-6 [Chlorocebus sabaeus]
 ref|XP_008069643.1| PREDICTED: proteasome subunit alpha type-6 [Tarsius syrichta]
 ref|XP_008511175.1| PREDICTED: proteasome subunit alpha type-6 [Equus przewalskii]
 ref|XP_008572098.1| PREDICTED: proteasome subunit alpha type-6 [Galeopterus variegatus]
 ref|XP_008831132.1| PREDICTED: proteasome subunit alpha type-6 [Nannospalax galili]
 ref|XP_010631915.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Fukomys 
damarensis]
 ref|XP_010833601.1| PREDICTED: proteasome subunit alpha type-6 [Bison bison bison]
 ref|XP_010966161.1| PREDICTED: proteasome subunit alpha type-6 [Camelus bactrianus]
 ref|XP_010984427.1| PREDICTED: proteasome subunit alpha type-6 [Camelus dromedarius]
 ref|XP_011374978.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus vampyrus]
 sp|P60901.1|PSA6_RAT RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Rattus norvegicus]
 sp|P60900.1|PSA6_HUMAN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=27 
kDa prosomal protein; Short=PROS-27; Short=p27K; AltName: 
Full=Macropain iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota 
chain [Homo sapiens]
 sp|Q2YDE4.1|PSA6_BOVIN RecName: Full=Proteasome subunit alpha type-6 [Bos taurus]
 pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|O Chain O, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 emb|CAA42052.1| prosomal P27K protein [Homo sapiens]
 dbj|BAA01587.1| proteasome subunit R-IOTA [Rattus sp.]
 gb|AAH02979.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH17882.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH22354.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH23659.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH62232.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 gb|AAH70137.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 emb|CAG33225.1| PSMA6 [Homo sapiens]
 dbj|BAE01337.1| unnamed protein product [Macaca fascicularis]
 gb|AAI10261.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Bos taurus]
 gb|EAW65877.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_b [Homo sapiens]
 gb|ABM83272.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 gb|EDM03426.1| proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 dbj|BAG35846.1| unnamed protein product [Homo sapiens]
 gb|ACM47241.1| proteasome subunit alpha type 6 [Capra hircus]
 dbj|BAI46667.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 tpg|DAA17455.1| TPA: proteasome subunit alpha type-6 [Bos taurus]
 dbj|BAK63685.1| proteasome subunit alpha type 6 [Pan troglodytes]
 gb|EHB02978.1| Proteasome subunit alpha type-6 [Heterocephalus glaber]
 gb|EHH27823.1| hypothetical protein EGK_18113 [Macaca mulatta]
 gb|EHH63557.1| hypothetical protein EGM_16549 [Macaca fascicularis]
 gb|ELK11320.1| Proteasome subunit alpha type-6 [Pteropus alecto]
 gb|ELR59203.1| Proteasome subunit alpha type-6 [Bos mutus]
 gb|AIC63124.1| PSMA6, partial [synthetic construct]
 gb|KFO29294.1| Proteasome subunit alpha type-6 [Fukomys damarensis]
 prf||1912298A prosomal RNA-binding protein p27K
Length=246

 Score =   284 bits (727),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>emb|CDS07623.1| Putative Proteasome subunit alpha type [Absidia idahoensis var. 
thermophila]
Length=246

 Score =   284 bits (727),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGKDGCVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L +V
Sbjct  181  KKLKKNPTLNMEDTIELAITTLSTV  205



>emb|CEP12966.1| hypothetical protein [Parasitella parasitica]
Length=246

 Score =   284 bits (727),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L +V
Sbjct  181  KKLKKNPELNMEDTIELAITTLSTV  205



>ref|XP_004470220.1| PREDICTED: proteasome subunit alpha type-6 [Dasypus novemcinctus]
Length=246

 Score =   284 bits (727),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_004649175.1| PREDICTED: proteasome subunit alpha type-6 [Jaculus jaculus]
Length=246

 Score =   284 bits (727),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_004559366.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
Length=246

 Score =   284 bits (727),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+T++ AIS L +V
Sbjct  181  KKVKKKLDWTYEQTIEAAISCLSTV  205



>gb|EPB88050.1| proteasome subunit alpha type-6 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=246

 Score =   284 bits (726),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L +V
Sbjct  181  KKLKKNPELNMEDTIELAITTLSTV  205



>ref|XP_010153543.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eurypyga 
helias]
 ref|XP_010581956.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Haliaeetus 
leucocephalus]
Length=246

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTV  205



>ref|XP_005149366.1| PREDICTED: proteasome subunit alpha type-6 [Melopsittacus undulatus]
Length=246

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTV  205



>ref|XP_006258805.1| PREDICTED: proteasome subunit alpha type-6 [Alligator mississippiensis]
Length=246

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTV  205



>ref|XP_001095366.1| PREDICTED: proteasome subunit alpha type-6-like isoform 1 [Macaca 
mulatta]
 ref|XP_001095483.1| PREDICTED: proteasome subunit alpha type-6-like isoform 2 [Macaca 
mulatta]
Length=246

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+Q+EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQIEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_008282309.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|NP_001132918.1| proteasome subunit alpha type-6 [Ovis aries]
 gb|ACI46679.1| proteasome subunit alpha type 6 [Ovis aries]
Length=246

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQSAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|NP_001088418.1| uncharacterized protein LOC495277 [Xenopus laevis]
 gb|AAH84423.1| LOC495277 protein [Xenopus laevis]
Length=246

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++Y +T++TAIS L +V
Sbjct  181  KKVKKKLDWTYGQTLETAISCLSTV  205



>emb|CAG00121.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=246

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTVETAISCLSTV  205



>dbj|GAN03133.1| proteasome subunit alpha type-6 [Mucor ambiguus]
Length=246

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G + TG+ ADAR  V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARAQVTKARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILVGYDDELGPQLYKCDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L +V
Sbjct  181  KKLKKNPELNMEDTIELAITTLSTV  205



>ref|XP_005865030.1| PREDICTED: proteasome subunit alpha type-6 [Myotis brandtii]
 gb|EPQ06979.1| Proteasome subunit alpha type-6 [Myotis brandtii]
Length=246

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG + G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGSYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_007253022.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Astyanax 
mexicanus]
Length=246

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YG+E+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAANWQYKYGFEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EAI+FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEAISFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKHDWTFEQTIETAISCLSTV  205



