BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047L16

Length=727
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           434   5e-145   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       432   3e-144   Ipomoea batatas [batate]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             405   1e-133   Nicotiana tomentosiformis
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   405   1e-133   Ipomoea nil [qian niu]
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            389   2e-133   Glehnia littoralis
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       403   8e-133   Ipomoea batatas [batate]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           402   2e-132   Nicotiana attenuata
gb|AAC33966.1|  phenylalanine ammonia-lyase                             395   4e-132   Capsicum chinense [bonnet pepper]
gb|AET41698.1|  phenylalanine ammonia-lyase                             386   1e-131   Prunus salicina [Japanese plum]
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            386   1e-131   Lotus japonicus
gb|AGT63063.1|  phenylalanine ammonia-lyase                             399   4e-131   Solanum tuberosum [potatoes]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           398   5e-131   Nicotiana attenuata
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             398   6e-131   Nicotiana sylvestris
gb|ACF94717.1|  phenylalanine ammonia lyase                             384   6e-131   Robinia pseudoacacia [black locust]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             397   1e-130   Nicotiana tomentosiformis
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           384   2e-130   Eriobotrya japonica [loquat]
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            381   2e-130   Glehnia littoralis
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        397   2e-130   
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             396   2e-130   Nicotiana sylvestris
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    396   3e-130   Capsicum annuum
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    396   3e-130   Solanum lycopersicum
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       396   3e-130   Stylosanthes humilis [alfafinha do nordeste]
gb|ACF94715.1|  phenylalanine ammonia lyase                             383   4e-130   Robinia pseudoacacia [black locust]
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            395   4e-130   Lotus japonicus
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             396   4e-130   Solanum lycopersicum
gb|AIB08913.1|  phenylalanine ammonia-lyase                             379   4e-130   Angelica sinensis [Chinese angelica]
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            380   7e-130   Glehnia littoralis
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            390   2e-129   Lotus japonicus
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        385   2e-129   
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       394   2e-129   Nicotiana tabacum [American tobacco]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       394   2e-129   Nicotiana tabacum [American tobacco]
gb|AIA66448.1|  PAL1                                                    394   3e-129   Capsicum annuum
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            377   4e-129   Phaseolus vulgaris [French bean]
gb|ACA30407.1|  phenylalanine ammonia-lyase                             393   5e-129   Stylosanthes guianensis [stylo]
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 379   6e-129   Manihot esculenta [manioc]
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             379   7e-129   
dbj|BAA95629.1|  phenylalanine ammonia lyase                            393   7e-129   Catharanthus roseus [chatas]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             392   9e-129   Gossypium arboreum [tree cotton]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        392   2e-128   Cicer arietinum [garbanzo]
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      383   2e-128   
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    392   2e-128   
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    392   2e-128   Solanum tuberosum [potatoes]
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            392   2e-128   Lotus japonicus
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              391   3e-128   Ricinus communis
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             391   3e-128   Olea europaea
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           388   3e-128   Glycine soja [wild soybean]
gb|AFC37247.1|  phenylalanine ammonia-lyase                             377   4e-128   Camellia chekiangoleosa
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   380   4e-128   Citrus sinensis [apfelsine]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           390   4e-128   Manihot esculenta [manioc]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      390   5e-128   
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        390   6e-128   Solanum tuberosum [potatoes]
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       374   7e-128   Malus domestica [apple tree]
emb|CDP06747.1|  unnamed protein product                                385   1e-127   Coffea canephora [robusta coffee]
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            380   1e-127   Lotus japonicus
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           387   1e-127   Glycine soja [wild soybean]
gb|ACF94716.1|  phenylalanine ammonia lyase                             390   1e-127   Robinia pseudoacacia [black locust]
gb|AFP24940.1|  phenylalanine ammonia lyase                             389   1e-127   Prunus salicina [Japanese plum]
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             375   2e-127   Vitis vinifera
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        389   2e-127   Solanum tuberosum [potatoes]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          389   3e-127   Populus euphratica
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           389   3e-127   
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            388   3e-127   Lotus japonicus
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    389   3e-127   Solanum lycopersicum
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     389   3e-127   Prunus avium [gean]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     389   3e-127   Petroselinum crispum
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    379   3e-127
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             389   4e-127   
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 388   4e-127   Pyrus x bretschneideri [bai li]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             388   4e-127   Pyrus x bretschneideri [bai li]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           388   5e-127   Prunus mume [ume]
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           385   5e-127   Glycine soja [wild soybean]
gb|AFG30054.1|  phenylalanine ammonialyase                              388   5e-127   Malus hybrid cultivar
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    388   5e-127   Pyrus x bretschneideri [bai li]
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    388   6e-127   
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    388   6e-127   Glycine max [soybeans]
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           388   6e-127   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      388   6e-127   
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            388   7e-127   Daucus carota [carrots]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        387   7e-127   Cicer arietinum [garbanzo]
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        388   8e-127   Solanum tuberosum [potatoes]
gb|ACT32033.1|  phenylalanine ammonia-lyase                             387   9e-127   Glycine soja [wild soybean]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    387   9e-127   Gossypium raimondii
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             387   9e-127   Sesamum indicum [beniseed]
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    387   1e-126   Solanum tuberosum [potatoes]
dbj|BAD94354.1|  phenylalanine ammonia lyase                            375   1e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AGL50914.1|  phenylalanine ammonia lyase                             387   1e-126   Pyrus communis
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            387   1e-126   Daucus carota [carrots]
gb|AGL81344.1|  phenylalanine ammonia lyase                             387   1e-126   Pyrus communis
gb|ABB70117.2|  phenylalanine ammonia lyase                             387   1e-126   Pyrus communis
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           387   1e-126   Malus domestica [apple tree]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        387   1e-126   Medicago truncatula
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           386   1e-126   Glycine soja [wild soybean]
emb|CDP20698.1|  unnamed protein product                                385   2e-126   Coffea canephora [robusta coffee]
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    387   2e-126   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      387   2e-126   Cicer arietinum [garbanzo]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      387   2e-126   
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             386   2e-126   Populus tomentosa [Chinese white poplar]
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            387   2e-126   Lotus japonicus
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             370   2e-126   Pyrus pyrifolia [sha li]
gb|ADR78835.1|  phenylalanine ammonia lyase                             382   2e-126   Ziziphus jujuba [Chinese jujube]
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     384   2e-126   Glycine soja [wild soybean]
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 386   2e-126   Pyrus x bretschneideri [bai li]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         386   3e-126   Populus trichocarpa [western balsam poplar]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             386   3e-126   Morus alba
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            385   3e-126   Lotus japonicus
gb|AGF50184.1|  phenylalanine ammonia lyase                             371   4e-126   Salvia virgata
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       376   4e-126   Vitis vinifera
gb|ACR56688.1|  phenylalanine ammonia-lyase                             385   4e-126   Scutellaria viscidula [zhan mao huang qin]
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           385   4e-126   Coffea canephora [robusta coffee]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     385   4e-126   Glycine max [soybeans]
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                386   4e-126   Medicago truncatula
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        382   4e-126   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       386   4e-126   Medicago sativa [alfalfa]
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            385   5e-126   Lotus japonicus
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           385   5e-126   Coffea arabica [arabica coffee]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   385   5e-126   Populus tremuloides
gb|AEY94464.1|  phenylalanine ammonia-lyase                             373   5e-126   Prunella vulgaris
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       385   5e-126   Camellia sinensis [black tea]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      385   6e-126   
gb|ACV30588.1|  phenylalanine ammonia-lyase                             370   7e-126   Carica papaya [mamon]
gb|AAU08174.1|  phenylalanine ammonia-lyase                             385   9e-126   Camellia sinensis [black tea]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             385   9e-126   Citrus clementina [clementine]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            384   1e-125   Melissa officinalis [sweet balm]
gb|KJB46526.1|  hypothetical protein B456_007G373700                    383   1e-125   Gossypium raimondii
gb|AEW43005.1|  phenylalanine ammonia lyase                             373   1e-125   Leucaena leucocephala [cassie]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             384   1e-125   Angelica gigas
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   385   1e-125   Citrus sinensis [apfelsine]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             384   1e-125   Prunus persica
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      384   1e-125   
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       384   2e-125   Pisum sativum [garden pea]
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       384   2e-125   Pisum sativum [garden pea]
gb|AAA34179.2|  phenylalanine ammonia lyase                             384   2e-125   Solanum lycopersicum
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    384   2e-125   Solanum lycopersicum
prf||2001451A  Phe ammonia lyase                                        384   2e-125
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        384   2e-125   Solanum tuberosum [potatoes]
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      383   4e-125   Citrus sinensis [apfelsine]
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        377   4e-125   
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    383   4e-125   
gb|KJB46525.1|  hypothetical protein B456_007G373600                    383   4e-125   Gossypium raimondii
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    383   5e-125   
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      383   5e-125   Glycine max [soybeans]
gb|ACC63889.1|  phenylalanine ammonia-lyase                             382   6e-125   Populus trichocarpa [western balsam poplar]
gb|AIB06732.1|  phenylalanine ammonia lyase                             382   6e-125   Mangifera indica
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    383   6e-125   
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             382   7e-125   Citrus clementina [clementine]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             382   7e-125   Populus szechuanica
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             382   7e-125   Citrus clementina [clementine]
emb|CAA34715.1|  unnamed protein product                                378   7e-125   Petroselinum crispum
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 383   7e-125   Rubus idaeus [European raspberry]
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   382   9e-125   Trifolium pratense [peavine clover]
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             382   1e-124   Vitis vinifera
gb|AGF50183.1|  phenylalanine ammonia lyase                             367   1e-124   Salvia hypoleuca
gb|AAQ74878.1|  phenylalanine ammonia lyase                             382   1e-124   Populus trichocarpa x Populus deltoides
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           382   1e-124   Scutellaria baicalensis [Baikal skullcap]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       382   1e-124   Citrus limon [lemon]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             382   2e-124   Phaseolus vulgaris [French bean]
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                384   2e-124   Erythranthe guttata [common monkey flower]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             381   2e-124   Trifolium pratense [peavine clover]
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             379   2e-124   
ref|XP_007016787.1|  PHE ammonia lyase 1                                381   2e-124   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             381   3e-124   Vitis vinifera
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          369   3e-124   Cynara cardunculus var. scolymus [artichoke]
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           380   3e-124   Prunus domestica
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           368   3e-124   Eriobotrya japonica [loquat]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         381   3e-124   Populus trichocarpa [western balsam poplar]
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             380   3e-124   
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             380   3e-124   Sesamum indicum [beniseed]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             380   4e-124   Populus tomentosa [Chinese white poplar]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     381   4e-124   Solanum tuberosum [potatoes]
gb|AAY82485.1|  phenylalanine ammonia-lyase                             374   4e-124   Ulmus americana
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 380   5e-124   Manihot esculenta [manioc]
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                380   5e-124   Medicago truncatula
gb|AGH13333.1|  phenylalanine ammonia-lyase                             380   5e-124   Rhus chinensis
gb|AEX32790.1|  phenylalanine ammonia-lyase                             380   6e-124   Vitis vinifera
gb|AAX84839.1|  phenylalanine ammonia-lyase                             380   7e-124   Astragalus mongholicus
dbj|BAM28965.1|  phenylalanine ammonia lyase                            366   8e-124   Lilium hybrid division I
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           380   8e-124   Prunus mume [ume]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             380   9e-124   Phaseolus vulgaris [French bean]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             380   9e-124   Garcinia mangostana [mangosteen]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             379   9e-124   Vitis vinifera
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             380   9e-124   Gossypium arboreum [tree cotton]
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      374   1e-123   
gb|ABV71917.1|  PAL                                                     363   1e-123   Plectranthus scutellarioides
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    379   1e-123   Petroselinum crispum
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   379   1e-123   Populus tremuloides
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     379   1e-123   Daucus carota [carrots]
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        379   1e-123   Vitis vinifera
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             379   1e-123   Vitis vinifera
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     379   1e-123   Petroselinum crispum
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             379   1e-123   Capsella rubella
gb|AFG26322.1|  phenylalanine ammonia-lyase                             379   1e-123   Cinnamomum osmophloeum
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             378   2e-123   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            379   2e-123   Vigna radiata [mung bean]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   379   2e-123   Rehmannia glutinosa [Chinese foxglove]
gb|AID16077.1|  phenylalanine ammonium lyase                            379   2e-123   Morus alba
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        379   2e-123   Vitis vinifera
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             378   3e-123   Vitis vinifera
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    374   3e-123   Populus sieboldii x Populus grandidentata
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             379   3e-123   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    378   3e-123   Phaseolus vulgaris [French bean]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        378   3e-123   Populus euphratica
gb|KJB36583.1|  hypothetical protein B456_006G166000                    378   3e-123   Gossypium raimondii
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    374   4e-123
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        378   4e-123   Vitis vinifera
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             378   4e-123   
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    371   5e-123
gb|AEJ88223.1|  phenylalanine ammonia lyase                             378   5e-123   Prunus persica
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           378   5e-123   Fragaria vesca subsp. vesca
gb|ABM67591.1|  phenylalanin ammonia-lyase                              377   5e-123   Vitis vinifera
gb|AJO53273.1|  phenylalanine ammonia-lyase                             377   5e-123   Pogostemon cablin
gb|AIZ76770.1|  PAL2                                                    366   5e-123   Pyrus pyrifolia [sha li]
emb|CDY18464.1|  BnaA04g21230D                                          368   5e-123   Brassica napus [oilseed rape]
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    371   6e-123   Phaseolus vulgaris [French bean]
gb|ABD42947.1|  phenylalanine ammonia lyase                             377   6e-123   Acacia auriculiformis x Acacia mangium
gb|AIZ76768.1|  PAL2                                                    366   6e-123   Pyrus pyrifolia [sha li]
gb|AAR31107.1|  phenylalanine ammonia-lyase                             377   6e-123   Quercus suber [cork oak]
gb|AGE10589.1|  phenylalanine amononia-lyase                            377   6e-123   Lonicera japonica [Japanese honeysuckle]
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        377   6e-123   Vitis vinifera
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         378   7e-123   Arabidopsis thaliana [mouse-ear cress]
prf||2006271A  Phe ammonia lyase                                        378   7e-123
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       377   7e-123   Trifolium subterraneum
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             377   7e-123   Astragalus membranaceus
gb|ACE95170.1|  phenylalanine ammonia-lyase                             377   7e-123   Populus tomentosa [Chinese white poplar]
gb|AAC18870.1|  phenylalanine ammonia lyase                             377   8e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AEE81750.1|  phenylalanine ammonia lyase                             377   8e-123   Morus alba var. multicaulis
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              377   8e-123   Ricinus communis
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             377   9e-123   Vitis vinifera
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            377   9e-123   Lotus japonicus
gb|AAY82486.1|  phenylalanine ammonia-lyase                             374   1e-122   Ulmus pumila [dwarf elm]
gb|AHY94892.1|  phenylalanine ammonia lyase                             377   1e-122   Prunella vulgaris
gb|AAZ29732.1|  phenylalanine ammonia lyase                             377   1e-122   Trifolium pratense [peavine clover]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          377   1e-122   Vitis vinifera
emb|CAN77065.1|  hypothetical protein VITISV_009233                     377   1e-122   Vitis vinifera
gb|ACS71953.1|  phenylalanine ammonia-lyase                             377   2e-122   Euphorbia pulcherrima
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           377   2e-122   Camelina sativa [gold-of-pleasure]
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             376   2e-122   Vitis vinifera
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        376   2e-122   Medicago truncatula
gb|ACM44926.1|  phenylalanine ammonia-lyase                             376   2e-122   Euphorbia pulcherrima
emb|CAN61378.1|  hypothetical protein VITISV_032212                     375   2e-122   Vitis vinifera
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             376   2e-122   Perilla frutescens [beefsteak-mint]
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             376   2e-122   
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          376   2e-122   Cynara cardunculus var. scolymus [artichoke]
gb|ABF50788.1|  phenylalanine ammonia-lyase                             376   3e-122   Isatis tinctoria [woad]
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     376   3e-122   Petroselinum crispum
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             375   3e-122   Vitis vinifera
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         375   3e-122   Populus trichocarpa [western balsam poplar]
gb|AAZ29734.1|  phenylalanine ammonia lyase                             376   3e-122   Trifolium pratense [peavine clover]
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    375   3e-122   Populus sieboldii x Populus grandidentata
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       375   4e-122   Populus trichocarpa [western balsam poplar]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             375   4e-122   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007027354.1|  PHE ammonia lyase 1                                375   4e-122   Theobroma cacao [chocolate]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    375   5e-122   Gossypium raimondii
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       375   5e-122   Digitalis lanata [Grecian foxglove]
gb|AIY26016.1|  PAL                                                     375   5e-122   Jasminum sambac [Arabian jasmine]
gb|ABI33979.1|  phenylalanine ammonia lyase                             375   6e-122   Jatropha curcas
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      375   1e-121   Camelina sativa [gold-of-pleasure]
gb|ABC69916.1|  phenylalanine ammonia-lyase                             375   1e-121   Brassica napus [oilseed rape]
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            375   1e-121   Brassica oleracea var. botrytis [cauliflower]
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           374   1e-121   Brassica rapa
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             374   1e-121   Eutrema salsugineum [saltwater cress]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             374   1e-121   Hibiscus cannabinus [bimli-jute]
gb|AGF50182.1|  phenylalanine ammonia lyase                             360   1e-121   Salvia officinalis
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             374   1e-121   Populus tomentosa [Chinese white poplar]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         374   1e-121   Populus trichocarpa [western balsam poplar]
gb|ADY02660.1|  phenylalanine ammonia lyase                             374   1e-121   Parrya nudicaulis
gb|AGY49231.1|  phenylalanine ammonia lyase                             374   1e-121   Ricinus communis
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             374   2e-121   Capsella rubella
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      374   2e-121   Cucumis melo [Oriental melon]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             374   2e-121   Gossypium arboreum [tree cotton]
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             374   2e-121   Phaseolus vulgaris [French bean]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     374   2e-121   Nicotiana tomentosiformis
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      374   2e-121   Tarenaya hassleriana [spider flower]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            374   2e-121   Populus sieboldii x Populus grandidentata
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   369   2e-121   Citrus sinensis [apfelsine]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             374   2e-121   Plectranthus scutellarioides
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           373   2e-121   Scutellaria baicalensis [Baikal skullcap]
gb|AIZ76769.1|  PAL2                                                    367   2e-121   Pyrus pyrifolia [sha li]
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         373   2e-121   Jatropha curcas
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             373   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      373   3e-121   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      374   3e-121   
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           373   3e-121   
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 370   3e-121   
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             373   3e-121   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             373   3e-121   
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            373   3e-121   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             373   4e-121   
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             373   4e-121   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           373   4e-121   
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        373   4e-121   
gb|KJB16792.1|  hypothetical protein B456_002G248000                    373   4e-121   
gb|AER12109.1|  PAL                                                     373   5e-121   
gb|ADY02661.1|  phenylalanine ammonia lyase                             371   5e-121   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             372   6e-121   
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           372   7e-121   
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             372   9e-121   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             370   9e-121   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    372   9e-121   
gb|AIZ76767.1|  PAL2                                                    367   1e-120   
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             372   1e-120   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       371   1e-120   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    372   1e-120   
dbj|BAH20339.1|  AT3G53260                                              367   1e-120   
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        373   1e-120   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              371   2e-120   
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       355   2e-120   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    371   2e-120   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   2e-120   
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   2e-120   
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         371   2e-120   
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       368   2e-120   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            371   2e-120   
gb|AFU90757.1|  phenylalanine ammonia-lyase                             371   2e-120   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             370   2e-120   
gb|AAM28276.1|  phenylalanine ammonia-lyase                             357   2e-120   
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      371   3e-120   
gb|AGA84059.1|  phenylalanine ammonia lyase                             370   3e-120   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    371   3e-120   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      371   3e-120   
gb|ACZ36441.1|  phenylalanine ammonialyase                              370   3e-120   
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        370   4e-120   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    370   4e-120   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      370   4e-120   
gb|ADY02662.1|  phenylalanine ammonia lyase                             370   4e-120   
gb|ABN79671.2|  phenylalanine ammonia-lyase                             370   5e-120   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             370   5e-120   
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      370   5e-120   
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   370   6e-120   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            370   6e-120   
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        370   6e-120   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           370   6e-120   
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    369   7e-120   
gb|AGV54597.1|  phenylalanine ammonia-lyase                             370   7e-120   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             370   7e-120   
gb|ACR15762.1|  phenylalanine ammonia-lyase                             370   8e-120   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 369   8e-120   
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       364   8e-120   
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        369   8e-120   
gb|ABR14606.1|  phenylalanine ammonia-lyase                             369   8e-120   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             369   9e-120   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             369   1e-119   
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             370   1e-119   
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           370   1e-119   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    369   1e-119   
gb|AJO53274.1|  phenylalanine ammonia-lyase                             369   2e-119   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             369   2e-119   
gb|AAC18871.1|  phenylalanine ammonia lyase                             369   2e-119   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         369   2e-119   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   369   2e-119   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           369   2e-119   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             369   2e-119   
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           368   2e-119   
gb|ADO64252.1|  PAL                                                     368   2e-119   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             367   3e-119   
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          367   3e-119   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             367   5e-119   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           368   5e-119   
gb|AGU91428.1|  phenylalanine ammonia-lyase                             367   5e-119   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    367   5e-119   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            368   5e-119   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      367   5e-119   
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           367   5e-119   
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         367   5e-119   
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            367   7e-119   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            367   7e-119   
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             367   8e-119   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    366   1e-118   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        366   1e-118   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             367   1e-118   
ref|XP_004173358.1|  PREDICTED: phenylalanine ammonia-lyase-like        362   1e-118   
gb|AEH02821.1|  phenylalanine ammonia lyase                             366   1e-118   
gb|ADD82537.1|  phenylalanine ammonia-lyase                             362   1e-118   
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    366   1e-118   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        366   2e-118   
gb|AIE16710.1|  phenylalanine ammonia-lyase                             349   2e-118   
gb|AIL23235.1|  phenylalanine ammonia-lyase                             366   2e-118   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    366   3e-118   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        365   3e-118   
gb|AGE10617.1|  phenylalanine amononia-lyase                            361   3e-118   
gb|ABE03772.1|  phenylalanine ammonia-lyase                             365   4e-118   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             365   4e-118   
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    364   7e-118   
gb|AIA24411.1|  phenylalanine ammonia-lyase                             364   7e-118   
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        364   7e-118   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             364   7e-118   
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           364   8e-118   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            364   1e-117   
gb|AIE16718.1|  phenylalanine ammonia-lyase                             347   1e-117   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           363   1e-117   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             363   1e-117   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           363   1e-117   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            363   1e-117   
gb|AGE10605.1|  phenylalanine amononia-lyase                            349   2e-117   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             363   2e-117   
gb|AFS28702.1|  putative phenylalanine ammonia-lyase                    357   3e-117   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        363   3e-117   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            363   3e-117   
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   363   3e-117   
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                362   3e-117   
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             362   4e-117   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             362   5e-117   
gb|ACT21093.1|  phenylalanine ammonia-lyase                             362   5e-117   
gb|ACG56648.1|  phenylalanine ammonia lyase                             362   5e-117   
gb|AGE10590.1|  phenylalanine amononia-lyase                            362   8e-117   
gb|AIC66437.1|  phenylalanine ammonia lyase                             361   1e-116   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          361   1e-116   
gb|ACG56647.1|  phenylalanine ammonia lyase                             361   2e-116   
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        360   2e-116   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             359   3e-116   
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       360   3e-116   
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        360   3e-116   
gb|ADD12041.1|  phenylalanine ammonia lyase                             360   4e-116   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             360   4e-116   
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        360   4e-116   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        359   5e-116   
emb|CDY00922.1|  BnaC05g42780D                                          359   5e-116   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             360   5e-116   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             359   7e-116   
gb|AGE10591.1|  phenylalanine amononia-lyase                            358   2e-115   
dbj|BAM05604.1|  phenylalanine ammonia lyase                            348   2e-115   
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        358   2e-115   
emb|CDY08611.1|  BnaA05g28470D                                          358   2e-115   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            358   2e-115   
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 357   3e-115   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   3e-115   
gb|AJO53272.1|  phenylalanine ammonia-lyase                             357   4e-115   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             357   4e-115   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             357   5e-115   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            357   5e-115   
gb|AAV98199.1|  phenylalanine ammonialyase 1                            357   7e-115   
gb|AEC11891.1|  PAL1                                                    357   7e-115   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             356   7e-115   
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    355   8e-115   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        356   9e-115   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             356   1e-114   
gb|ACG80829.1|  phenylalanine ammonia lyase                             352   1e-114   
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            353   1e-114   
gb|ACG80828.1|  phenylalanine ammonia lyase                             352   2e-114   
gb|AAW78932.1|  phenylalanine-ammonia lyase                             355   2e-114   
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        355   3e-114   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           355   3e-114   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        355   4e-114   
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        355   4e-114   
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       345   4e-114   
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           355   4e-114   
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           355   6e-114   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    354   6e-114   
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        354   6e-114   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         354   6e-114   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    354   6e-114   
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        354   7e-114   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      354   7e-114   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             354   8e-114   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             353   1e-113   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    353   1e-113   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           353   1e-113   
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     353   1e-113   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        353   2e-113   
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        353   2e-113   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             352   3e-113   
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           352   3e-113   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           352   3e-113   
gb|AHF20178.1|  phenylalanine ammonia lyase                             349   3e-113   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    352   3e-113   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        352   4e-113   
emb|CAA53733.1|  phenylanaline ammonia-lyase                            349   5e-113   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             351   5e-113   
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        352   6e-113   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            351   6e-113   
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     351   1e-112   
gb|ACT22906.1|  phenylalanine ammonia-lyase                             347   1e-112   
dbj|BAC10907.1|  phenylalanine ammonia-lyase 1                          339   1e-112   
gb|ADT63058.1|  phenylalanine ammonia-lyase                             350   2e-112   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            350   3e-112   
gb|ACX31148.1|  phenylalanine ammonialyase                              347   4e-112   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           349   5e-112   
gb|AGZ95690.1|  phenylalanine ammonia-lyase                             348   8e-112   
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        348   8e-112   
gb|AAS48415.1|  phenylalanine lyase                                     348   1e-111   
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   338   1e-111   
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       348   2e-111   
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        348   2e-111   
gb|AID69536.1|  phenylalanine ammonia-lyase                             343   2e-111   
gb|AHA42443.1|  phenylalanine ammonia lyase                             347   2e-111   
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        348   2e-111   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             348   2e-111   
gb|ADO24189.1|  phenylalanine ammonia-lyase                             347   2e-111   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             347   3e-111   
gb|AII00960.1|  phenylalanine ammonia lyase                             337   5e-111   
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        345   2e-110   
ref|XP_010106884.1|  Phenylalanine ammonia-lyase                        342   2e-110   
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        344   5e-110   
gb|AER58180.1|  phenylalanine ammonia lyase                             343   1e-109   
ref|XP_002862326.1|  predicted protein                                  325   4e-109   
emb|CDX74991.1|  BnaA05g07370D                                          331   5e-109   
gb|AEW25950.1|  phenylalanine ammonia-lyase                             331   9e-109   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             339   4e-108   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase-like        339   4e-108   
emb|CDX91331.1|  BnaC04g08190D                                          328   5e-108   
gb|AEX09407.1|  phenylalanine ammonia-lyase                             324   1e-107   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   434 bits (1116),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 221/239 (92%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSST+LVALCQAIDLRHLE+NL+NAV
Sbjct  468  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTFLVALCQAIDLRHLEENLRNAV  527