>ref|XP_006172412.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, alpha type, 6 [Tupaia chinensis]
Length=246

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK  E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKXTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_001363110.1| PREDICTED: proteasome subunit alpha type-6 [Monodelphis domestica]
Length=246

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_004542308.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
 ref|XP_005724902.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005917154.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
Length=246

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_003440740.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
Length=246

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>emb|CDH55408.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=246

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGQDGCVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L +V
Sbjct  181  KKLKKNPTLNMEDTIELAITTLSTV  205



>ref|XP_005798367.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD T+VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDDTTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEVPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATGFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKIKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_003924255.1| PREDICTED: proteasome subunit alpha type-6 [Saimiri boliviensis 
boliviensis]
Length=283

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = +3

Query  51   KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  230
             MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDK
Sbjct  37   NMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDK  96

Query  231  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  410
            LLD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IA
Sbjct  97   LLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIA  156

Query  411  DKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFL  590
            D SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FL
Sbjct  157  DISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFL  216

Query  591  EKKMKNDPAFSYEETVQTAISALQSV  668
            EKK+K    +++E+TV+TAI+ L +V
Sbjct  217  EKKVKKKFDWTFEQTVETAITCLSTV  242



>ref|XP_007530301.1| PREDICTED: proteasome subunit alpha type-6 [Erinaceus europaeus]
Length=246

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_005810950.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_010744453.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_007436765.1| PREDICTED: proteasome subunit alpha type-6 [Python bivittatus]
Length=246

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKLDWTFEQTVETAITCLSTV  205



>ref|XP_008396439.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|NP_001279159.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Callorhinchus 
milii]
 gb|AFM88302.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   282 bits (722),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++Y++TV+TAI+ L +V
Sbjct  181  KKVKKKLDWTYDQTVETAITCLSTV  205



>ref|XP_003971508.1| PREDICTED: proteasome subunit alpha type-6-like [Takifugu rubripes]
Length=246

 Score =   282 bits (722),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_004083706.1| PREDICTED: proteasome subunit alpha type-6 [Oryzias latipes]
Length=246

 Score =   282 bits (721),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEVPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEFGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_003471921.1| PREDICTED: proteasome subunit alpha type-6 [Cavia porcellus]
Length=246

 Score =   282 bits (721),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+ AI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVEIAITCLSTV  205



>pdb|4R3O|A Chain A, Human Constitutive 20s Proteasome
 pdb|4R3O|O Chain O, Human Constitutive 20s Proteasome
 pdb|4R67|A Chain A, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|O Chain O, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|CC Chain c, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|QQ Chain q, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=244

 Score =   282 bits (721),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +3

Query  57   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  236
            SRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKLL
Sbjct  1    SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLL  60

Query  237  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  416
            D ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD 
Sbjct  61   DSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADI  120

Query  417  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEK  596
            SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLEK
Sbjct  121  SQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEK  180

Query  597  KMKNDPAFSYEETVQTAISALQSV  668
            K+K    +++E+TV+TAI+ L +V
Sbjct  181  KVKKKFDWTFEQTVETAITCLSTV  204



>ref|XP_007569003.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   282 bits (721),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGMDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_005285405.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysemys 
picta bellii]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITETIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+T I+ L +V
Sbjct  181  KKVKKKYDWTFEQTVETGITCLSTV  205



>ref|XP_010876681.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVFKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++++ETV+TAI+ L +V
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTV  205



>ref|XP_007012616.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma cacao]
 gb|EOY30235.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma cacao]
Length=181

 Score =   279 bits (713),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+PVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVV  464
            KSQVYTQHAYMRPLG++
Sbjct  121  KSQVYTQHAYMRPLGLL  137



>gb|ACI66289.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ADM16303.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++++ETV+TAI+ L +V
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTV  205



>dbj|BAE36518.1| unnamed protein product [Mus musculus]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MR LG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRTLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_007576015.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATGFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_005158685.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Danio 
rerio]
 gb|AAH55520.1| Psma6a protein [Danio rerio]
 gb|AAI64827.1| Psma6a protein [Danio rerio]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   V+TQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++++TV+TAIS L +V
Sbjct  181  KKIKKKLDWTFDQTVETAISCLSTV  205



>emb|CDQ90937.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++++ETV+TAI+ L +V
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTV  205



>ref|XP_006985315.1| PREDICTED: proteasome subunit alpha type-6 [Peromyscus maniculatus 
bairdii]
Length=246

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GID E+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDGEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|NP_001132944.1| proteasome subunit alpha type-6 [Sus scrofa]
 gb|ACJ06406.1| proteasome subunit alpha type 6 [Sus scrofa]
Length=246

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGVDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLFTV  205



>ref|XP_007253021.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Astyanax 
mexicanus]
Length=288

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YG+E+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAANWQYKYGFEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EAI+FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEAISFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKHDWTFEQTIETAISCLSTV  205



>ref|XP_001511492.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ornithorhynchus 
anatinus]
Length=246

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|NP_001002589.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAH76196.1| Zgc:92716 [Danio rerio]
Length=246

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+ V+TAI+ L +V
Sbjct  181  KKVKKKLDWTFEQAVETAITCLTTV  205



>ref|XP_008398058.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFKITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT++GVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCGFKATASGVKQTEATGFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|XP_006632201.1| PREDICTED: proteasome subunit alpha type-6-like [Lepisosteus 
oculatus]
Length=246

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITETIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEFGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++++TV+TAI+ L +V
Sbjct  181  KKVKKKLDWTFDQTVETAITCLSTV  205



>gb|ACO51961.1| Proteasome subunit alpha type-6 [Rana catesbeiana]
Length=246

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKS  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++V+HLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDNSTVSHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEETGPQVYKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E++V+TAIS L +V
Sbjct  181  KKVKKKFDWTFEQSVETAISCLSTV  205



>ref|XP_005989234.1| PREDICTED: proteasome subunit alpha type-6 [Latimeria chalumnae]
Length=246

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF VT+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAGTVTHLFRVTENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GID+E GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILVGIDQEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKLDWTFEQTVETAITCLSTV  205



>ref|XP_005562133.1| PREDICTED: proteasome subunit alpha type-6-like [Macaca fascicularis]
Length=245

 Score =   279 bits (714),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTAD-RSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  119

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  120  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  179

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  180  KKVKKKFDWTFEQTVETAITCLSTV  204