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAYADDPCS+NYPLMQKLR V
Sbjct  528  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQV  587

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQN       +TSI QKIAAFEDELK  LPKE+EGARS  ENGNPAIPN+IT+CR
Sbjct  588  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  647

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELGTEMLTGEKV+SPGEVCDKVFTAVC+GGIIDPLLECL SW+GAPLP+
Sbjct  648  SYPLYKFIREELGTEMLTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  706



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   432 bits (1111),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 219/239 (92%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  469  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRHLEENLKNAV  528

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            +NTV+QVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAYADDPCS NYPL QKLR V
Sbjct  529  RNTVNQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLFQKLRQV  588

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQN       +TSI QKIAAFEDELK  LPKE+EGARS  ENGNPAIPN+IT+CR
Sbjct  589  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKAVLPKEVEGARSAIENGNPAIPNRITECR  648

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTEMLTGEKV+SPGEVCDKVFTAVC+GGIIDPLLECL SWDGAPLP+
Sbjct  649  SYPLYKFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGAPLPI  707



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   405 bits (1041),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 213/239 (89%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  476  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLR+VDREY+FAYADDPCS NYPLMQKLR V
Sbjct  536  KNTVSQVAKRTLTMGANGELHPARFCEKELLRIVDREYLFAYADDPCSCNYPLMQKLRQV  595

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA+      +N  +SI QKI AFEDELK  LPKE+E AR+  E+GNPAIPN+IT+CR
Sbjct  596  LVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALESGNPAIPNRITECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+ELGTE+LTGEKVRSPGE CDKVFTA+C G IIDP+LECL SW+GAPLP+
Sbjct  656  SYPLYRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPI  714



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   405 bits (1040),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSSTYLVALCQAIDLR LE+NL+NAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRFLEENLRNAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN V+QVAKRTLTMG NGELHP+RFCEKDLLRVVDREYVFAYADDPCS NYPLMQKLR  
Sbjct  532  KNAVTQVAKRTLTMGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQA  591

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQN        TSI  K+AAFEDELK  LPKE+E AR   E+GNPAIPN+I +CR
Sbjct  592  LVDHALQNGESEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGTE+LTGEKVRSPGE CDKVFTA+CEG IIDPLLECL SWDGAPLP+
Sbjct  652  SYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPI  710



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   389 bits (999),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  28   TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  87

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  88   KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  147

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIAAFEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  148  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAALESGNPAIPNRIKECR  207

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE LTGEKVRSPGE  DKVFTA+  G IIDPLLECL SW+GAPLP+
Sbjct  208  SYPLYKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSRGEIIDPLLECLESWNGAPLPI  266



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   403 bits (1035),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSSTYLVALCQAIDLR LE+NL+NAV
Sbjct  468  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRFLEENLRNAV  527

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN V+QVAKRTLT+G NGELHP+RFCEKDLLRVVDREYVFAYADDPCS NYPLMQKLR  
Sbjct  528  KNAVTQVAKRTLTVGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQA  587

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQN        TSI  K+AAFEDELK  LPKE+E AR   E+GNPAIPN+I +CR
Sbjct  588  LVDHALQNGENEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECR  647

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGTE+LTGEKVRSPGE CDKVFTA+CEG IIDPLLECL SWDGAPLP+
Sbjct  648  SYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPI  706



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   402 bits (1033),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 212/239 (89%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQV  597

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDELK  LPKE+E AR+  E+GNPAI N+IT+CR
Sbjct  598  LVDHAMKNGESEKNVNSSIFQKIGAFEDELKAVLPKEVENARAALESGNPAIANRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+ELGTE+LTGE+VRSPGE CDKVFTA+C G IIDP+LECL SW+GAPLP+
Sbjct  658  SYPLYRFVRKELGTELLTGERVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPI  716



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 210/239 (88%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  293  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  352

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS  YPLMQKLR V
Sbjct  353  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQV  412

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  +SI QKIAAFEDELK  LPKE+E AR   E+GNP+IPN+IT+CR
Sbjct  413  LVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECR  472

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGE+VRSPGE  DKVFTA+C G +IDPLLECL SW+GAPLP+
Sbjct  473  SYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQVIDPLLECLKSWNGAPLPI  531



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   386 bits (992),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NL+N V
Sbjct  78   TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  137

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  138  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  197

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE++ AR+  ++G+  +PN+IT+CR
Sbjct  198  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  257

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF+A+CEG IIDP+LECL  W+GAPLP+
Sbjct  258  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPI  316



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   386 bits (991),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK +V
Sbjct  72   TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKYSV  131

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDRE +FAY DDPC   YPLMQKLR V
Sbjct  132  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  191

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKIA FEDELK  LPKE+E AR+ +E+GNPA+PNKI +CR
Sbjct  192  LVDHALVNGEYEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAMPNKINECR  251

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVR+ELGTE+LTGEK RSPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  252  SYPLYKFVRKELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPI  310



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   399 bits (1024),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 210/239 (88%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  483  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  542

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  543  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQV  602

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA+      +N  +SI QKI AFEDELK  LPKE+E AR+  E+GNP+IPN+IT+CR
Sbjct  603  LVDHAMNNGESEKNVNSSIFQKIVAFEDELKAMLPKEVESARAVLESGNPSIPNRITECR  662

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYK VR+ELG+E+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  663  SYPLYKLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLQSWNGAPLPI  721



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   398 bits (1023),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CS NYPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQ      NA +SI QKI AFEDELK  LPKE+E AR   E+GNPAI N+I +CR
Sbjct  593  LVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARIALESGNPAIANRIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG E+LTGEKVRSPGE CDKVFTA+C G IID LLECL  W+GAPLP+
Sbjct  653  SYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPI  711



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   398 bits (1023),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 211/239 (88%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA+      +N  +SI QKI AFEDELK  LPKE+E AR+  E GNPAI N+IT+CR
Sbjct  598  LVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALECGNPAIANRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+ELGTE+LTGE+VRSPGE C+KVFTA+C G IIDP+LECL SW+GAPLP+
Sbjct  658  SYPLYRFVRKELGTELLTGERVRSPGEECEKVFTAMCNGQIIDPMLECLKSWNGAPLPI  716



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   384 bits (987),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK++ 
Sbjct  72   TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKSSA  131

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  132  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  191

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FE+ELK  LPKE+E AR+ +E+GN AIPNKI +CR
Sbjct  192  LVDHALVNGENEKNLNTSIFQKIATFEEELKALLPKEVESARAAYESGNAAIPNKINECR  251

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  252  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  310



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   397 bits (1020),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CS NYPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQ      NA +SI QKI AFEDELK  LPKE+E AR+  E+GNPAI N+I +CR
Sbjct  593  LVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR ELG E+LTGEKVRSPGE CDKVFTA+C G IID LLECL  W+GAPLP+
Sbjct  653  SYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPI  711



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   384 bits (986),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LK MSST+LVALCQAIDLRHLE+NLK+ V
Sbjct  91   TNHVQSAEQHNQDVNSLGLISSRKTTEAVDILKPMSSTFLVALCQAIDLRHLEENLKSTV  150

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCS  YPLMQKLRHV
Sbjct  151  KTTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRHV  210

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIAAFE+ELK  LPKE+E  R+++ENG  AIPN+I +CR
Sbjct  211  LVEHALSNGDKERSTSTSIFQKIAAFEEELKALLPKEVETTRAEYENGKTAIPNRIKECR  270

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT++LTGEKVRSPGE CDKVF+A+C G +IDPLL+CL  W+GAPLP+
Sbjct  271  SYPLYKFVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  329



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   381 bits (979),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  28   TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  87

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  88   KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  147

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIA FEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  148  LVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  207

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREEL T+ LTGEKVRSPGE  DKVFTA+ +G IIDPLL CL SW+GAPLP+
Sbjct  208  SYPLYKFVREELATDYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPI  266



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   397 bits (1020),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 210/239 (88%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL++AV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRSAV  541

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  542  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDELK  LPKE+E AR+  E+GNPAIPN+IT+CR
Sbjct  602  LVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECR  661

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELG+E+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  662  SYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPI  720



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CS NYPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+      NA +SI QKI AFE ELK  LPKE+E AR   ENGNPAI N+I +CR
Sbjct  593  LVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG E+LTGEKVRSPGE CDKVFTA+C G IID LLECL  W+GAPLP+
Sbjct  653  SYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPI  711



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 210/239 (88%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS  YPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  +SI QKIAAFEDELK  LPKE+E AR   E+GNP+IPN+IT+CR
Sbjct  598  LVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGE+VRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  658  SYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPI  716



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 210/239 (88%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL++AV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRSAV  541

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  542  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDELK  LPKE+E AR+  E+GNPAIPN+IT+CR
Sbjct  602  LVDHAMKNGESEKNVNSSIFQKIVAFEDELKAALPKEVESARAVVESGNPAIPNRITECR  661

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELG+E+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  662  SYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPI  720



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT+EAV +LKLMS TYL+ALCQAIDLRHLE+NLKN V
Sbjct  476  TSHVQSAEQHNQDVNSLGLISARKTNEAVEILKLMSPTYLIALCQAIDLRHLEENLKNTV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL++VDREY FAY DDPCS  YPLMQKLR V
Sbjct  536  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSATYPLMQKLRQV  595

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL NA       TSI QKI  FE+ELK  LPKE+EGAR  +ENG  AIPNKI +CR
Sbjct  596  LVEHALANAENEKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYENGQSAIPNKIKECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTEMLTGEKVRSPGE CDK+FTA+C+G IIDPLLEC+  W+GAPLPL
Sbjct  656  SYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPL  714



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   383 bits (984),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN V
Sbjct  93   TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  152

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQ+AKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DD CS  YPLMQKLR V
Sbjct  153  KNTVSQIAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDACSATYPLMQKLRQV  212

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKI  FE+ELK  LPKE+E AR  +ENG  AIPNKI +CR
Sbjct  213  LVDHALANADGEKNLNTSIFQKITTFEEELKTLLPKEVESARVAYENGQCAIPNKIEECR  272

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  273  SYPLYKFVREELGTGLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  331



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   395 bits (1015),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK +V
Sbjct  449  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKYSV  508

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDRE VFAY DDPCS  YPLMQKLR V
Sbjct  509  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETVFAYIDDPCSATYPLMQKLRQV  568

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E AR+ +E+GNPAIPNKI +CR
Sbjct  569  LVDHALVNEENEKNMNTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  628

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGTE+LTGEKVRSPGE CDK+FTA+CEG IIDPLLECL  W+GAPLP+
Sbjct  629  SYPLYKFVREGLGTELLTGEKVRSPGEECDKLFTAICEGKIIDPLLECLGEWNGAPLPI  687



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   396 bits (1017),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 209/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTV QVAKRTLTMG NGELHPSRFCEKDLLR+VDREY+FAYADDPCS NYPLMQKLR V
Sbjct  532  KNTVCQVAKRTLTMGANGELHPSRFCEKDLLRIVDREYLFAYADDPCSANYPLMQKLRQV  591

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HALQ      NA++SI QKI AFE+ELK  LP+E+E AR   E+GNPAI N+I +CR
Sbjct  592  LVEHALQNGENEKNASSSIFQKIVAFEEELKSVLPREVESARVALESGNPAIANRINECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGE+VRSPGE CDKVFTA+C G IID LLECL  W+GAPLP+
Sbjct  652  SYPLYKFVREELGTELLTGERVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPV  710



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   379 bits (974),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 201/233 (86%), Gaps = 6/233 (3%)
 Frame = -2

Query  708  AEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAVKNTVSQ  529
            AEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ VKNTVSQ
Sbjct  1    AEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSQ  60

Query  528  VAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHVLLDHAL  349
            VAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  L++HAL
Sbjct  61   VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHAL  120

Query  348  QNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCRSYPLYK  187
             N       +TSI QKIAAFEDELK  LPKE+E AR+  E+GNPAIPN+I +CRSYPLYK
Sbjct  121  NNGDKERNLSTSIFQKIAAFEDELKTLLPKEVESARAALESGNPAIPNRIKECRSYPLYK  180

Query  186  FVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            FVREELGTE LTGEKVRSPGE  DKVFTA+ +G IIDPLLECL SW+GAPLP+
Sbjct  181  FVREELGTEYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLECLESWNGAPLPI  233



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   380 bits (976),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGL+S+RKT EAV +LKLMS+T+L  L QA+DLRHLE+NLK+ V
Sbjct  28   TNHVQSAEQHNQDVNSLGLVSSRKTAEAVEILKLMSTTFLAGLLQAVDLRHLEENLKSTV  87

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR V
Sbjct  88   KNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  147

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKIAAFEDELK  LPKE+E AR+  E+GNPA+PN+I +CR
Sbjct  148  LVEHALKNGETEKNLSTSIFQKIAAFEDELKTLLPKEVESARAVLESGNPAVPNRIKECR  207

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELGT  LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL SW+GAPLP+
Sbjct  208  SYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMCKGQIIDPLMECLQSWNGAPLPI  266



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NL+ +V
Sbjct  330  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLRYSV  389

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT  ++GELHPSRFCEKDLL+VVDRE VFAY DDPCS  YPLMQKLR V
Sbjct  390  KNTVSQVAKRTLTTSVSGELHPSRFCEKDLLKVVDREVVFAYIDDPCSATYPLMQKLRQV  449

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKI+ FEDELK  LPKE+E AR+ +E+GNP IPNKI +CR
Sbjct  450  LVDHALVNAENEKNQNTSIFQKISTFEDELKSLLPKEVESARNAYESGNPVIPNKINECR  509

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEKVRSPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  510  SYPLYKFVREELGTELLTGEKVRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPI  568



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  217  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  276

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLTMG+NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPL QKLR V
Sbjct  277  KNTVSQVAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  336

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FE+ELK  LPKE+E AR+ +E+GNP IPNKI  CR
Sbjct  337  LVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCR  396

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE V SPGEVCDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  397  SYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  455



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSL LISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  473  TNHVQSAEQHNQDVNSLDLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CS NYPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQ      NA +SI QKI AFEDELK  LPKE+E AR+  E+GNPAI N+I +CR
Sbjct  593  LVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR ELG E+LTGEKVRSPGE CDKVFTA+C G IID LLECL  W+GAPLP+
Sbjct  653  SYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPI  711



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVF YADD CS NYPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFRYADDACSANYPLMQKLRQV  592

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+      NA +SI QKI AFE ELK  LPKE+E AR   ENGNPAI N+I +CR
Sbjct  593  LVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG E+LTGEKVRSPGE CDKVFTA+C G IID LLECL  W+GAPLP+
Sbjct  653  SYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPI  711



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 209/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADD CS  YPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDTCSSTYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  +SI QKIAAFEDELK  LPKE+E AR   E+GNP+IPN+IT+CR
Sbjct  598  LVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGE+VRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  658  SYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPI  716



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   377 bits (968),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT+E++ +LKLMSST+L+ LCQAIDLRHLE+NLK++V
Sbjct  1    TSHVQSAEQHNQDVNSLGLISARKTNESIEILKLMSSTFLMGLCQAIDLRHLEENLKSSV  60

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLR V
Sbjct  61   KNTVSQVSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSGTYPLMQKLRQV  120

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK  LPKE+E  R+ +E+G  AIPNKI +CR
Sbjct  121  LVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECR  180

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  181  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPI  239



>gb|ACA30407.1| phenylalanine ammonia-lyase [Stylosanthes guianensis]
Length=717

 Score =   393 bits (1010),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 185/240 (77%), Positives = 206/240 (86%), Gaps = 6/240 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN V
Sbjct  475  TSHVQSAEQHNQDVNSLGLISARKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL++VDREY FAY DDPCS  YPLMQKLR V
Sbjct  535  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSGTYPLMQKLRQV  594

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL NA       TSI QKI  FE+ELK  LPKE+EGAR  + NG  AIPNKI +CR
Sbjct  595  LVEHALANAENGKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYGNGQSAIPNKIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPLI  25
            SYPLYKFVREELGTEMLTGEKVRSPGE CDK+FTA+C+G IIDPLLEC+  W+GAPLP +
Sbjct  655  SYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECVGEWNGAPLPYV  714



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   379 bits (974),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMS+T+LVALCQAIDLRHLE+NLK+AV
Sbjct  76   TSHVQSAEQHNQDVNSLGLISSRKTEEAVDILKLMSTTFLVALCQAIDLRHLEENLKHAV  135

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CS  YPLMQKLR V
Sbjct  136  KNTVSQVAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQV  195

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TSI QKI AFE+ELK  LPKE+E AR  +ENGNPAI NKI +CR
Sbjct  196  LVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECR  255

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREE+GT +LTGEKVRSPGE  DKVFTA+C+G IIDP+L+CL  W+GAPLP+
Sbjct  256  SYPLYKFVREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPI  314



>ref|XP_006439143.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
 gb|ESR52383.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
Length=308

 Score =   379 bits (973),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLE+NLK+ V
Sbjct  69   TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  128

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNT+SQ AK+ LTMG+NGELHPSRFCEKDLL+VVDREYVF+YADDPCS  YPLM+KLR V
Sbjct  129  KNTISQAAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQV  188

Query  366  LLDHA------LQNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA      L+NA  SI  KI AFE+ELK  LPKE+E ARS FE+GN  IPN+I +CR
Sbjct  189  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  248

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG   LTGEK  SPGE CDKVFTA+C+G IIDPLLECL  WDG+PLP+
Sbjct  249  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI  307



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   393 bits (1009),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTYLVALCQAIDLRHLEENLKNAV  536

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT+G+NGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLM+KLR V
Sbjct  537  KNTVSQVAKRTLTVGVNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLMEKLRQV  596

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHALQN        TSI QKIAAFEDELK  LPKE+E AR+  ENGNPAIPN+I +CR
Sbjct  597  IVDHALQNGESEKNVNTSIFQKIAAFEDELKTVLPKEVESARTALENGNPAIPNRIKECR  656

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE++G E LTGEK RSPGE  DKVFTA+C   IIDPLLECL  W+GAPLP+
Sbjct  657  SYPLYKFVREDVGAEFLTGEKDRSPGEEFDKVFTAMCNEKIIDPLLECLKEWNGAPLPI  715



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   392 bits (1008),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EA+ +LKLMSST++VALCQAIDLRHLE+NLKN V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISARKTAEAIDILKLMSSTFMVALCQAIDLRHLEENLKNTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCS NYPL+QKLR V
Sbjct  531  KNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQV  590

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKI  FE+ELK  LPKE+E AR++FENGNPAIPNKI +CR
Sbjct  591  LVDHALMNGDREKDSTTSIFQKIGVFEEELKTHLPKEVESARTEFENGNPAIPNKIEECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CL  W+GAPLP+
Sbjct  651  SYPLYKFVREVLGTNLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPI  709



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  484  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  543

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  544  KNIVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  603

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E AR+ +E+GNPAIPNKI  CR
Sbjct  604  LVDHALVNGENEKNLNTSIFQKIATFEDELKTLLPKEVESARAAYESGNPAIPNKINGCR  663

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  664  SYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPV  722



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLK+ V
Sbjct  202  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSVV  261

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS  YPLMQKLR V
Sbjct  262  KNTVSQVAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQV  321

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDEL   LPKE+E AR+  E+GNP+IPN+IT+CR
Sbjct  322  LVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECR  381

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGEKVRSPGE  +KVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  382  SYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQIIDPLLECLKSWNGAPLPI  440