>gb|ERE72543.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=250

 Score =   280 bits (715),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 171/209 (82%), Gaps = 4/209 (2%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETV----QTAISALQSV  668
            KK+K    +++E+TV    QTAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVEHSFQTAITCLSTV  209



>ref|XP_002824717.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pongo 
abelii]
Length=246

 Score =   279 bits (714),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QV+Y F+++   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVDYCFQSINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_006015430.1| PREDICTED: proteasome subunit alpha type-6 [Alligator sinensis]
Length=382

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  137  MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  196

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  197  LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  256

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  257  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  316

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++YE+TV+TAI+ L +V
Sbjct  317  KKVKKKFDWTYEQTVETAITCLSTV  341



>ref|XP_004653726.1| PREDICTED: proteasome subunit alpha type-6-like [Jaculus jaculus]
Length=246

 Score =   279 bits (713),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+Q EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQAEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+  MRPLG   +++G DEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNTEMRPLGCCMILIGTDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>gb|ETE73021.1| Proteasome subunit alpha type-6, partial [Ophiophagus hannah]
Length=279

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  34   MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  93

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  94   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  153

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  154  ISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  213

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TA++ L +V
Sbjct  214  KKVKKKLDWTFEQTVETAVTCLSTV  238



>ref|XP_002500811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62069.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 172/250 (69%), Gaps = 45/250 (18%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQV-----------------------------------  128
            MSRGSG GYDRHITIFSPEGRL+QV                                   
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPIIPSLFTPARIARLTGD  60

Query  129  -------EYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGL  287
                   EYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKLLD T +TH+F +TK +GL
Sbjct  61   PVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLDPTDITHMFKITKTIGL  120

Query  288  LATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVA  467
             ATG   D R +VQ+AR+ AAEFR  YGYE+PVD L+  +AD  QVYTQHAYMRP+  + 
Sbjct  121  CATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADWFQVYTQHAYMRPMAAMC  180

Query  468  MILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPA---FSYEETV  638
            M +GIDEE+GP L+K DPAG+F G+KATSAG KEQEAINFLEKK+K   A   F+ +ETV
Sbjct  181  MFVGIDEERGPSLYKNDPAGYFVGYKATSAGAKEQEAINFLEKKVKGKDAGNTFTEQETV  240

Query  639  QTAISALQSV  668
            +TAI+ LQ+V
Sbjct  241  RTAIACLQTV  250



>emb|CDQ78135.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K     +++ETV+TAI+ L +V
Sbjct  181  KKVKKKLDLTFKETVETAITCLSTV  205



>ref|XP_007513369.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16927.1| predicted protein [Bathycoccus prasinos]
Length=247

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+GGGYDRHITIFSPEGRL+QVEYAFKA+KA GI SI V+GKD V  VTQKK PD L
Sbjct  1    MSRGAGGGYDRHITIFSPEGRLYQVEYAFKAIKAVGINSIAVKGKDCVVAVTQKKCPDVL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +DQ+++TH+F VTK LG+  TG   D R +VQ+AR +AAEFRF YGYE+PVDVLA  +AD
Sbjct  61   IDQSAMTHMFKVTKTLGMCMTGKDPDIRNVVQKARKQAAEFRFEYGYEIPVDVLANKMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
            + QVYTQHAYMRPL  + +++GIDEE+G  L+KCDP+G++ G+KA +AG KE EA+NFLE
Sbjct  121  EFQVYTQHAYMRPLATMCILMGIDEERGASLYKCDPSGYYAGYKACAAGNKEVEAVNFLE  180

Query  594  KKMKNDPAFS-YEETVQTAISALQSV  668
            KK+K +   +  +   + AIS LQ V
Sbjct  181  KKIKRESNVNDVDGACRLAISTLQHV  206



>ref|NP_001150310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG38611.1| proteasome subunit alpha type 6 [Zea mays]
 tpg|DAA63585.1| TPA: proteasome subunit alpha type 6 [Zea mays]
Length=285

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 164/211 (78%), Gaps = 10/211 (5%)
 Frame = +3

Query  60   RGSGG----GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKV--  221
            RG+G       DR IT+F  +GRL+QV+YA+ A K AG+TS+GVRG DSVCVV Q++   
Sbjct  14   RGAGAFRTLSEDRRITVFCSDGRLYQVDYAWNATKLAGVTSVGVRGTDSVCVVGQRRANT  73

Query  222  ---PDKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDV  392
                DKLLD TSV+ LFP+T  LGLLATGI  + R L  +ARN+ AEFRF +GYEMP DV
Sbjct  74   HAPKDKLLDMTSVSRLFPITDRLGLLATGIAGEGRALAHEARNQTAEFRFNWGYEMPPDV  133

Query  393  LARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKG-PQLFKCDPAGHFFGHKATSAGVKE  569
            LA+WIAD++Q++TQ+   RP GVVAMILGID+EKG PQLF CDPAG+FFGHKA SAG ++
Sbjct  134  LAQWIADRAQIWTQYVSKRPSGVVAMILGIDDEKGTPQLFTCDPAGYFFGHKAASAGQRD  193

Query  570  QEAINFLEKKMKNDPAFSYEETVQTAISALQ  662
             EA+NFLEKKMKN+P+  ++ET+Q AISALQ
Sbjct  194  TEAVNFLEKKMKNNPSLPFQETIQMAISALQ  224



>gb|ACQ58552.1| Proteasome subunit alpha type-6 [Anoplopoma fimbria]
Length=246

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE G Q++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDEEHGAQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>ref|NP_705941.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAK40122.1|AF354750_1 proteasome subunit alpha Type 6-A [Danio rerio]
Length=233

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   V+TQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PV +L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVGMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++++TV+TAIS L +V
Sbjct  181  KKIKKKLDWTFDQTVETAISCLSTV  205



>gb|AFK10987.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPD+L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDEL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVY Q+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYMQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++Y++TV+TAI+ L +V
Sbjct  181  KKVKKKLDWTYDQTVETAITCLSTV  205



>gb|KDO64981.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=149

 Score =   274 bits (701),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGI  482
            KSQVYTQHAYMRPLGV   ++ I
Sbjct  121  KSQVYTQHAYMRPLGVGLFLIEI  143



>gb|ACM08640.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKP  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    ++++ETV+TAI+ L +V
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTV  205