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 209/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  480  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC+ NYPLMQKLR V
Sbjct  540  KNTVSQVAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQV  599

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA+      +N  +SI QKI AFEDELK  LPKE+E AR   E+GNPAIPN+IT+CR
Sbjct  600  LVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VREELGTE+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  660  SYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPI  718



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 209/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL+NAV
Sbjct  484  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  543

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC+ NYPLMQKLR V
Sbjct  544  KNTVSQVAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQV  603

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA+      +N  +SI QKI AFEDELK  LPKE+E AR   E+GNPAIPN+IT+CR
Sbjct  604  LVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECR  663

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VREELGTE+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  664  SYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPI  722



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 209/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK++V
Sbjct  478  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKRTLT  +NGELHPSRFCEKDLL+VVDRE +FAY DDPCS  YPLMQKLR V
Sbjct  538  KSTVSQVAKRTLTTSVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCSATYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKIA FEDELK  LPKE+E AR+ +E+GNP IPNKI +CR
Sbjct  598  LVDHALVNGENEKNSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEK RSPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  658  SYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPI  716



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   391 bits (1005),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 209/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSST+LVALCQAIDLRHLE+NLK+ V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREY+FAY DDPCS  YPLMQKLR V
Sbjct  540  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSATYPLMQKLRQV  599

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N++TSI QKI AFE+ELK  LPKE+E AR++++NGNPAIPNKI +CR
Sbjct  600  LVDHALLNGEKEKNSSTSIFQKIGAFEEELKALLPKEVENARTEYDNGNPAIPNKIKECR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEK+RSPGE  DKVF+A+C G +IDP+LECL  W+GAPLP+
Sbjct  660  SYPLYKFVREELGTGLLTGEKIRSPGEEFDKVFSAMCAGKLIDPMLECLKEWNGAPLPI  718



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   391 bits (1004),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLE+NL+NAV
Sbjct  474  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLIALCQAIDLRHLEENLRNAV  533

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS VAK+TLT+G+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  534  KNTVSLVAKKTLTVGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQV  593

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N      A TSI QKI AFEDEL   LPKE+E AR   E+GNPAIPNKI +CR
Sbjct  594  LVEHALKNGETEKEANTSIFQKIGAFEDELIANLPKEVESARIALESGNPAIPNKINECR  653

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEKVRSPGE CDKVFTA+ +G IIDPLLECLN W+G PLP+
Sbjct  654  SYPLYKFVREELGTELLTGEKVRSPGEECDKVFTAMSKGLIIDPLLECLNGWNGEPLPI  712



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ VLKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  380  TTHVQSAEQHNQDVNSLGLISSRKTAEAIDVLKLMSSTFLVALCQAIDLRHLEENLKNTV  439

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT+GINGELHPSRFCEKDLL++VDREYV+AY DDPCS  YPLMQKLR V
Sbjct  440  KNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  499

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQN      ++TSI QKI AFE+EL   LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  500  LVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECR  559

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEKV+SPGE  DKVFTA+CEG  IDPLL+CL  W+GAPLP+
Sbjct  560  SYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPI  618



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   377 bits (968),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLE+NL+N V
Sbjct  69   TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRHLEENLRNTV  128

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN+VSQVAKRTLTMG+NGELHPSRFCEK+LLRVVDRE+VF Y DDPCS  YPLMQKLR V
Sbjct  129  KNSVSQVAKRTLTMGVNGELHPSRFCEKELLRVVDREHVFEYIDDPCSATYPLMQKLRQV  188

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKI AFE+EL   LPKE+E AR   E+GNP IPN+I +CR
Sbjct  189  LVEHALKNGDAEKNVSTSIFQKIRAFEEELMALLPKEVESARRAVESGNPGIPNRIKECR  248

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT  LTGEK  SPGE  DKVFTA+CEG +IDPLL+CL SW+GAPLP+
Sbjct  249  SYPLYKFVREELGTGFLTGEKALSPGEEFDKVFTAMCEGQVIDPLLDCLKSWNGAPLPI  307



>gb|KDO36715.1| hypothetical protein CISIN_1g016039mg [Citrus sinensis]
Length=396

 Score =   380 bits (977),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLE+NLK+ V
Sbjct  157  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  216

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNT+SQVAK+ LTMG+NGELHPSRFCEKDLL+VVDREYVF+YADDPCS  YPLM+KLR V
Sbjct  217  KNTISQVAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQV  276

Query  366  LLDHA------LQNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA      L+NA  SI  KI AFE+ELK  LPKE+E ARS FE+GN  IPN+I +CR
Sbjct  277  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  336

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG   LTGEK  SPGE CDKVFTA+C+G IIDPLLECL  WDG+PLP+
Sbjct  337  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI  395



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   390 bits (1003),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLK  V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKQTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMGINGELHPSRFCEKDLL+VVDREYV+AY DDPCS  YPLMQKLR V
Sbjct  531  KNTVSQVAKRVLTMGINGELHPSRFCEKDLLKVVDREYVYAYVDDPCSATYPLMQKLRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA+      +N++TSI QKI AFE+ELK  LPKE+E AR+++ENGNPAI NKI +CR
Sbjct  591  LVDHAMMNGEKEKNSSTSIFQKIGAFEEELKTLLPKEVESARTEYENGNPAISNKIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG  +LTGEK+RSPGE  DKVF+A+C G +IDP+LECL  W+GAPLP+
Sbjct  651  SYPLYKFVREELGCSLLTGEKIRSPGEEFDKVFSAICAGKLIDPMLECLKEWNGAPLPI  709



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   390 bits (1003),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSST+L+ALCQAIDLRHLE+NLKN V
Sbjct  474  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTFLIALCQAIDLRHLEENLKNTV  533

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AY DDPCS  YPLMQKLR V
Sbjct  534  KNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYVDDPCSATYPLMQKLRQV  593

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKI AFE+ELK  LPKE+EGAR +FENGN AIPN+I +CR
Sbjct  594  LVDHALMNGDREKNSTTSIFQKIGAFEEELKTLLPKEVEGARIEFENGNAAIPNRIEECR  653

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEKV SPGE CDKVF+A+C G +IDPLLECL  W+GAPLP+
Sbjct  654  SYPLYKFVREVLGTSLLTGEKVISPGEECDKVFSAMCAGKLIDPLLECLKEWNGAPLPI  712



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   390 bits (1003),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLK+AV
Sbjct  484  TNHVQSAEQHNQDVNSLGLISARKTVEAVDILKLMSSTYLVALCQAIDLRHLEENLKSAV  543

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  544  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  603

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D A++N        +SI QKI AFEDEL   LPKE+E  R+  E+GNP+IPN+IT+CR
Sbjct  604  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECR  663

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  664  SYPLYRLVRQELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPI  722



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   374 bits (959),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 199/232 (86%), Gaps = 6/232 (3%)
 Frame = -2

Query  705  EQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAVKNTVSQV  526
            EQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N VKNTVSQV
Sbjct  3    EQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQV  62

Query  525  AKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHVLLDHAL-  349
            AKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR VL++HAL 
Sbjct  63   AKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLIEHALT  122

Query  348  -----QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCRSYPLYKF  184
                 +NA+TSI QKI AFE+ELK  LPKE+E ARS  E GN A+PN+I +CRSYPLYKF
Sbjct  123  NGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIEGGNAAVPNRIAECRSYPLYKF  182

Query  183  VREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            VREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  183  VREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  234



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LE+NLKNAV
Sbjct  318  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRFLEENLKNAV  377

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLTMG NGELHPSRFC+KDLLRVVDREY FAY DDPCS  YPLMQKLR V
Sbjct  378  KNIVSQVAKRTLTMGANGELHPSRFCDKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  437

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N        TSI QKIAAFEDELK  LPKE+E ARS  E+GNPAIPN+I +CR
Sbjct  438  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECR  497

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGTE+L+GEK +SPGEV D+VFTA+ +G I+DPLLECL  W+GAPLP+
Sbjct  498  SYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPI  556



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK++V
Sbjct  198  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  257

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKRTLT G++GELHPSRFCEKDLL+VVDRE +FAY DDPC   YPLMQKLR V
Sbjct  258  KSTVSQVAKRTLTTGVSGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  317

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKI +FEDELK  LPKE+E AR+ +E+GNPAIPNKI +CR
Sbjct  318  LVDHALVNGENEKDSKTSIFQKIGSFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  377

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEK RSPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  378  SYPLYKFVREELGTELLTGEKSRSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPI  436



>gb|KHN02334.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=619

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  380  TSHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  439

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G+NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLR V
Sbjct  440  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQV  499

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK FLPKE+E AR  +E+G  AIPNKI +CR
Sbjct  500  LVDHALVNAENEKDMNTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECR  559

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  560  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  618



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   390 bits (1001),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK++ 
Sbjct  480  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKSSA  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  599

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E AR+ +E+GNPAIPNKI +CR
Sbjct  600  LVDHALVNGEYEKNLNTSIFQKIATFEDELKALLPKEVESARAAYESGNPAIPNKIKECR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPG   DK+FTA+C G IIDPLLECL  W+GAPLP+
Sbjct  660  SYPLYKFVREELGTGLLTGEKVRSPGGEFDKLFTAMCRGKIIDPLLECLGEWNGAPLPI  718



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NL+N V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE++ AR+  ++G+  +PN+IT+CR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF+A+CEG IIDP+LECL  W+GAPLP+
Sbjct  658  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPI  716



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   375 bits (964),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  69   TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  128

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  129  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  188

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  189  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  248

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  249  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  307



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   389 bits (999),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  483  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  542

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLTMG NGELHP+RFCEK+LL+VV+REY+F YADDPCS  YPLMQKLR V
Sbjct  543  KNTVSQVAKKTLTMGANGELHPARFCEKELLQVVEREYLFTYADDPCSCTYPLMQKLRQV  602

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDELK  LPKE+E AR   E+GNP IPN+IT+CR
Sbjct  603  LVDHAMKNGESESNVNSSIFQKIVAFEDELKAVLPKEVESARVVLESGNPVIPNRITECR  662

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+ELGTE+LTGEK+RSPGE  DKVFTA C G IIDPLLECL SW+GAPLP+
Sbjct  663  SYPLYRFVRKELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPI  721



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+E+NLKN V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF Y DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL       N++TSI QKI AFE+ELK  LPKE+E AR + ENGNPAIPN+IT+CR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGAFEEELKALLPKEVESARHELENGNPAIPNRITECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECL  W+GAPLPL
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPL  710



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK +V
Sbjct  465  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKYSV  524

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQV KRTLT G+NGELHPSRFCEKDLL+VVDRE +F+Y DDPCS  YPLMQKLR V
Sbjct  525  KSTVSQVVKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFSYIDDPCSATYPLMQKLRQV  584

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKIA FEDELK  LPKE+E AR+ +E+GNP IPNKI +CR
Sbjct  585  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECR  644

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEK RSPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  645  SYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPI  703



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  541

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS  YPLMQKLR V
Sbjct  542  KNTVSQVAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQV  601

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDELK  LPKE+E AR+  E+GNPAIPN+IT+CR
Sbjct  602  LVDHAMKNGESEKNLNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECR  661

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+E+GTE+LTGEKVRSPGE  DKVFTA C G IIDPLLECL SW+GAP+P+
Sbjct  662  SYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPI  720



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NL+N V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE++ AR+  ++G+  +PN+IT+CR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVFTA+CEG IIDP+L+CL  W+GAPLP+
Sbjct  658  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPI  716



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  538

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  539  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  598

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIAAFEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  599  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVETARAALESGNPAIPNRIKECR  658

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE LTGEKVRSPGE  +KVFTA+ +G IIDPLLECL SW+GAPLP+
Sbjct  659  SYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGAPLPI  717



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   379 bits (972),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LV L QAIDLRHLEDNLKN V
Sbjct  177  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLVGLWQAIDLRHLEDNLKNTV  236

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLR V
Sbjct  237  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  296

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+AL      +N  TSI QKIA+FE+ELK  LPKE+EGAR  +EN   AIPNKI +CR
Sbjct  297  LVDYALANGENEKNTNTSIFQKIASFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  356

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDKVFTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  357  SYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGNIIDPLLECLGEWNGAPLPI  415



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   389 bits (998),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  541

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS  YPLMQKLR V
Sbjct  542  KNTVSQVAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQV  601

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDELK  LPKE+E AR+  E+GNPAIPN+IT+CR
Sbjct  602  LVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECR  661

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+E+GTE+LTGEKVRSPGE  DKVFTA C G IIDPLLECL SW+GAP+P+
Sbjct  662  SYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPI  720



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  599

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  600  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  660  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  718



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  599

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  600  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  660  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  718



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NL+N V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE++ AR+  ++G+  +PN+IT+CR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF+A+CEG IIDP+L+CL  W+GAPLP+
Sbjct  658  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPI  716



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   385 bits (989),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  380  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTV  439

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            +NTVSQVAKR LT+GINGELHPSRFCEKDLL++VDREYV+AY DDPCS  YPLMQKLR V
Sbjct  440  RNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  499

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQ      N++TSI QKI AFE+EL   LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  500  LVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECR  559

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEKV+SPGE  DKVFTA+CEG +IDPLL+CL  W GAPLP+
Sbjct  560  SYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPI  618



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  599

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  600  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  660  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  718



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   388 bits (996),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L +HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   388 bits (996),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ VLKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  478  TTHVQSAEQHNQDVNSLGLISSRKTAEAIDVLKLMSSTFLVALCQAIDLRHLEENLKNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT+GINGELHPSRFCEKDLL++VDREYV+AY DDPCS  YPLMQKLR V
Sbjct  538  KNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  597

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQN      ++TSI QKI AFE+EL   LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  598  LVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEKV+SPGE  DKVFTA+CEG  IDPLL+CL  W+GAPLP+
Sbjct  658  SYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPI  716



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   388 bits (996),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CD+VF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   388 bits (996),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L +HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   388 bits (996),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  476  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  536  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  595

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIAAFEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  596  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE LTGEKV SPGE  DKVFTA+ +G IIDPLLECL SW+GAPLP+
Sbjct  656  SYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPI  714



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   387 bits (995),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN V
Sbjct  476  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPC   YPLMQKLR V
Sbjct  536  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDPCLSTYPLMQKLRQV  595

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E AR  +ENG   IPNKI +CR
Sbjct  596  LVDHALVNVDGEKNLNTSIFQKIATFEDELKTLLPKEVESARIAYENGQCGIPNKIKECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEKV SPGE CDK+FTA+C+G I+DPLLECL  W+G+PLP+
Sbjct  656  SYPLYKFVREELGTELLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNGSPLPI  714



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   388 bits (996),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLK+AV
Sbjct  484  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSAV  543

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT+G NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  544  KNTVSQVAKRTLTVGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  603

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D A++N        +SI QKI AFEDEL   LPKE+E  R+  E+GNP+IPN+IT+CR
Sbjct  604  LVDQAMKNGESEKHFNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECR  663

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGEK+RSPGE  DKVFTA C G IIDPLLECL SW+GAPLP+
Sbjct  664  SYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPI  722



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   387 bits (995),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G+NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLR V
Sbjct  533  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQV  592

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK FLPKE+E AR  +E+G  AIPNKI +CR
Sbjct  593  LVDHALVNAENEKDMNTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  653  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  711



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   387 bits (994),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISARKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCS NYPL+QKLR V
Sbjct  531  KNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQV  590

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKI  FE+ELK  LPKE+E AR++FENG+PAI NKI +CR
Sbjct  591  LVDHALMNGDREKDSTTSIFQKIGVFEEELKTQLPKEVESARTEFENGSPAIANKIEECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CL  W+GAPLP+
Sbjct  651  SYPLYKFVREVLGTHLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPI  709



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   387 bits (994),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLE+NL+ AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTIEALDILKLMSSTYLIALCQAIDLRHLEENLRLAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N       +TSI QKI AFEDELK  LPKE+E AR   E+GNPAI N+IT+CR
Sbjct  592  LVDHALKNGDGEKSLSTSIFQKIEAFEDELKALLPKEVESARIALESGNPAIANRITECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELGT  LTGEKV SPGE CDKVFTA+ +G I+DPLL+CL+ W+GAPLP+
Sbjct  652  SYPLYKFIREELGTNFLTGEKVTSPGEECDKVFTALSKGLIVDPLLKCLDGWNGAPLPI  710



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKNAV
Sbjct  480  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLT+G NGELHP+RFCEK+LL+VV+REY+F YADDPCS  YPLMQKLR V
Sbjct  540  KNTVSQVAKKTLTIGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQV  599

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFE+ELK  LPKE+E AR+  E+GNP+IPN+IT+CR
Sbjct  600  LVDHAMKNGVSETNVNSSIFQKIVAFEEELKAVLPKEVESARAMLESGNPSIPNRITECR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGEK+RSPGE  DKVFTA C G IIDPLLECL SW+GAPLP+
Sbjct  660  SYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPI  718



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   375 bits (963),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/239 (72%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLE+NL+  V
Sbjct  118  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  177

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+ YADDPCS  YPL+QKLR V
Sbjct  178  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  237

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LPKE+E AR+ ++NG  AIPN+I +CR
Sbjct  238  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  297

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGTE+LTGEKV SPGE  DKVFTA+CEG IIDP++ECLN W+GAP+P+
Sbjct  298  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPI  356



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CD+VF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+N+K+ V
Sbjct  476  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENMKSTV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  536  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  595

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIAAFEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  596  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE LTGEKV SPGE  DKVFTA+ +G IIDPLLECL SW+GAPLP+
Sbjct  656  SYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPI  714



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CD+VF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLE+NL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CD+VF A+C+G IIDP+L CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPI  719



>ref|XP_008366650.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLK+ V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTFEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLRHV
Sbjct  541  KTTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHV  600

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIAAFE+ELK  LPKE+E  R+++ENG  AIPN+I +CR
Sbjct  601  LVEHALSNGDKEMSTSTSIFQKIAAFEEELKTLLPKEVETTRAEYENGKTAIPNRIKECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT++LTGEKVRSPGE CDKVF+A+C G +I+PLL+CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLINPLLDCLKEWNGAPLPI  719



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NL+N V
Sbjct  473  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLRNTV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAYADDPC   YPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQV  592

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKIA FEDELK  LPKE+E AR+ +ENG   I NKI +CR
Sbjct  593  LVDHALVNTEGEKNSNTSIFQKIATFEDELKAILPKEVESARTAYENGQSGISNKIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDK+FTA+C+G I+DPL+ECL  W+GAPLP+
Sbjct  653  SYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLMECLGEWNGAPLPI  711



>gb|KHN09507.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=701

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  462  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  521

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G+NGELHPSRFCEKDLL+VVDREY+F+Y DDPCS  YPLMQKLR V
Sbjct  522  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQV  581

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       +SI QKIA FE+ELK  LPKE+EGAR+ +E+G  AIPNKI +CR
Sbjct  582  LVDHALVNAESEKDVNSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECR  641

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPL+ECL  W+GAPLP+
Sbjct  642  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPI  700



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   385 bits (990),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LE+NLKNAV
Sbjct  435  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRFLEENLKNAV  494

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCS  YPLMQKLR V
Sbjct  495  KNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  554

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N        TSI QKIAAFEDELK  LPKE+E ARS  ENGNPAIPN+I +CR
Sbjct  555  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVENGNPAIPNRIRKCR  614

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEK +SPGEV D+VFTA+ +G I+DPLLECL  W+GAPLP+
Sbjct  615  SYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMNKGQIVDPLLECLQEWNGAPLPI  673



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   387 bits (993),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G+NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLR V
Sbjct  533  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQV  592

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK FLPKE+E AR  +E+G  AIPNKI +CR
Sbjct  593  LVDHALVNAENEKDMNTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  653  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  711



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   387 bits (993),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRH+E+NLK+ V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTFLVALCQAIDLRHIEENLKSVV  538

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT+G+NGELHPSRFCEKDLL VV+REYVFAY DDPCS  YPLMQKLRHV
Sbjct  539  KNTVSQVAKRVLTVGVNGELHPSRFCEKDLLNVVEREYVFAYIDDPCSATYPLMQKLRHV  598

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+      N++TSI QKI AFE ELK  LPKE+E  R D ENGNPA+PN+I +CR
Sbjct  599  LVDHALENGDREGNSSTSIFQKIGAFEQELKTLLPKEVESVRVDVENGNPAVPNRIIECR  658

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEK+RSPGE CDKVF A+C+G  IDP+L+CL  W+GAPLP+
Sbjct  659  SYPLYKFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGAPLPI  717



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   387 bits (993),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  474  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  533

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G+NGELHPSRFCEKDLL+VVDREY+F+Y DDPCS  YPLMQKLR V
Sbjct  534  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQV  593

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       +SI QKIA FE+ELK  LPKE+EGAR+ +E+G  AIPNKI +CR
Sbjct  594  LVDHALVNAESEKDVNSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECR  653

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPL+ECL  W+GAPLP+
Sbjct  654  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPI  712



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+E+NLKN V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL       N++TSI QKI AFE+ELK  LPKE+E AR + ENGNPAIPN+IT+CR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECL  W+GAPLPL
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPL  710



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMSST+L+ALCQAIDLRHLE+NLK +V
Sbjct  491  TTHVQSAEQHNQDVNSLGLISSRKTNEAVEILKLMSSTFLIALCQAIDLRHLEENLKYSV  550

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDRE VFAY DDPC   YPLMQKLR V
Sbjct  551  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREAVFAYIDDPCLATYPLMQKLRQV  610

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKIA FEDELK  LPKE+E AR+ +E+GNP I NKI +CR
Sbjct  611  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTISNKINECR  670

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEK RSPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  671  SYPLYKFVREELGTELLTGEKSRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPI  729



>gb|AFQ92048.1| phenylalanine ammonia-lyase, partial [Pyrus pyrifolia]
Length=234

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 200/233 (86%), Gaps = 6/233 (3%)
 Frame = -2

Query  708  AEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAVKNTVSQ  529
            AEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLK+ VK TVSQ
Sbjct  1    AEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTVKTTVSQ  60

Query  528  VAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHVLLDHAL  349
            VAKR LT+G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLRHVL++HAL
Sbjct  61   VAKRVLTVGLNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHAL  120

Query  348  QNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCRSYPLYK  187
             N        TSI QKI AFE+ELK  LPKE++ A +++ENG  AIPN+I +CRSYPLYK
Sbjct  121  SNGEKEISTGTSIFQKITAFEEELKTLLPKEVDNAWAEYENGKTAIPNRIKECRSYPLYK  180

Query  186  FVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            FVREELGT++LTG+KVRSPGE CDKVF A+C G +IDPLL+CL  W+GAPLP+
Sbjct  181  FVREELGTDLLTGDKVRSPGEECDKVFNAMCAGKLIDPLLDCLKEWNGAPLPI  233



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQA+DLRHLE+ LKN V
Sbjct  320  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAVDLRHLEEQLKNTV  379

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTV QVAKR LT+G NGELHPSRFCEK+LL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  380  KNTVGQVAKRVLTLGSNGELHPSRFCEKELLQVVDREYVFAYIDDPCSATYPLMQKLRQV  439

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            +++HAL+      NA+TSI QKIAAFE+ELK  LPKE+E AR+++ENGNPAIPNKI + R
Sbjct  440  IVEHALKNGENERNASTSIFQKIAAFEEELKTLLPKEVESARAEYENGNPAIPNKIKERR  499

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG  +LTGEK RSPGE CDKVF+A+  G +IDP+LECL  W+GAPLP+
Sbjct  500  SYPLYKFVREELGAGLLTGEKARSPGEECDKVFSAIYAGKLIDPMLECLKEWNGAPLPI  558



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  380  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  439

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLR V
Sbjct  440  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  499

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+AL      +N  TSI QKIA FE+ELK  LPKE+EGAR  +EN   AIPNKI +CR
Sbjct  500  LVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  559

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDKVFTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  560  SYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI  618



>gb|ADF59062.1| phenylalanine ammonia-lyase 2 precursor [Pyrus x bretschneideri]
Length=720

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLK+ V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTTEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVSQVAKR LT+G NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLRHV
Sbjct  541  KTTVSQVAKRVLTVGFNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHV  600

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIA FE+ELK  LPKE+E  R+++ENG  AIPN+I +CR
Sbjct  601  LVEHALSNGDKERSTSTSIFQKIATFEEELKTLLPKEVETTRAEYENGKTAIPNRIKECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT++LTGEKVRSPGE CDKVF+A+C G +IDPLL+CL  W+GAPLP+
Sbjct  661  SYPLYKFVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  719



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   386 bits (991),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+E+NLKN V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL       N++TSI QKI AFE+ELK  LPKE+E AR + ENGNPAIPN+IT+CR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECL  W+GAPLPL
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPL  710



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   386 bits (992),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LVALCQAIDLRHLE+NL+N V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVALCQAIDLRHLEENLRNTV  546

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  547  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  606

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE++ AR+  ++G+  +PN+IT+CR
Sbjct  607  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  666

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVFTA+CEG IIDP+L+CL  W+GAPLP+
Sbjct  667  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPI  725



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   385 bits (989),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK++V
Sbjct  445  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  504

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDRE +FAY DDPC   YPLMQKLR V
Sbjct  505  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  564

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKIA FEDELK  LPKE+E AR+ +E+GNPAIPNKI +CR
Sbjct  565  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  624

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEK RSPGE  DK+FTA+C+G IIDPL+ECL  W+GAPLP+
Sbjct  625  SYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPI  683



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   371 bits (953),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLE+NLK+AV
Sbjct  43   TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAIDLRHLEENLKHAV  102

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC   YPLMQKLR V
Sbjct  103  KNTVSQVAKRALTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQV  162

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI  FE+ELK  LPKE+E AR   E+G+PA+PN+I +CR
Sbjct  163  LVEHALKNGEGEKNASTSIFQKIEQFEEELKALLPKEVEAARLALESGSPAVPNRIAECR  222

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG   LTGEK  SPGE CDKVFTA+C G I+DPLL+CL  W+G PLP+
Sbjct  223  SYPLYKFVREELGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPI  281



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  177  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  236

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  237  KKTVSHVAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  296

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  297  LVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  356

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  357  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  415



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRHLE+NL+ AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHLEENLRLAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQ+AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCS NYPLMQKLR V
Sbjct  532  KNTVSQLAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TSI QKI AFE+ELK  LPKE+E AR   E GNPA+PN+IT+CR
Sbjct  592  LVDHALKNGENEKNASTSIFQKIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REE GTE LTGEKV SPGE CDKVFTA+  G IID LL CL +W+GAPLP+
Sbjct  652  SYPLYKFIREEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDSLLTCLEAWNGAPLPI  710



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LE+NLKNAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRVLEENLKNAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCS  YPLMQKLR V
Sbjct  532  KNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  591

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N        TSI QKIAAFEDELK  LPKE+E ARS  E+GNPAIPN+I +CR
Sbjct  592  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGTE+L+GEK +SPGEV D+VFTA+ +G I+DPLLECL  W+GAPLP+
Sbjct  652  SYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPI  710



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  474  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  533

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G+NGELHPSRFCEKDLL+VVDREY+F+Y DDPCS  YPLMQKLR V
Sbjct  534  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQV  593

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       +SI QKIA FE+ELK  LPKE+EGAR+ +E+G  AIPNKI +CR
Sbjct  594  LVDHALVNAECEKDVNSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECR  653

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPL+ECL  W+GAPLP+
Sbjct  654  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPI  712



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   386 bits (991),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  485  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  544

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLT+G+NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPL QKLR V
Sbjct  545  KNTVSQVAKKTLTIGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  604

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FE+ELK  LPKE+E AR+ +E+GNP IPNKI  CR
Sbjct  605  LVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCR  664

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE V SPGEVCDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  665  SYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  723



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 206/240 (86%), Gaps = 6/240 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQ+IDLRHLE+NLKNAV
Sbjct  343  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQSIDLRHLEENLKNAV  402

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  403  KDTVSQVAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLMQKLRQV  462

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+A++N        +SI QKI AFEDELK  LP E+E AR   E G+P IPN+IT+CR
Sbjct  463  LVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPDEVENARVVLEGGSPLIPNRITECR  522

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPLI  25
            SYPLY+FVR+ELGTE+LTGE+VRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+ 
Sbjct  523  SYPLYRFVRKELGTELLTGERVRSPGEDVDKVFTALCNGQIIDPLLECLKSWNGAPLPIF  582



>sp|P27990.1|PALY_MEDSA RecName: Full=Phenylalanine ammonia-lyase [Medicago sativa]
 emb|CAA41169.1| phenylalanine ammonia-lyase [Medicago sativa]
Length=725

 Score =   386 bits (991),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT+EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  486  TTHVQSAEQHNQDVNSLGLISARKTNEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLTMG+NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPL QKLR V
Sbjct  546  KNTVSQVAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FE+ELK  LPKE+E AR+ +E+GNP IPNKI  CR
Sbjct  606  LVDHALVNGESEKNFNTSIFQKIATFEEELKTLLPKEVESARTAYESGNPTIPNKINGCR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE V SPGE CDK+F+A+C+G IIDPLLECL  W+GAPLP+
Sbjct  666  SYPLYKFVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGAPLPI  724



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   385 bits (988),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLE+NLK++V
Sbjct  451  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  510

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDRE +FAY DDPC   YPLMQKLR V
Sbjct  511  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  570

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N      + TSI QKIA FEDELK  LPKE+E AR+ +E+GNPAIPNKI +CR
Sbjct  571  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  630

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEK RSPGE  DK+FTA+C+G IIDPL+ECL  W+GAPLP+
Sbjct  631  SYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPI  689



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LE+NLKNAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRFLEENLKNAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCS  YPLMQKLR V
Sbjct  532  KNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  591

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N        TSI QKIAAFEDELK  LPKE+E ARS  E+GNPAIPN+I +CR
Sbjct  592  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEK +SPGEV D+VFTA+ +G I+DPLLECL  W+GAPLP+
Sbjct  652  SYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPI  710



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+E+NLKN V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSR CEKDLL+VVDRE+VF Y DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRICEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL       N++TSI QKI  FEDELK  LPKE+E AR + ENGNPAIPN+IT+CR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGVFEDELKALLPKEVESARLELENGNPAIPNRITECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECL  W+GAPLPL
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPL  710



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   373 bits (958),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLE+NLK AV
Sbjct  110  TNHVQSAEQHNQDVNSLGLISSRKTVEAMDILKLMSSTYLVALCQAIDLRHLEENLKLAV  169

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  170  KNTVSQVAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLMQKLRQV  229

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N       +TSI  KI AFE+ELK  LPKE+E AR   E+G PA+ N+I +CR
Sbjct  230  LVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECR  289

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+RE LGT  LTGEK  SPGE CDKVFTA+C+G I+DPLLECL  W+G PLP+
Sbjct  290  SYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPI  348



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   385 bits (989),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRH E+NL+N V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHFEENLRNTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR V
Sbjct  535  KSTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  594

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKI AFE+E+K  LPKE+E  R+  ENGN AIPN+I +CR
Sbjct  595  LVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEKVRSPGE  DKVFTA+C+G +IDPL++CL  W+GAPLP+
Sbjct  655  SYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPI  713