>ref|XP_008311014.1| PREDICTED: proteasome subunit alpha type-6 [Cynoglossus semilaevis]
Length=246

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A  RPLG   +++ +DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNADKRPLGCCMIVISVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>gb|ACH70968.1| proteasome (prosome, macropain) subunit, alpha type 6-2 [Salmo 
salar]
Length=246

 Score =   276 bits (707),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPD L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDTL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K     +++ETV+TAI+ L +V
Sbjct  181  KKVKKKLDLTFKETVETAITCLSTV  205



>ref|XP_002610620.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
 gb|EEN66630.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
Length=246

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKAV   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAVNQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTH+F +T Y+G + TG+ AD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAETVTHIFQITDYIGCVMTGMIADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G D+E GPQ++K DPAG++ G+KATS GVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGYDDEHGPQVYKTDPAGYYCGYKATSVGVKQTEANSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    F+Y E V+TAI+ L ++
Sbjct  181  KKIKKKVDFTYNEAVETAITCLSTI  205



>ref|XP_001640650.1| predicted protein [Nematostella vectensis]
 gb|EDO48587.1| predicted protein [Nematostella vectensis]
Length=246

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RG DS  VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVGIRGADSAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VT LF +++ +G + TG+ AD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSNTVTQLFELSERIGCVMTGMVADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEEKGPQL+K DPAG+F G KA S GVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCGMILIGIDEEKGPQLYKTDPAGYFCGFKACSVGVKQTEANSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K   A+++ ETV+TAIS L SV
Sbjct  181  KKVKKKHAWTFNETVETAISCLSSV  205



>ref|XP_006932865.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Felis 
catus]
Length=203

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQ  641
            KK+K    +++E+TV+
Sbjct  181  KKVKKKFDWTFEQTVE  196



>gb|ACH70967.1| proteasome (prosome, macropain) subunit, alpha type 6-1 [Salmo 
salar]
 gb|ACI66033.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ACI70006.1| Proteasome subunit alpha type-6 [Salmo salar]
 emb|CDQ70650.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   275 bits (704),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++ +T++TAI+ L +V
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTV  205



>ref|XP_004637142.1| PREDICTED: proteasome subunit alpha type-6 [Octodon degus]
Length=244

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA   ++Y YE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA--NWKYNYEIPVDMLCKRIAD  118

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  119  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  178

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  179  KKVKKKFDWTFEQTVETAITCLSTV  203



>gb|ACO08806.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF  T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKTTENIGCVMSGMTADSKSQVQRARCEAANWKYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++ +T++TAI+ L +V
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTV  205



>ref|XP_006793167.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=234

 Score =   274 bits (701),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  51   KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  230
            KMSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK
Sbjct  36   KMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDK  95

Query  231  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  410
            LLD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IA
Sbjct  96   LLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIA  155

Query  411  DKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFL  590
            D SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FL
Sbjct  156  DISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFL  215

Query  591  EKKMKNDPAFSYEETVQTA  647
            EKK+K    +++E+T++ +
Sbjct  216  EKKVKKKLDWTFEQTIEVS  234



>ref|XP_010876973.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   274 bits (700),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGQDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++ +TV+ AI+ L +V
Sbjct  181  KKVKKKLDWTFAQTVEMAITCLSTV  205



>ref|XP_010777538.1| PREDICTED: proteasome subunit alpha type-6 [Notothenia coriiceps]
Length=246

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDCAIVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T ++G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDAGTVTHLFRITDHIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++GID+E GPQ++K DPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDDEHGPQVYKNDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+T++TAIS L +V
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTV  205



>gb|EIE87129.1| hypothetical protein RO3G_11840 [Rhizopus delemar RA 99-880]
Length=269

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 170/228 (75%), Gaps = 23/228 (10%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGI-----------------------TADARTLVQQARNE  344
            LD +++TH+F +T  +G + TG+                       TADAR+ V +AR E
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIGKCNSFEHERDEIINLKLLNEPTADARSQVTRARQE  120

Query  345  AAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPA  524
            AAEFR++YGYE+P D+LA+ +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPA
Sbjct  121  AAEFRYKYGYEIPTDMLAKRVANINQVYTQQAAMRPYGVSMILIGHDDEFGPQLYKCDPA  180

Query  525  GHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSV  668
            G+F G+KAT+AG K+QEA+N LEKK+K +P  + E+T++ AI+ L SV
Sbjct  181  GYFVGYKATAAGAKQQEALNHLEKKLKKNPELNMEDTIELAITTLSSV  228



>ref|XP_004333676.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11663.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
Length=242

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSR +G  YDRHITIFSPEGRL+QVEYAFKA+K   +TS+G+RG DS CV+TQKKVP+KL
Sbjct  1    MSRSAG--YDRHITIFSPEGRLYQVEYAFKAIKTENLTSLGIRGADSCCVITQKKVPEKL  58

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D TSVTHLF +T  +G + TG+ ADAR+ VQ+AR EAA+F  ++GY++PV  LA+ +AD
Sbjct  59   VDPTSVTHLFNITPTIGCVMTGMIADARSQVQRARKEAADFAHKFGYDIPVSYLAKRMAD  118

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +Q+YTQHAYMRPL ++  ++ IDEE+GPQL+KCDPAG + G KAT AG KEQEA NFLE
Sbjct  119  IAQIYTQHAYMRPLAMI--LISIDEEEGPQLYKCDPAGSYAGFKATGAGHKEQEARNFLE  176

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK K DP    ++T++ AI+ALQ+V
Sbjct  177  KKFKTDPKLDADKTIKMAINALQTV  201



>gb|ACI69778.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+ AD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMAADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  VSQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++ +T++TAI+ L +V
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTV  205



>emb|CDH55409.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=244

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKK  DKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGQDGCVIVTQKK--DKL  58

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  59   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  118

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSAG K+QE++N LE
Sbjct  119  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSAGAKQQESLNHLE  178

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P  + E+T++ AI+ L +V
Sbjct  179  KKLKKNPTLNMEDTIELAITTLSTV  203



>ref|XP_011419593.1| PREDICTED: proteasome subunit alpha type-6 [Crassostrea gigas]
 gb|EKC40404.1| Proteasome subunit alpha type-6 [Crassostrea gigas]
Length=228