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   385 bits (990),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  478  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLR V
Sbjct  538  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+AL      +N +TSI QKIA FE+ELK  LPKE+EGAR  +EN   AIPNKI +CR
Sbjct  598  LVDYALANGENEKNTSTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDKVFTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  658  SYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI  716



>gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya]
Length=268

 Score =   370 bits (949),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLE+NLKN V
Sbjct  29   TTHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKNTV  88

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN+VSQV ++ L MG NGELHPSRFCEKDLL+VVDREY+FAYADDPCS  YPLMQKLR V
Sbjct  89   KNSVSQVIRKVLFMGDNGELHPSRFCEKDLLKVVDREYLFAYADDPCSATYPLMQKLRQV  148

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ +SI  KI AFE+ELK  LPKE+EG R + E GN AIPN+I +CR
Sbjct  149  LVDHALINADRDKNSGSSIFHKIGAFEEELKTLLPKEVEGTRLEVEAGNAAIPNRIKECR  208

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVF+A+C G +IDPLL+CL  W+GAPLP+
Sbjct  209  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFSAMCAGKMIDPLLDCLKEWNGAPLPI  267



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   385 bits (988),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRH E+NL+N V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHFEENLRNTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR V
Sbjct  535  KSTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  594

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKI AFE+E+K  LPKE+E  R+  ENGN AIPN+I +CR
Sbjct  595  LVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEKVRSPGE  DKVFTA+C+G +IDPL++CL  W+GAPLP+
Sbjct  655  SYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPI  713



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   385 bits (989),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDL++VVDREYVFAY DDPCS +YPLMQKLR V
Sbjct  541  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKI AFEDELK  LPKE+E AR++ E+GN AI N+I +CR
Sbjct  601  LVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYK VREE+GT +LTGEKVRSPGE  DKVF A+CEG +IDP+LECL  W+GAPLP+
Sbjct  661  SYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPI  719



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLV LCQAIDLRHLE+NLK+AV
Sbjct  470  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVGLCQAIDLRHLEENLKHAV  529

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  530  KNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQV  589

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E AR+  E+GNPAI N+I +CR
Sbjct  590  LVEHALKNGEGEKNASTSIFQKIEAFEEELKTLLPKEVESARTALESGNPAIANRIAECR  649

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELG + LTGEKV SPGE CDKVFTA+  G IIDPLLECL  W+GAPLP+
Sbjct  650  SYPLYKFIREELGADFLTGEKVVSPGEECDKVFTALSNGLIIDPLLECLQGWNGAPLPI  708



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV ++KLMSSTYLVALCQAIDLRHLE+NLKN V
Sbjct  431  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDIIKLMSSTYLVALCQAIDLRHLEENLKNTV  490

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCS  YPLMQKLR V
Sbjct  491  KNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQV  550

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL       NA+TSI QKIAAFE+ELK  LPKE+E +R   ENGNPAIPNKIT+CR
Sbjct  551  LVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIENGNPAIPNKITKCR  610

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECL  W+GAPLP+
Sbjct  611  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPI  669



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   373 bits (958),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYL+ALCQAIDLRHLE+NLKN V
Sbjct  126  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTYLIALCQAIDLRHLEENLKNTV  185

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN V+QVAK+ LTMG+NGEL PSRFCEKDLL VVDRE+VF Y DDPCS  YPLMQKLR V
Sbjct  186  KNAVNQVAKKVLTMGVNGELLPSRFCEKDLLTVVDREHVFDYIDDPCSATYPLMQKLRQV  245

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQN      A TSI  KIAAFE ELK  LPKE+E AR + ENG  AIPN+I +CR
Sbjct  246  LVDHALQNGNRENDANTSIFLKIAAFEKELKTLLPKEVESARIEVENGKSAIPNRIKECR  305

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGT +LTGEKVRSPGE  DKVFTA+CEG +IDPLL+CL  W+GAPLPL
Sbjct  306  SYPLYRFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAPLPL  364



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+AV
Sbjct  460  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSAV  519

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  520  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  579

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKIA FEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  580  LVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  639

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE LTGEK RSPGE  DKVFTA+  G IIDPLL CL SW+GAPLP+
Sbjct  640  SYPLYKFVREELGTEYLTGEKARSPGEEFDKVFTAMSRGEIIDPLLACLESWNGAPLPI  698



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   385 bits (988),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDL++VVDREYVFAY DDPCS +YPLMQKLR V
Sbjct  541  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKI AFEDELK  LPKE+E AR++ E+GN AI N+I +CR
Sbjct  601  LVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYK VREE+GT +LTGEKVRSPGE  DKVF A+CEG +IDP+LECL  W+GAPLP+
Sbjct  661  SYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPI  719



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NL+N V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPC+  YPLMQKLR V
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCNATYPLMQKLRQV  597

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE++ AR+  ++G   +PN+IT+CR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGTAGVPNRITECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGE+VRSPGE CDKVF+A+CEG IIDP+L+CL  W+GAPLP+
Sbjct  658  SYPLYKFVREELGAEYLTGEEVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPI  716



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  477  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  536

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G+NGELHPSRFCEKDLL+VVDREY+F+Y DDPCS  YPLMQKLR V
Sbjct  537  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQV  596

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       +SI QKIA FE+ELK  LPKE+E AR+ +E+G  AIPNKI +CR
Sbjct  597  LVDHALVNAESEKDVNSSIFQKIAIFEEELKNLLPKEVESARAAYESGKAAIPNKIQECR  656

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DK+FTA+C+G IIDPL+ECL  W+GAPLP+
Sbjct  657  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPI  715



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   384 bits (987),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQA+DLRHLE+NLKN+V
Sbjct  484  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAVDLRHLEENLKNSV  543

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLLRVVDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  544  KNIVSQVAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLMQKLRQV  603

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E  R+ +E+GNP +PNKI  CR
Sbjct  604  LVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPNKINGCR  663

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+ELGT +LTGEKV SPGE CDK+FTA+C+G IIDPLL+CL  W+GAPLP+
Sbjct  664  SYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI  722



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   384 bits (987),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  485  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  544

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VS VAKRTLT GINGELHPSRFCEKDLLRVVDRE+VF+Y DDPCS  YPLMQKLR V
Sbjct  545  KNMVSHVAKRTLTTGINGELHPSRFCEKDLLRVVDREHVFSYIDDPCSATYPLMQKLRQV  604

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E AR  +ENGN  I NKI +CR
Sbjct  605  LVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESARGAYENGNTTISNKIKECR  664

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  665  SYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGAPLPI  723



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT +AV +LK+MSSTYLVALCQAIDLRHLE+NLK+ V
Sbjct  465  TNHVQSAEQHNQDVNSLGLISARKTAKAVDILKIMSSTYLVALCQAIDLRHLEENLKSVV  524

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  525  KNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  584

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D A++N        +SI QKI AFEDEL   LPKE+E  R+ FE+GNP I N+IT+CR
Sbjct  585  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECR  644

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VREELGTE+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  645  SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPI  703



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT +AV +LK+MSSTYLVALCQAIDLRHLE+NLK+ V
Sbjct  465  TNHVQSAEQHNQDVNSLGLISARKTAKAVDILKIMSSTYLVALCQAIDLRHLEENLKSVV  524

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  525  KNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  584

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D A++N        +SI QKI AFEDEL   LPKE+E  R+ FE+GNP I N+IT+CR
Sbjct  585  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECR  644

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VREELGTE+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  645  SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPI  703



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQA+DLRHLE+NLKN+V
Sbjct  484  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAVDLRHLEENLKNSV  543

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLLRVVDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  544  KNIVSQVAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLMQKLRQV  603

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E  R+ +E+GNP +PNKI  CR
Sbjct  604  LVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPNKINGCR  663

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+ELGT +LTGEKV SPGE CDK+FTA+C+G IIDPLL+CL  W+GAPLP+
Sbjct  664  SYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI  722



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 208/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTY+VALCQ+IDLRHLE+NLKNAV
Sbjct  470  TTHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYIVALCQSIDLRHLEENLKNAV  529

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVS+VAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS NYPLMQKLR V
Sbjct  530  KDTVSRVAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLMQKLRQV  589

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+A++N        +SI QKI AFEDELK  LP E+E AR   E+GNP+IPN+IT+CR
Sbjct  590  LVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPNEVENARVILESGNPSIPNRITECR  649

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+ELGTE+LTGE+VRSPGE  DKVFTA+C G IIDPLLECL SW+GAPLP+
Sbjct  650  SYPLYRFVRKELGTELLTGERVRSPGEDIDKVFTALCNGQIIDPLLECLKSWNGAPLPI  708



>ref|XP_006488063.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Citrus sinensis]
Length=714

 Score =   383 bits (984),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLE+NLK+ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNT+SQV K+ LTMG+NGELHPSRFCEKDLL+VVDREYVF+YADDPCS  YPLMQKLR V
Sbjct  535  KNTISQVVKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMQKLRQV  594

Query  366  LLDHA------LQNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA      L+NA  SI  KI AFE+ELK  LPKE+E ARS FE+GN  IPN+I +CR
Sbjct  595  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG   LTGEK  SPGE CDKVFTA+C+G IIDPLLECL  WDG+PLP+
Sbjct  655  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI  713



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   377 bits (969),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LV LCQAIDLRHLE+NLK  V
Sbjct  296  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKQTV  355

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G+NGELHPSRFCEKDLL+VVDREYV+AY DDPCS  YPLMQ LR V
Sbjct  356  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQV  415

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKIAAFE+ELK  LPKE+E AR  +ENGN AI NKIT+CR
Sbjct  416  LVEHALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISNKITECR  475

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKV+TA+C+G +IDP+LECL+ W+G PLP+
Sbjct  476  SYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPI  534



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   383 bits (984),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLE+NLKN V
Sbjct  477  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  536

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLR V
Sbjct  537  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  596

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+AL      +N  TSI QKIA FE+ELK  LPKE+EGAR  +EN   AIPNKI +CR
Sbjct  597  LVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  656

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDKVFTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  657  SYPLYKFVREELGTALLTGERVVSPGEECDKVFTAMCQGKIIDPLLECLGEWNGAPLPI  715



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   383 bits (984),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKN V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTV  538

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCS  YPLMQKLR V
Sbjct  539  KNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQV  598

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL       NA+TSI QKIAAFE+ELK  LPKE+E +R   +NGNPAIPNKIT+CR
Sbjct  599  LVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIQNGNPAIPNKITECR  658

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECL  W+GAPLP+
Sbjct  659  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPI  717



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   383 bits (984),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 180/236 (76%), Positives = 207/236 (88%), Gaps = 3/236 (1%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL NAV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLSNAV  541

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT+G NGELHP+RFCEK+L +VVDREY+FAY DDPC+  YPL+QKLR V
Sbjct  542  KNTVSQVAKRTLTVGANGELHPARFCEKELPQVVDREYLFAYVDDPCNSTYPLIQKLRQV  601

Query  366  LLDHAL---QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCRSYP  196
            L+DHA+   +N  +SI QKI AFEDELK  LPKE+E AR+  E+GNPAIPN+IT+CRSYP
Sbjct  602  LVDHAMKNEKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPNRITECRSYP  661

Query  195  LYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            LYK VR++LGTE+LTGEKVRSPGE  +KVFTA+C G IIDPLLECL +W+GAP+P+
Sbjct  662  LYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNGAPIPI  717



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   383 bits (983),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGL+S+RKT EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  478  TNHVQSAEQHNQDVNSLGLVSSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            +NTVSQVAKR LT+GINGELHPSRFCEKDLL++VDREYV+AY DDPCS  YPLMQKLR V
Sbjct  538  RNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  597

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQ      N++TSI QKI AFE+EL   LPKE+E +R + ENGNPAIPN+I +CR
Sbjct  598  LVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESSRIEVENGNPAIPNRIKECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGT +LTGEKV+SPGE  DKVFTA+CEG +IDPLL+CL  W GAPLP+
Sbjct  658  SYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPI  716



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   382 bits (982),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+E+NLK+ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N+ TSI QKI +FE+ELK  LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECL  WDGAPLP+
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI  710



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   382 bits (982),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKN V
Sbjct  468  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTV  527

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDL++VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  528  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSATYPLMQKLRQV  587

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HA+ N      ++TSI QKI AFE+ELK  LPKE+E  R + ENGN A+PNKI +CR
Sbjct  588  LVEHAMANGEREKKSSTSIFQKIGAFEEELKTLLPKEVESTRIEIENGNAAVPNKIKECR  647

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG   LTGEKV+SPGE  DKVF+A+C G +IDP++ECL  W+GAPLPL
Sbjct  648  SYPLYKFVREELGASFLTGEKVKSPGEEFDKVFSAICAGKLIDPMMECLKEWNGAPLPL  706



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   383 bits (983),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/236 (76%), Positives = 207/236 (88%), Gaps = 3/236 (1%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NL NAV
Sbjct  483  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLSNAV  542

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT+G NGELHP+RFCEK+L +VVDREY+FAY DDPC+  YPL+QKLR V
Sbjct  543  KNTVSQVAKRTLTVGANGELHPARFCEKELPQVVDREYLFAYVDDPCNSTYPLIQKLRQV  602

Query  366  LLDHAL---QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCRSYP  196
            L+DHA+   +N  +SI QKI AFEDELK  LPKE+E AR+  E+GNPAIPN+IT+CRSYP
Sbjct  603  LVDHAMKNEKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPNRITECRSYP  662

Query  195  LYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            LYK VR++LGTE+LTGEKVRSPGE  +KVFTA+C G IIDPLLECL +W+GAP+P+
Sbjct  663  LYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNGAPIPI  718



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   382 bits (982),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLE+NLK+ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+T+SQVAK+ LTMG+NGELHPSRFCEKDLL+VVDREYVF+YADDPCS  YPLMQKLR V
Sbjct  535  KSTISQVAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMQKLRQV  594

Query  366  LLDHA------LQNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA      L+NA  SI  KI AFE+ELK  LPKE+E ARS FE+GN  IPN+I +CR
Sbjct  595  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG   LTGEK  SPGE CDKVFTA+C+G IIDPLLECL  WDG+PLP+
Sbjct  655  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI  713



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   382 bits (982),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+E+NLK+ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHVEENLKSTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N+ TSI QKI +FE+ELK  LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECL  WDGAPLP+
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI  710



>ref|XP_006424538.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
 gb|ESR37778.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
Length=714

 Score =   382 bits (982),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLE+NLK+ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNT+SQVAK+ LTMG+NGELHPSRFCEKDLL+VVDREYVF+YADDPCS  YPLM+KLR V
Sbjct  535  KNTISQVAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQV  594

Query  366  LLDHA------LQNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA      L+NA  SI  KI AFE+ELK  LPKE+E ARS FE+GN  IPN+I +CR
Sbjct  595  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG   LTGEK  SPGE CDKVFTA+C+G IIDPLLECL  WDG+PLP+
Sbjct  655  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI  713



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   378 bits (971),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  341  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  400

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS VAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  401  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  460

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKIA FEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  461  LVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  520

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVR+ELGTE LTGEKV SPGE  +KVF A+ +G IIDPLLECL SW+GAPLP+
Sbjct  521  SYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPI  579



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   383 bits (983),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLK+ V
Sbjct  491  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  550

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQ+AKR LT G+NGELHPSRFCEKDLL VV+REY+FAY DDPCS  YPLMQ+LR V
Sbjct  551  KNTVSQLAKRVLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQV  610

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E AR+ +E+GN AIPN+I +CR
Sbjct  611  LVEHALTNGENEKNASTSIFQKITAFEEELKTILPKEVESARAAYESGNAAIPNRIVECR  670

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVFTA+C+G IIDP+L+CL+ W+G PLP+
Sbjct  671  SYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGNIIDPILDCLSGWNGEPLPI  729



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   382 bits (981),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+E++ +LKLMSST+L+ALCQAIDLRHLE+NL+N V
Sbjct  473  TTHVQSAEQHNQDVNSLGLISSRKTNESIEILKLMSSTFLIALCQAIDLRHLEENLRNTV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAYADDPC   YPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQV  592

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKIA FEDELK  LPKE+E  R  +ENG   I NKI +CR
Sbjct  593  LVDHALVNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISNKIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDK+FTA+C+G I+DPLLECL  W+GAPLP+
Sbjct  653  SYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNGAPLPI  711



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLK  V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKITV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNT+S +AK+TLT G+NGELHPSRFCEKDLL+VVDREY+FAY DDPCS+ YPLMQK+R V
Sbjct  531  KNTISHIAKKTLTTGVNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSETYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E  R+  E+GNP IPN+I  CR
Sbjct  591  LVEHALNNGENEKNVSTSIFQKIVAFEEELKALLPKEVESTRAGLESGNPFIPNRIKDCR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL+ W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSGWNGAPLPI  709



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   367 bits (943),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 200/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLM STYLVALCQAIDLRHLE+NLK+AV
Sbjct  43   TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMFSTYLVALCQAIDLRHLEENLKHAV  102

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC   YPLMQKLR V
Sbjct  103  KNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQV  162

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI  KI  FE+ELK  LPKE+E AR   E+G+PA+PN+I +CR
Sbjct  163  LVEHALKNGEGEKNASTSIFHKIEQFEEELKALLPKEVEAARMALESGSPAVPNRIAECR  222

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE+LG   LTGEK  SPGE CDKVFTA+C G I+DPLL+CL  W+G PLP+
Sbjct  223  SYPLYKFVREQLGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPI  281



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+E+NLK+ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL       N+ TSI QKI +FE+ELK  LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  592  LVEHALVNGERETNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECL  WDGAPLP+
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI  710



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRHLE+NL+ AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHLEENLRLAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQ+AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCS NYPLMQKLR V
Sbjct  532  KNTVSQLAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TSILQ+I AFE+ELK  LPKE+E AR   E GNPA+PN+IT+CR
Sbjct  592  LVDHALKNGENEKNASTSILQEIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+R E GTE LTGEKV SPGE CDKVFTA+  G IID LL CL +W+GAPLP+
Sbjct  652  SYPLYKFIRGEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDQLLTCLEAWNGAPLPI  710



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGL S+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLNSSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDL++VVDREYVFAY DDPCS + PLMQKLR V
Sbjct  541  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASSPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKI AFEDELK  LPKE+E AR++ E+GN AIPN+I +CR
Sbjct  601  LVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIPNRIKECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYK VRE++GT +LTGEKVRSPGE  DKVFTA+CEG +IDP+LECL  W+GAPLP+
Sbjct  661  SYPLYKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPI  719



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   382 bits (980),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEKDLL+VV+REY FAY DDPCS  YPLMQKLR V
Sbjct  533  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVEREYTFAYIDDPCSGTYPLMQKLRQV  592

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+AL N        TSI QKIA+FE+ELK  LPKE+EGAR  +EN   AIPNKI  CR
Sbjct  593  LVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDKVF+A+C+G IIDPLLECL  W+GAPLP+
Sbjct  653  SYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPI  711



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLE+NL+ AV
Sbjct  551  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLRLAV  610

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQ AK+TLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  611  KNTVSQAAKKTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLMQKLREV  670

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NAATSI QKI AFE+ELK  LPKE+E ARS  ENGN A+ N+I +CR
Sbjct  671  LVDHALKNGDNQKNAATSIFQKIEAFEEELKAVLPKEVESARSAVENGNAAVGNRIKECR  730

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELGTE LTGEK+ SPGE CDKVFTA+ +G I+DPLLECL  W+GAPLP+
Sbjct  731  SYPLYKFMREELGTEFLTGEKLTSPGEECDKVFTALSKGLIVDPLLECLEGWNGAPLPI  789



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   381 bits (979),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+E++ +LKLMSST+L+ALCQAIDLRHLE+NL+N V
Sbjct  473  TTHVQSAEQHNQDVNSLGLISSRKTNESIEILKLMSSTFLIALCQAIDLRHLEENLRNTV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAYADDPC   YPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQV  592

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKIA FEDELK  LPKE+E  R  +ENG   I NKI +CR
Sbjct  593  LVDHALVNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISNKIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDK+FTA+C+G I+DPLLEC+  W+GAPLP+
Sbjct  653  SYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECMGEWNGAPLPI  711



>ref|XP_007220629.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
 gb|EMJ21828.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
Length=625

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRHLE+NLK+ V
Sbjct  386  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTV  445

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKR LT+G NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLRHV
Sbjct  446  KSTVSQVAKRVLTVGFNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHV  505

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N      ++TSI QKI AFE+ELK  LPKE+E AR +++NG  A PN+I  CR
Sbjct  506  LVEHALNNGEKEKSSSTSIFQKITAFEEELKTLLPKEVESARLEYDNGKSATPNRIKDCR  565

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTG+KVRSPGE  DKVF A+C G  IDPLL+CL  W+GAPLP+
Sbjct  566  SYPLYKFVREELGTALLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPI  624



>ref|XP_007016787.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY34406.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=713

 Score =   381 bits (979),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTY++ALCQAIDLRHLE+NLKNAV
Sbjct  474  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYMIALCQAIDLRHLEENLKNAV  533

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN +SQVA++ LTMG+NGEL PSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  534  KNAMSQVARKVLTMGVNGELQPSRFCEKDLLKVVDREHVFAYVDDPCSATYPLMQKLRQV  593

Query  366  LLDHA------LQNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HA      L NA  SI  KI AFE+ELK  LP+E+E AR+ FE+GNPAIPNKI +CR
Sbjct  594  LVEHALTNSDDLSNANASIFLKIGAFEEELKTVLPEEVETARTAFESGNPAIPNKIKECR  653

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE LGTE LTGEKVRSPGE CDKVF  +CEG +IDPLLECL  WDG PLP+
Sbjct  654  SYPLYKFVREGLGTEFLTGEKVRSPGEECDKVFVGMCEGKLIDPLLECLKDWDGNPLPI  712



>ref|XP_002285277.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 emb|CAN74850.1| hypothetical protein VITISV_000789 [Vitis vinifera]
Length=717

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSSTYLVALCQAIDLRHLE+NLKN V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTEEAIDILKLMSSTYLVALCQAIDLRHLEENLKNTV  537

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT+GINGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQ LR V
Sbjct  538  KNTVSQVAKKVLTIGINGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQNLRQV  597

Query  366  LLDHA------LQNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA      L+N++TSI  KI AFE+ELK  LPK++E  R  F+NGN AIPN+I +CR
Sbjct  598  LVDHALMNNEDLRNSSTSIFLKIGAFEEELKTLLPKDVESTRIAFDNGNLAIPNRIKECR  657

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREE GTE LTGEKV SPGE  DKVF+A+CEG IIDPLL+CLN WDG PLP+
Sbjct  658  SYPLYKFVREESGTEFLTGEKVTSPGEEFDKVFSAICEGKIIDPLLKCLNDWDGTPLPI  716



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   369 bits (946),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 200/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQ++DLRHLE+N+K+ V
Sbjct  100  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQSVDLRHLEENMKSTV  159

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQ+LR V
Sbjct  160  KNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQRLRQV  219

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FEDELK  LPKE+E  R+ +E  + +IPN+I  CR
Sbjct  220  LVDHALNNGETEKNTNTSIFQKIATFEDELKAILPKEVESVRTAYETDSLSIPNRIKACR  279

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG   LTGEKV SPGE  DKVFTA+C+G +IDPLLEC+  W+GAPLP+
Sbjct  280  SYPLYRFVREELGGGFLTGEKVTSPGEEFDKVFTAMCKGELIDPLLECVEGWNGAPLPI  338



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/237 (75%), Positives = 204/237 (86%), Gaps = 6/237 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSA+QHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NL+N V
Sbjct  465  TNHVQSAQQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  524

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  525  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  584

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE++  R+  ++G+  +PN+IT+CR
Sbjct  585  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSXRAALDSGSAGVPNRITECR  644

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPL  34
             YPLYKFVREELG E LTGEKVRSPGE CDKVF+A+CEG IIDP+LECL  W+GAPL
Sbjct  645  FYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPL  701



>gb|ABV44807.1| phenylalanine ammonia lyase 2 [Eriobotrya japonica]
Length=330

 Score =   368 bits (945),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 197/228 (86%), Gaps = 6/228 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  92   TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  151

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  152  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  211

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  212  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  271

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLEC  61
            SYPLYKFVREELG E LTGEKVRSPGE CD+VF A+C+G IIDP+L C
Sbjct  272  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGC  319



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+E+NLK+ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPLMQ LR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N+ TSI QKI +FE+ELK  LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECL  WDGAPLP+
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI  710



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+E+NLK+ V
Sbjct  468  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  527

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR L MG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPLMQKLR V
Sbjct  528  KNTVSQVAKRVLAMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQV  587

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N+ T+ILQKI +FE+ELK  LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  588  LVEHALVNGERERNSTTTILQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  647

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECL  WDGAPLP+
Sbjct  648  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI  706



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLE+NL+ AV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLRLAV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS+NYPLMQKLR V
Sbjct  533  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYVDDPCSENYPLMQKLRQV  592

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKI AFEDELK  LPKE+E AR   E+GNPAI N+I +CR
Sbjct  593  LVEHALKNGDNEKNLSTSIFQKIGAFEDELKALLPKEVESARIALESGNPAIANRIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+F+REELGT  LTGEKV SPGE  DKVFTA+ +G I+DPLL+CL  W G+PLP+
Sbjct  653  SYPLYRFIREELGTGFLTGEKVTSPGEEGDKVFTALSKGLIVDPLLKCLEGWSGSPLPI  711



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   380 bits (977),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+E+NLK+ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPLMQ LR V
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N+ TSI QKI +FE+ELK  LPKE+E AR + ENGNPAIPN+I +CR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECL  WDGAPLP+
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI  710



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   381 bits (978),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLK+ V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSVV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS  YPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQV  600

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHA++N        +SI QKI AFEDEL   LPKE+E AR+  E+GNP+IPN+IT+CR
Sbjct  601  LVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VR+ELGTE+LTGEKVRSPGE  +KVFTA+C G I DPLLECL SW+GAPLP+
Sbjct  661  SYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNGAPLPI  719



>gb|AAY82485.1| phenylalanine ammonia-lyase [Ulmus americana]
Length=509

 Score =   374 bits (961),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMS+T+LVALCQAIDLRHLE+NLKN V
Sbjct  270  TNHVQSAEQHNQDVNSLGLISSRKTEEAVEILKLMSTTFLVALCQAIDLRHLEENLKNTV  329

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G NGELHPSR CEKDLL+VVDREYVF+Y DDPCS  YPLMQ+LR V
Sbjct  330  KNTVSQVAKKVLTTGSNGELHPSRLCEKDLLKVVDREYVFSYIDDPCSSIYPLMQELRQV  389

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N        TSI QKIAAFE+ELK  LPKE+E +R   ENGNPAIP+KI  CR
Sbjct  390  LVDHALNNGEKETNPNTSIFQKIAAFEEELKTLLPKEVESSRVQLENGNPAIPDKIKGCR  449

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            S+PLYKFVREELGT +LTGEKV+SPGE  DKVF A+C G +IDPLLECL  WDGAPLP+
Sbjct  450  SFPLYKFVREELGTGLLTGEKVKSPGEEFDKVFPAMCAGKLIDPLLECLKEWDGAPLPI  508



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   380 bits (976),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMS+T+LVALCQAIDLRHLE+NLK+AV
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTEEAVDILKLMSTTFLVALCQAIDLRHLEENLKHAV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CS  YPLMQKLR V
Sbjct  533  KNTVSQVAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQV  592

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TSI QKI AFE+ELK  LPKE+E AR  +ENGNPAI NKI +CR
Sbjct  593  LVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREE+GT +LTGEK+RSPGE  DKVFTA+C+G IIDP+L+CL  W+GAPLP+
Sbjct  653  SYPLYKFVREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPI  711



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   380 bits (977),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  485  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  544

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLT+G+NGEL PSR CEKDLL+VVDRE+VFAY DDPCS  YPL QKLR V
Sbjct  545  KNTVSQVAKKTLTIGVNGELQPSRLCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  604

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N  TSI QKIA FE+ELK  LPKE+E AR+ +E+GNP IPNKI  CR
Sbjct  605  LVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCR  664

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE V SPGEVCDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  665  SYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  723



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   380 bits (976),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  468  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  527

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDL++VVDREYVFAY DDPCS  YPL QKLR V
Sbjct  528  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSATYPLTQKLRQV  587

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HA+      +N++TSI QKI AFE+ELK  LPKE+E  R + ENGN A+PNKI +CR
Sbjct  588  LVEHAMANGDAEKNSSTSIFQKIGAFEEELKTLLPKEVESTRIEIENGNAAVPNKIKECR  647

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT  LTGEK RSPGE  DKVF+A+C G +IDP++ECL  W+GAPLPL
Sbjct  648  SYPLYKFVREELGTSFLTGEKARSPGEEFDKVFSAMCAGKLIDPMMECLKEWNGAPLPL  706



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   380 bits (976),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+AV
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSAV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAICEGKIIDPLLDCLSAWNGAPLPI  709



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   380 bits (976),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  479  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  538

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPC   YP+MQ LR V
Sbjct  539  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCLATYPMMQSLRQV  598

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FEDELK  LPKE+E  R+ +ENG  AIPNKI +CR
Sbjct  599  LVDHALANAEAEKNVNTSIFQKIATFEDELKALLPKEVENTRAAYENGQCAIPNKIKECR  658

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVR ELGT +LTGEKV SPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  659  SYPLYKFVRGELGTGLLTGEKVISPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  717



>dbj|BAM28965.1| phenylalanine ammonia lyase, partial [Lilium hybrid division 
I]
Length=301

 Score =   366 bits (939),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQA+DLRHLE+NLK AV
Sbjct  62   TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTFLVALCQAVDLRHLEENLKAAV  121

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG+NGELHPSRFCEKDL++V+DREYVFAYADDPCS  YPLMQKLR V
Sbjct  122  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVIDREYVFAYADDPCSAAYPLMQKLRGV  181

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N        TSI QKIAAFE+ELK  LPKE+EG R  F+NG   I N+I++CR
Sbjct  182  LVEHALVNGEKEKEVGTSIFQKIAAFEEELKVTLPKEVEGVRMAFDNGTNVIANRISECR  241

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELG   LTGEKVRSPGE  +KVF A+ +  +IDPLLECL+ W+GAPLP+
Sbjct  242  SYPLYRFVREELGAGYLTGEKVRSPGEEFNKVFIAMSQWKVIDPLLECLSDWNGAPLPI  300



>ref|XP_008233304.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=719

 Score =   380 bits (976),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRHLE+NLK+ V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKR LT+G NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLRHV
Sbjct  540  KSTVSQVAKRVLTVGFNGELHPSRFCEKDLLKVVDREYVFAYVDDPCSATYPLMQKLRHV  599

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N      ++TSI QKI AFE+ELK  LPKE+E AR D++NG  A PN+I  CR
Sbjct  600  LVEHALNNGEKEKSSSTSIFQKITAFEEELKTLLPKEVESARLDYDNGKSATPNRIKDCR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTG+KVRSPGE  DKVF A+C G  IDPLL+CL  W+GAPLP+
Sbjct  660  SYPLYKFVREELGTALLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPI  718



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   380 bits (975),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT+E++ +LKLMSST+L+ LCQAIDLRHLE+NLK++V
Sbjct  475  TSHVQSAEQHNQDVNSLGLISARKTNESIEILKLMSSTFLMGLCQAIDLRHLEENLKSSV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLR V
Sbjct  535  KNTVSQVSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSGTYPLMQKLRQV  594