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDCAVVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  +VTHLF +T+ LG + TG+ AD+R+ VQ+AR EAA++++ YGYE+PVDVL + IAD
Sbjct  61   LDADTVTHLFQLTENLGCVMTGMVADSRSQVQRARYEAAKWKYNYGYEIPVDVLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ A MRPLG   +++G D E GPQ+FK DPAG+F G+KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQSAEMRPLGCSMIMVGFDAEYGPQVFKADPAGYFSGYKATAAGVKQLEANSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    F+Y E V+ AI+ L +V
Sbjct  181  KKIKKKQDFTYNEAVEVAITCLSTV  205



>gb|ACO08382.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   V TQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVATQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADNKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++ +T++TAI+ L +V
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTV  205



>ref|XP_005703510.1| 20S proteasome subunit alpha 1 [Galdieria sulphuraria]
 gb|EME26990.1| 20S proteasome subunit alpha 1 [Galdieria sulphuraria]
Length=247

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKAVK+ GIT++ V+G DSVC VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAVKSVGITTVAVKGVDSVCGVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +D  SVT++F V+ + G + TG+  DAR  +Q+ R+EAA+F+F++GYE+PVD +A+ +AD
Sbjct  61   IDPKSVTNVFRVSDHHGCIFTGLATDARAQLQRTRSEAADFKFKFGYEIPVDQIAKRLAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINF-L  590
             +QVYTQHAYMRPLGV  + +G+D+E+GPQL+KCDPAG++ G++  +AG KEQEAIN+  
Sbjct  121  INQVYTQHAYMRPLGVSLIFIGMDDERGPQLYKCDPAGYYIGYRGCAAGAKEQEAINYLE  180

Query  591  EKKMKNDPAFSYEETVQTAISALQSV  668
            +K  + +   SYEETVQ A++ LQSV
Sbjct  181  KKLKEEEKKLSYEETVQLALATLQSV  206



>ref|XP_003388491.1| PREDICTED: proteasome subunit alpha type-6-like [Amphimedon queenslandica]
Length=246

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G+DR ITIFSPEGRL+QVEYAFKA+   G TSIGV+G +S  V+TQKKVPDKL
Sbjct  1    MSRGSSAGFDRFITIFSPEGRLYQVEYAFKAIAQTGSTSIGVKGTNSAVVITQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD  S+THLF +T  +G + TG+TAD+R  V++AR+EAAEF++RYGY+MPVD + + +AD
Sbjct  61   LDPDSITHLFKITDTVGCVMTGMTADSRAQVKRARHEAAEFKYRYGYDMPVDAVCKRMAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +Q+YTQ+A+MRP G   +++GIDEE+G QLFK DPAG++ G+KATS G K+ EA N+LE
Sbjct  121  IAQIYTQNAFMRPYGCSMILIGIDEERGIQLFKTDPAGYYCGYKATSVGAKQTEANNYLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K +P++ Y ETV+ A+  L  V
Sbjct  181  KKIKKNPSWGYHETVEVALLTLSQV  205



>ref|XP_008608969.1| proteasome subunit alpha type-6 [Saprolegnia diclina VS20]
 gb|EQC37449.1| proteasome subunit alpha type-6 [Saprolegnia diclina VS20]
 gb|KDO22075.1| proteasome subunit alpha type-6 [Saprolegnia parasitica CBS 223.65]
Length=242

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = +3

Query  66   SGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQT  245
            SG GYDRHITIFSP+GRL+Q+EYAFKAVK + +TS+ VRG  S  VVTQKKVPDKL+D  
Sbjct  2    SGDGYDRHITIFSPDGRLYQIEYAFKAVKESSLTSVAVRGAKSCVVVTQKKVPDKLIDPD  61

Query  246  SVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQV  425
            SVT++F +T  +G L TG+ ADA+  VQ+ R EA +F  +YGY +P  VLA+ +AD SQV
Sbjct  62   SVTNIFKITPLIGCLMTGLYADAKAQVQRLRYEAHDFEHKYGYPVPCHVLAKRLADISQV  121

Query  426  YTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMK  605
            YTQHA MR LGVV M++ +DEEKGPQL+K DPAGHF+G+KAT+AGVK+QEA N+LEKK+K
Sbjct  122  YTQHASMRALGVVTMLISVDEEKGPQLYKIDPAGHFWGYKATAAGVKDQEATNYLEKKIK  181

Query  606  NDPAFSYEETVQTAISALQSV  668
             + A  +E TV TAI+ LQSV
Sbjct  182  ANAAMDHETTVHTAITCLQSV  202



>ref|XP_006065991.1| PREDICTED: proteasome subunit alpha type-6-like [Bubalus bubalis]
Length=246

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G DRHITIFSPEGRL+QVE AFKAV   G+TS+ VRGKD   +V QKKVPDKL
Sbjct  1    MSRGSSAGVDRHITIFSPEGRLYQVEDAFKAVNQGGLTSVAVRGKDCAVIVAQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            L  ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA+++++YGYE+PV +L + IAD
Sbjct  61   LHSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAAKWKYKYGYEIPVHMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTV  205



>ref|XP_004349345.1| proteasome subunit iota [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91465.1| proteasome subunit iota [Capsaspora owczarzaki ATCC 30864]
Length=244

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  72   GGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSV  251
            G +DRHI+IFSPEGRL+Q+EYAFKA+ + G+TSIG+RGKDS  V+TQKKVPDKL+D +SV
Sbjct  5    GSWDRHISIFSPEGRLYQIEYAFKAINSGGLTSIGMRGKDSCVVITQKKVPDKLMDASSV  64

Query  252  THLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYT  431
            THLF +T+ +G + TG+ ADAR  VQ+AR+EAA+F+F YGY +PVD LAR +AD SQV T
Sbjct  65   THLFQLTEEIGCVMTGMIADARAQVQRARHEAAQFKFTYGYPIPVDQLARRVADISQVST  124

Query  432  QHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKND  611
            Q A  RPLG   +++G D+E G QL+K DPAG++ G+KATSAG+K QEA N+LEKK+K +
Sbjct  125  QQAGARPLGCSMILIGYDDEYGAQLYKTDPAGYYIGYKATSAGIKSQEANNYLEKKIKKN  184

Query  612  PAFSYEETVQTAISALQSV  668
            P +SY+ETV+ AI+AL SV
Sbjct  185  PEWSYQETVENAITALGSV  203



>ref|XP_005762775.1| hypothetical protein EMIHUDRAFT_446206 [Emiliania huxleyi CCMP1516]
 ref|XP_005781576.1| hypothetical protein EMIHUDRAFT_442798 [Emiliania huxleyi CCMP1516]
 gb|EOD10346.1| hypothetical protein EMIHUDRAFT_446206 [Emiliania huxleyi CCMP1516]
 gb|EOD29147.1| hypothetical protein EMIHUDRAFT_442798 [Emiliania huxleyi CCMP1516]
Length=264

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 166/216 (77%), Gaps = 11/216 (5%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            M+RGS  GYDRHITIFSPEGRL+QVEYAFKA+K +G+TS+GVRG DS  V+TQ+KVPDKL
Sbjct  1    MARGSSAGYDRHITIFSPEGRLYQVEYAFKAIKTSGLTSVGVRGADSCVVLTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
             D  SVT+++ +T  +GL+ TGI  DAR  V++ R EAA+F+F  GY++PV  LA+  AD
Sbjct  61   YDPESVTNMYAITPNIGLVMTGIVPDARASVKKLREEAAKFKFNNGYDIPVSYLAKRAAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGID---EEKGPQLFKCDPAGHFFGHKATSAGVKEQEAIN  584
             +QVYTQHA MRPLG+  +I+GID   E+K PQLF+CDPAG++ G+KATSAG KEQEA N
Sbjct  121  TAQVYTQHANMRPLGIAMIIIGIDVEGEKKVPQLFRCDPAGYYVGYKATSAGAKEQEANN  180

Query  585  FLEKKMKN--------DPAFSYEETVQTAISALQSV  668
            FLEK+ K         DP  S+++TVQ A++ LQ+V
Sbjct  181  FLEKRFKPPAGSNVAVDPKLSHDDTVQLALACLQNV  216



>tpg|DAA43694.1| TPA: hypothetical protein ZEAMMB73_913533 [Zea mays]
Length=146

 Score =   266 bits (680),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  414  KSQVYTQHAYMRPLGVV  464
            K+QVYTQHAYMRPLGVV
Sbjct  121  KAQVYTQHAYMRPLGVV  137



>ref|XP_006678757.1| hypothetical protein BATDEDRAFT_88011 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80942.1| hypothetical protein BATDEDRAFT_88011 [Batrachochytrium dendrobatidis 
JAM81]
Length=252

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = +3

Query  72   GGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSV  251
             GYDRHITIFSPEGRL+QVEYAFKA+  AG TS+GVRGK S  +VTQKKVPDKLLD ++V
Sbjct  12   AGYDRHITIFSPEGRLYQVEYAFKAISNAGFTSVGVRGKSSCVIVTQKKVPDKLLDPSTV  71

Query  252  THLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYT  431
            TH+F +T  +G + TG+ ADA + V +AR EAAE+R++YGYE+PVD+LA+ IA  +QVYT
Sbjct  72   THMFQLTPKIGCVMTGLIADAHSQVARARMEAAEWRYKYGYEIPVDMLAKRIASINQVYT  131

Query  432  QHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKND  611
            Q A MRPLGV  +++  D+E+GPQLFKCDPAG+F G+KAT+AG K QEA+N LEKK K +
Sbjct  132  QQAAMRPLGVSMILISYDDERGPQLFKCDPAGYFVGYKATTAGAKHQEALNHLEKKFKKE  191

Query  612  PAFSYEETVQTAISALQSV  668
               ++E+T++ AI+ L +V
Sbjct  192  LVLNHEDTIELAITTLSNV  210



>gb|ABI13160.1| putative proteasome alpha subunit [Emiliania huxleyi]
Length=264

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 165/216 (76%), Gaps = 11/216 (5%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            M+RGS  GYDRHITIFSPEGRL+QVEYAFKA+K +G+TS+GVRG D   V+TQ+KVPDKL
Sbjct  1    MARGSSAGYDRHITIFSPEGRLYQVEYAFKAIKTSGLTSVGVRGADPCVVLTQRKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
             D  SVT+++ +T  +GL+ TGI  DAR  V++ R EAA+F+F  GY++PV  LA+  AD
Sbjct  61   YDPESVTNMYAITPNIGLVMTGIVPDARASVKKLREEAAKFKFNNGYDIPVSYLAKRAAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGID---EEKGPQLFKCDPAGHFFGHKATSAGVKEQEAIN  584
             +QVYTQHA MRPLG+  +I+GID   E+K PQLF+CDPAG++ G+KATSAG KEQEA N
Sbjct  121  TAQVYTQHANMRPLGIAMIIIGIDVEGEKKVPQLFRCDPAGYYVGYKATSAGAKEQEANN  180

Query  585  FLEKKMKN--------DPAFSYEETVQTAISALQSV  668
            FLEK+ K         DP  S+++TVQ A++ LQ+V
Sbjct  181  FLEKRFKPPAGSNVAVDPKLSHDDTVQLALACLQNV  216



>ref|XP_008881328.1| hypothetical protein H310_15130 [Aphanomyces invadans]
 gb|ETV90034.1| hypothetical protein H310_15130 [Aphanomyces invadans]
Length=242

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = +3

Query  66   SGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQT  245
            SG GYDRHITIFSPEGRLFQ+EYAFKAVK + +TS+ VRG  S  VVTQKKVPDKL+D  
Sbjct  2    SGDGYDRHITIFSPEGRLFQIEYAFKAVKESNLTSVAVRGAKSCVVVTQKKVPDKLIDPD  61

Query  246  SVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQV  425
            SVT++F +T  +G L TG+ ADA+  VQ+ R EA EF  ++GY +PV VLA+ +AD SQV
Sbjct  62   SVTNIFKITPAIGALLTGLYADAKAQVQRLRYEAHEFEHKFGYPVPVHVLAKRLADISQV  121

Query  426  YTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMK  605
            YTQHA MR LGV+ +++GIDEEKGPQL+K DPAG+F G+KATSAGVK+QEA N+LEKK+K
Sbjct  122  YTQHASMRALGVITILIGIDEEKGPQLYKIDPAGNFRGYKATSAGVKDQEATNYLEKKIK  181

Query  606  NDPAFSYEETVQTAISALQSV  668
             + +  +E TV  AI+ LQSV
Sbjct  182  ANDSLDHEGTVHCAITCLQSV  202



>gb|ELU01128.1| hypothetical protein CAPTEDRAFT_167909 [Capitella teleta]
Length=246

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            M+R S  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKDS  V TQKKVPDKL
Sbjct  1    MARPSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDSAVVATQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++V+H++P+T  +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDASTVSHVYPITDQIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCQRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QVYTQ A MRPLG + +++  DEE GPQ+++ DPAG+F G KATSAGVK+ EA ++LE
Sbjct  121  INQVYTQSAEMRPLGCIMILIAFDEENGPQVYRTDPAGYFCGCKATSAGVKQVEANSYLE  180

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK++    ++Y+ET++ AI+ L SV
Sbjct  181  KKIRKKQEYNYDETIELAITCLSSV  205



>ref|XP_007873808.1| hypothetical protein PNEG_01835 [Pneumocystis murina B123]
 gb|EMR10086.1| hypothetical protein PNEG_01835 [Pneumocystis murina B123]
Length=254

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 168/207 (81%), Gaps = 3/207 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  GYDRHITIFSPEGRL+QVEYAFK+V + GITS+ ++GKDSV  ++QKKVPDKL
Sbjct  1    MSRGSSTGYDRHITIFSPEGRLYQVEYAFKSVNSTGITSVAIKGKDSVVFISQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            +DQ SV+++F +T+ +G L TG  ADAR  V +AR EAA+F+++YGYE+PVDVLA+ IA+
Sbjct  61   IDQDSVSYIFRITENIGCLVTGQIADARASVNRARVEAADFKYKYGYEIPVDVLAKRIAN  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             +QV TQ A MRPLG+ ++ + IDEEKGPQ+FKCD AG++ G+KAT++G K+QEAIN+LE
Sbjct  121  INQVCTQRAAMRPLGISSIFIAIDEEKGPQIFKCDLAGYYAGYKATASGPKKQEAINYLE  180

Query  594  KKMKNDPAF--SYEETVQTAISALQSV  668
            KK+K+D  F  S+ +  + AI+ L SV
Sbjct  181  KKLKSD-GFEGSWIDITELAINTLSSV  206



>ref|XP_008993532.1| PREDICTED: LOW QUALITY PROTEIN: proteasome subunit alpha type-6-like 
[Callithrix jacchus]
Length=244

 Score =   267 bits (682),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  54   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  233
            MSRGS  G++RHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFERHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  234  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  413
            LD ++VTHLF +T+ +G L TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCLMTGMTADSRSQVQRARXEAANWKYKYGYEIPVDMLCKRIAD  120

Query  414  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  593
             SQVYTQ+A    L    +++GIDE +GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNA--EXLSCCMILIGIDEGQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  178

Query  594  KKMKNDPAFSYEETVQTAISALQSV  668
            KK+K    +++E+TV+TAI+ L +V
Sbjct  179  KKVKKKFDWTFEQTVETAITCLSTV  203



>ref|XP_009831249.1| hypothetical protein H257_07425 [Aphanomyces astaci]
 gb|ETV79408.1| hypothetical protein H257_07425 [Aphanomyces astaci]
Length=242

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = +3

Query  66   SGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQT  245
            SG GYDRHITIFSPEGRLFQ+EYAFKAVK + +TS+ VRG  S  VVTQKKVPDKL+D  
Sbjct  2    SGDGYDRHITIFSPEGRLFQIEYAFKAVKESNLTSVAVRGATSCVVVTQKKVPDKLIDPD  61

Query  246  SVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQV  425
            SVT++F +T  +G L TG+ ADA+  VQ+ R EA EF  ++GY +PV VLA+ +AD SQV
Sbjct  62   SVTNIFKITPAIGALLTGLYADAKAQVQRLRYEAHEFENKFGYPVPVHVLAKRLADISQV  121

Query  426  YTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMK  605
            YTQHA MR LGVV +++GIDEEKGPQL+K DPAG++ G+KATSAGVK+QEA N+LEKK+K
Sbjct  122  YTQHASMRALGVVTILIGIDEEKGPQLYKVDPAGNYRGYKATSAGVKDQEATNYLEKKIK  181

Query  606  NDPAFSYEETVQTAISALQSV  668
             + +  +E TV  AI+ LQSV
Sbjct  182  ANDSLDHEGTVHCAITCLQSV  202



>ref|XP_007688022.1| hypothetical protein COCMIDRAFT_5367 [Bipolaris oryzae ATCC 44560]
 ref|XP_007695112.1| hypothetical protein COCSADRAFT_177576 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007714363.1| hypothetical protein COCCADRAFT_6761 [Bipolaris zeicola 26-R-13]
 gb|EMD69927.1| hypothetical protein COCSADRAFT_177576 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD86199.1| hypothetical protein COCHEDRAFT_1023953 [Bipolaris maydis C5]
 gb|ENI06147.1| hypothetical protein COCC4DRAFT_166277 [Bipolaris maydis ATCC 
48331]
 gb|EUC31307.1| hypothetical protein COCCADRAFT_6761 [Bipolaris zeicola 26-R-13]
 gb|EUC45461.1| hypothetical protein COCMIDRAFT_5367 [Bipolaris oryzae ATCC 44560]
 gb|EUN24279.1| hypothetical protein COCVIDRAFT_18335 [Bipolaris victoriae FI3]
Length=254

 Score =   266 bits (681),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 160/200 (80%), Gaps = 2/200 (1%)
 Frame = +3

Query  75   GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVT  254
            GYDRHITIFS +GRL+QVEYAFKA+ AA ITS+GVRGKD   V++QKKVPDKL+D +SV+
Sbjct  6    GYDRHITIFSDQGRLYQVEYAFKAITAANITSLGVRGKDCAVVISQKKVPDKLIDPSSVS  65

Query  255  HLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQ  434
            H+F ++  +G + TG  ADAR  V +AR EAAEFR++YGYEMP DVLA+ IA+ SQVYTQ
Sbjct  66   HIFRLSPSVGCVMTGSIADARASVSRARGEAAEFRYKYGYEMPCDVLAKRIANISQVYTQ  125

Query  435  HAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKND-  611
             AYMRPLGV   ++ +D E GPQL+KCDPAG++ G+KAT++G K QEA+NFLEKK+KN  
Sbjct  126  RAYMRPLGVATTLISLDSEYGPQLYKCDPAGYYVGYKATASGPKTQEALNFLEKKLKNKE  185

Query  612  -PAFSYEETVQTAISALQSV  668
                ++EE V+ AI+AL +V
Sbjct  186  HADGNWEEVVELAITALSTV  205



>gb|ETI45522.1| hypothetical protein F443_09944 [Phytophthora parasitica P1569]
 gb|ETK85476.1| hypothetical protein L915_09741 [Phytophthora parasitica]
 gb|ETL38875.1| hypothetical protein L916_09645 [Phytophthora parasitica]
 gb|ETL92024.1| hypothetical protein L917_09568 [Phytophthora parasitica]
 gb|ETM45321.1| hypothetical protein L914_09611 [Phytophthora parasitica]
 gb|ETO74136.1| hypothetical protein F444_10040 [Phytophthora parasitica P1976]
 gb|ETP15302.1| hypothetical protein F441_09894 [Phytophthora parasitica CJ01A1]
 gb|ETP43379.1| hypothetical protein F442_09848 [Phytophthora parasitica P10297]
Length=242

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = +3

Query  69   GGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTS  248
            G GYDRHITIFSPEGRL+Q+EYAF+A K + +TS+ VRGKDS   VTQKKV DKL++  S
Sbjct  3    GDGYDRHITIFSPEGRLYQIEYAFRAAKESTLTSVAVRGKDSAVFVTQKKVQDKLIEPDS  62

Query  249  VTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVY  428
            VT++F +T  +G L TG+ AD++  VQ+ R EA EF  ++GY++P  VLA+ IAD +QVY
Sbjct  63   VTNVFQITPEIGCLMTGLYADSKAQVQRLRYEAHEFENKFGYKIPCHVLAKRIADVAQVY  122

Query  429  TQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKN  608
            TQHA MR  GV+ M++ +D+EKGPQLFK DPAGHF+G+KATSAGVKEQEA N+LEKK+K 
Sbjct  123  TQHASMRAFGVITMLISVDDEKGPQLFKIDPAGHFWGYKATSAGVKEQEAQNYLEKKIKA  182

Query  609  DPAFSYEETVQTAISALQSV  668
            +PA  YE T+ TAI+ LQSV
Sbjct  183  NPAMDYETTLHTAITCLQSV  202



>ref|XP_009526410.1| hypothetical protein PHYSODRAFT_285915 [Phytophthora sojae]
 gb|EGZ17352.1| hypothetical protein PHYSODRAFT_285915 [Phytophthora sojae]
Length=242

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = +3

Query  69   GGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTS  248
            G GYDRHITIFSPEGRL+Q+EYAF+A K + +TS+ VRGKDS   VTQKKV DKL++  S
Sbjct  3    GDGYDRHITIFSPEGRLYQIEYAFRAAKESTLTSVAVRGKDSAVFVTQKKVQDKLIEPDS  62

Query  249  VTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVY  428
            VT++F +T  +G L TG+ AD++  VQ+ R EA EF  ++GY++P  VLA+ IAD +QVY
Sbjct  63   VTNVFQITPEIGCLMTGLYADSKAQVQRLRYEAHEFENKFGYKIPCHVLAKRIADVAQVY  122

Query  429  TQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKN  608
            TQHA MR  GVV M++ +D+EKGPQLFK DPAGHF+G+KATSAGVKEQEA N+LEKK+K 
Sbjct  123  TQHASMRAFGVVTMLISVDDEKGPQLFKIDPAGHFWGYKATSAGVKEQEAQNYLEKKIKA  182

Query  609  DPAFSYEETVQTAISALQSV  668
            +PA  YE T+ TAI+ LQSV
Sbjct  183  NPAMDYETTLHTAITCLQSV  202



>ref|XP_003303796.1| hypothetical protein PTT_16156 [Pyrenophora teres f. teres 0-1]
 gb|EFQ88118.1| hypothetical protein PTT_16156 [Pyrenophora teres f. teres 0-1]
Length=254

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 160/200 (80%), Gaps = 2/200 (1%)
 Frame = +3

Query  75   GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVT  254
            GYDRHITIFS +GRL+QVEYAFKA+ AA ITS+GVRGKD   V++QKKVPDKL+D +SV+
Sbjct  6    GYDRHITIFSDQGRLYQVEYAFKAITAANITSLGVRGKDCAVVISQKKVPDKLIDPSSVS  65

Query  255  HLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQ  434
            H+F ++  +G + TG  ADAR  V +AR EAAEFR+++GYEMP DVLA+ IA+ SQVYTQ
Sbjct  66   HIFRLSPSVGCVMTGSIADARASVSRARGEAAEFRYKFGYEMPCDVLAKRIANISQVYTQ  125

Query  435  HAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKND-  611
             AYMRPLGV   ++ +D E GPQL+KCDPAG++ G+KAT++G K QEA+NFLEKK+KN  
Sbjct  126  RAYMRPLGVATTLISLDSEFGPQLYKCDPAGYYVGYKATASGPKTQEALNFLEKKLKNKE  185

Query  612  -PAFSYEETVQTAISALQSV  668
                S+EE V+ AI+AL +V
Sbjct  186  HAEGSWEEVVELAITALSTV  205



>ref|XP_001931683.1| proteasome subunit alpha type-6 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU40788.1| proteasome subunit alpha type-6 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=254

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 160/200 (80%), Gaps = 2/200 (1%)
 Frame = +3

Query  75   GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVT  254
            GYDRHITIFS +GRL+QVEYAFKA+ AA ITS+GVRGKD   V++QKKVPDKL+D +SV+
Sbjct  6    GYDRHITIFSDQGRLYQVEYAFKAITAANITSLGVRGKDCAVVISQKKVPDKLIDPSSVS  65

Query  255  HLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQ  434
            H+F ++  +G + TG  ADAR  V +AR EAAEFR+++GYEMP DVLA+ IA+ SQVYTQ
Sbjct  66   HIFRLSPSVGCVMTGSIADARASVSRARGEAAEFRYKFGYEMPCDVLAKRIANISQVYTQ  125

Query  435  HAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKND-  611
             AYMRPLGV   ++ +D E GPQL+KCDPAG++ G+KAT++G K QEA+NFLEKK+KN  
Sbjct  126  RAYMRPLGVATTLISLDSEFGPQLYKCDPAGYYVGYKATASGPKTQEALNFLEKKLKNKE  185

Query  612  -PAFSYEETVQTAISALQSV  668
                S+EE V+ AI+AL +V
Sbjct  186  HAEGSWEEVVELAITALSTV  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780