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK  LPKE+E  R+ +E+G  AIPNKI +CR
Sbjct  595  LVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  655  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPI  713



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   380 bits (975),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVA+CQA+DLRHLE+NLK+ V
Sbjct  479  TTHVQSAEQHNQDVNSLGLISSRKTQEAIDILKLMSSTFLVAICQAVDLRHLEENLKSTV  538

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  539  KNTVSQVAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQV  598

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N        TS+ QKIAAFE+ELK+ LPKE+EG R  +E+GN AIPN+I +CR
Sbjct  599  LVDHALANGEGERNPNTSVFQKIAAFEEELKDLLPKEIEGVRLAYESGNTAIPNRIKECR  658

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE  GT +LTGEKV SPGE  DKVFTA+C+G IIDP+L+CL  WDG PLP+
Sbjct  659  SYPLYKFVREVAGTSLLTGEKVTSPGEELDKVFTAICQGKIIDPILDCLEEWDGTPLPI  717



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   379 bits (974),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKIAAFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   380 bits (975),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKN V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTV  538

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCS  YPLMQKLR V
Sbjct  539  KNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQV  598

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL       NA+TSI QKIAAFE+ELK  LPKE+E +R   ENGN AIPNKI +CR
Sbjct  599  LVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSVENGNAAIPNKIMECR  658

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECL  W+GAPLP+
Sbjct  659  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAICQGKVIDPMLECLKEWNGAPLPI  717



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   374 bits (960),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  295  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTV  354

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV KR LT G+NGEL+PSRFCEKDLL+VVDREYV+ Y DDPCS  YPLMQ LR V
Sbjct  355  KNTVSQVVKRVLTTGVNGELNPSRFCEKDLLKVVDREYVYTYIDDPCSATYPLMQTLRQV  414

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKIAAFE+ELK FLPKE+E AR  +ENGN AI NKIT+CR
Sbjct  415  LVEHALTNGESEKNTSTSIFQKIAAFEEELKSFLPKEVESARIAYENGNAAISNKITECR  474

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKV+TA+C+G +IDP+LECL+ W+G PLP+
Sbjct  475  SYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPI  533



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   363 bits (932),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 193/233 (83%), Gaps = 6/233 (3%)
 Frame = -2

Query  711  SAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAVKNTVS  532
            SAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLE+NLK AV+NTVS
Sbjct  1    SAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKQAVRNTVS  60

Query  531  QVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHVLLDHA  352
            QVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLMQKLR VL+DHA
Sbjct  61   QVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHA  120

Query  351  LQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCRSYPLY  190
            LQN        TSI  KI +FE+ELK  LPKE E AR   E+GNPAI N+I +CRSYPLY
Sbjct  121  LQNGENEKNVGTSIFHKIESFEEELKALLPKEDESARISLESGNPAIANRIAECRSYPLY  180

Query  189  KFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLP  31
            KF+R ELG   LTGEK  SPGE C+KVFTA+ +G I+DPLLECL  W+GAPLP
Sbjct  181  KFIRGELGASFLTGEKATSPGEECEKVFTALSKGLIVDPLLECLQGWNGAPLP  233



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS VAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  535  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  594

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKIA FEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  595  LVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVR+ELGTE LTGEKV SPGE  +KVF A+ +G IIDPLLECL SW+GAPLP+
Sbjct  655  SYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPI  713



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLE+NL++AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLRSAV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCS  YPLMQKLR V
Sbjct  535  KNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQV  594

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TS+ QKIAAFEDELK  LPKE+E AR+ +++GN AI NKI +CR
Sbjct  595  LVDHALANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE VRSPGE  DKVFTA+CEG IIDP+LECL  W+GAPLP+
Sbjct  655  SYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCEGKIIDPMLECLGEWNGAPLPI  713



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRHLE+NLK+ V
Sbjct  469  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSTTFLVGLCQAVDLRHLEENLKSTV  528

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LTMG+NGELHPSRFCE DLLRVVDREY+FAY DDPCS  YPLMQKLR V
Sbjct  529  KNTVSQVAKKVLTMGVNGELHPSRFCELDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  588

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKIAAFEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  589  LVEHALKNGETEKNLSTSIFQKIAAFEDELKALLPKEVESARAVVESGNPAIPNRIKECR  648

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELGT  LTGEKV SPGE  DKVFTA+ +G IIDPLL CL SW+GAPLP+
Sbjct  649  SYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPI  707



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKIAAFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  536

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS VAKR LTMG+NGELHPSRFCEKDLLRVVDREY+FAY DDPCS  YPLMQKLR  
Sbjct  537  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  596

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N       +TSI QKIA FEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  597  LVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  656

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVR+ELGTE LTGEKV SPGE  +KVF A+ +G IIDPLLECL SW+GAPLP+
Sbjct  657  SYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPI  715



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLE+NLK  V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTV  546

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+ YADDPCS  YPL+QKLR V
Sbjct  547  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  606

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LPKE+E AR+ ++NG  AIPN+I +CR
Sbjct  607  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  666

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGTE+LTGEKV SPGE  DKVFTA+CEG IIDP++ECLN W+GAPLP+
Sbjct  667  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPLPI  725



>gb|AFG26322.1| phenylalanine ammonia-lyase [Cinnamomum osmophloeum]
Length=708

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLV LCQAIDLRHLE+NLK+ V
Sbjct  469  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSATYLVGLCQAIDLRHLEENLKSTV  528

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT+G+NGELHPSRFCEKDL++VVDREY+FAY DDPCS  YPLMQKLR V
Sbjct  529  KNTVSQVAKRVLTIGVNGELHPSRFCEKDLIKVVDREYLFAYIDDPCSSTYPLMQKLRQV  588

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N        TSI QKIAAFE+ELK  LPKE+E AR+++E+GNPAI N+I +CR
Sbjct  589  LVEHALNNEEKEKDLNTSIFQKIAAFEEELKTHLPKEVESARAEWESGNPAIANRIKECR  648

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREEL T +LTGE+VRSPGE  DKVF A+CEG +IDP LECL  W+GAPLP+
Sbjct  649  SYPLYKFVREELKTSLLTGERVRSPGEEFDKVFAAICEGKVIDPFLECLREWNGAPLPI  707



>ref|XP_007220630.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
 gb|EMJ21829.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
Length=686

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRHLE+NLK+ V
Sbjct  447  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTV  506

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKR LT+G NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLRHV
Sbjct  507  KSTVSQVAKRVLTVGFNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHV  566

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N      ++TSI QKI AFE+ELK  LPKE+E AR +++NG  A PN+I  CR
Sbjct  567  LVEHALNNGEKEKSSSTSIFQKITAFEEELKTLLPKEVESARLEYDNGKSATPNRIKDCR  626

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTG+KVRSPGE  DKVF A+C G  IDPLL+CL  W+GAPLP+
Sbjct  627  SYPLYKFVREELGTALLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPI  685



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+E++ +LKLMSST+L+ALCQAIDLRHLE+NLK++V
Sbjct  476  TSHVQSAEQHNQDVNSLGLISSRKTNESIEILKLMSSTFLMALCQAIDLRHLEENLKSSV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPL QKLR V
Sbjct  536  KNTVSQVSKRTLTTGFNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLTQKLRQV  595

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK  LPKE+E AR+ +E+G  AIPNKI +CR
Sbjct  596  LVDHALVNAENEKDVNTSIFQKIAIFEEELKTVLPKEVESARAAYESGKAAIPNKIKECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  656  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGDWNGAPLPI  714



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQA+DLRHLE+NL+ +V
Sbjct  469  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAVDLRHLEENLRLSV  528

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  529  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLMQKLRQV  588

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N +TSI QKI AFE ELK  LPKE+E AR   E+GNPAI N+IT+CR
Sbjct  589  LVDHALNNGESEKNVSTSIFQKIEAFEVELKAILPKEVESARIALESGNPAIGNRITECR  648

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELGT  LTGEKV SPGE CDKVFTA+ +G I+DPLL+CL  W+GAP P+
Sbjct  649  SYPLYKFIREELGTNYLTGEKVVSPGEECDKVFTALSKGLIVDPLLKCLEGWNGAPPPI  707



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTV  546

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G+NGELHPSRFCEKDLL+VVDREYV+AY DDPCS  YPLMQ LR V
Sbjct  547  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQV  606

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKIAAFE+ELK  LPKE+E AR+ +ENGN AI NKIT+CR
Sbjct  607  LVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECR  666

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE+LGT +LTGEKVRSPGE  DKV+TA+C+G +IDP+LECL  W+G PLP+
Sbjct  667  SYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLRGWNGEPLPI  725



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  531  KKTVSHVAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>sp|Q40910.1|PAL4_POPKI RecName: Full=Phenylalanine ammonia-lyase G4, partial [Populus 
sieboldii x Populus grandidentata]
 dbj|BAA07861.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=571

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 199/239 (83%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +L +MS+T+LVALCQAIDLRH+E+NLKN V
Sbjct  332  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILNVMSTTWLVALCQAIDLRHIEENLKNTV  391

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCS  YPLMQKLR V
Sbjct  392  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQV  451

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      QN++TSI QKI AFE+ELK  LPKE+E AR + ENGNPAIPN+IT  R
Sbjct  452  LVDHALMNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRR  511

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE  DKVFTA+C G +IDP    L  W+GAPLPL
Sbjct  512  SYPLYKFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPL  570



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLE+NLK  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+ YADDPCS  YPL+QKLR V
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LPKE+E AR+ ++NG  AIPN+I +CR
Sbjct  606  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGTE+LTGEKV SPGE  DKVFTA+CEG IIDP++ECLN W+GAP+P+
Sbjct  666  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPI  724



>sp|P19142.1|PAL2_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 2; AltName: Full=Phenylalanine 
ammonia-lyase class II [Phaseolus vulgaris]
 prf||1807329A Phe ammonia lyase
Length=712

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTNEALEILKLMSSTFLVALCQAIDLRHLEENLKNTV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KN VSQVAKRTLT G+NGELHPSRFCEK LL+VV+REY FAY DDPCS  YPLMQKLR V
Sbjct  533  KNVVSQVAKRTLTTGVNGELHPSRFCEKALLKVVEREYTFAYIDDPCSGTYPLMQKLRQV  592

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D+AL N        TSI QKIA+FE+ELK  LPKE+EGAR  +EN   AIPNKI  CR
Sbjct  593  LVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE CDKVF+A+C+G IIDPLLECL  W+GAPLP+
Sbjct  653  SYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPI  711



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 207/239 (87%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLE+NLK+AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCS NYPLM+KLR V
Sbjct  535  KNTVSHVSKRILTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSANYPLMKKLRQV  594

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TS+ QKI AFE+ELK  LPKE+E AR+ +++GN AI NKI +CR
Sbjct  595  LVDHALANGENEKNASTSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIENKIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+C+G IIDP+LECL  W+GAPLP+
Sbjct  655  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPI  713



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYL ALCQAIDLRHLE+NL++ V
Sbjct  481  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLAALCQAIDLRHLEENLRSTV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQ+AK+ LT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCS  YPLMQKLR V
Sbjct  541  KNTVSQIAKKVLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKIAAFE+ELK  LPKE+E AR+  ENGN AIPNKI +CR
Sbjct  601  LVEHALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            S+PLYKFVREELGT +LTGE V SPGE  DKVFTA+C+G IIDP+LECL  W+GAPLP+
Sbjct  661  SFPLYKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGRIIDPMLECLEEWNGAPLPI  719



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 199/239 (83%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +L +MS+T+LVALCQAIDLRH+E+NLKN V
Sbjct  343  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILNVMSTTWLVALCQAIDLRHIEENLKNTV  402

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCS  YPLMQKLR V
Sbjct  403  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQV  462

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      QN++TSI QKI AFE+ELK  LPKE+E AR + ENGNPAIPN+IT  R
Sbjct  463  LVDHALMNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRR  522

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV SPGE  DKVFTA+C G +IDP    L  W+GAPLPL
Sbjct  523  SYPLYKFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPL  581



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   378 bits (970),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   378 bits (970),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LK+MSSTYLVALCQAIDLRHLE+NLK+ V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKIMSSTYLVALCQAIDLRHLEENLKSVV  540

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAY DDPCS NYPLMQKLR V
Sbjct  541  KNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYVDDPCSSNYPLMQKLRQV  600

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+D A++N        +SI QKI AFEDEL   LPKE+E  R+  E+GNP I N+IT+CR
Sbjct  601  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPLIRNRITECR  660

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+ VREELGTE+LTGEKVRSPGE  DKVFTA+C G IIDPLLECL  W+GAPLP+
Sbjct  661  SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKRWNGAPLPI  719



>pir||A24727 phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney bean  (fragment)
 gb|AAA33770.1| phenylalanine ammonia-lyase (EC 4.3.1.5), partial [Phaseolus 
vulgaris]
 prf||1111326A ammonia lyase,Phe
Length=505

 Score =   371 bits (953),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSL LISARKT+E++ +LKLMSST+L+ LCQAIDLRHLE+NLK++V
Sbjct  266  TSHVQSAEQHNQDVNSLDLISARKTNESIEILKLMSSTFLMGLCQAIDLRHLEENLKSSV  325

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDP S  YPLMQKLR V
Sbjct  326  KNTVSQVSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPYSGTYPLMQKLRQV  385

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK  LPKE+E  R+ +E+G  AIPNKI +CR
Sbjct  386  LVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECR  445

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  446  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPI  504



>gb|AEJ88223.1| phenylalanine ammonia lyase [Prunus persica]
Length=719

 Score =   378 bits (970),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRHLE+NLK+ V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTV  539

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K+TVSQVAKR LT+G NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLRHV
Sbjct  540  KSTVSQVAKRVLTVGFNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHV  599

Query  366  LLDHALQN------AATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N      ++TSI QKI AFE+ELK  LPKE+E AR +++NG  A PN+I  CR
Sbjct  600  LVEHALNNGEKEKSSSTSIFQKITAFEEELKTLLPKEVESARLEYDNGKSATPNRIKDCR  659

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTG+KVRSPGE  DKVF A+C G  IDPLL+CL  W+GAPLP+
Sbjct  660  SYPLYKFVREELGTALLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPI  718



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   378 bits (970),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLE+NLK+ V
Sbjct  485  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  544

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQ+AKR LT G+NGELHPSRFCEKDLL VV+REY+FAY DDPCS  YPLMQ+LR V
Sbjct  545  KNTVSQLAKRLLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQV  604

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA TSI QKI+AFE+ELK  LPKE+E AR+  E+GN AIPN+I +CR
Sbjct  605  LVEHALTNGENEKNANTSIFQKISAFEEELKTILPKEVESARAACESGNAAIPNRIIECR  664

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG E LTGEKVRSPGE CDKVFTA+C+G IIDP+L+CL+ W+G PLP+
Sbjct  665  SYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGKIIDPILDCLSGWNGEPLPI  723



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   377 bits (969),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   377 bits (969),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLE+NL+ AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLIALCQAIDLRHLEENLRLAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAYADDPCS+NYPLMQKLR V
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TSI QKI AFE+ELK  LPKE+EGAR   E G   I N+I +CR
Sbjct  592  LVDHALNNGDKEKNASTSIFQKIQAFEEELKAVLPKEVEGARLAVEGGKEVIGNRIKECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REE+GTE LTGEKV SPGE CDKVF A+  G ++DPL +CL +W+GAPLP+
Sbjct  652  SYPLYKFIREEVGTEFLTGEKVTSPGEECDKVFKALTNGLMVDPLFKCLEAWNGAPLPI  710



>gb|AIZ76770.1| PAL2, partial [Pyrus pyrifolia]
Length=368

 Score =   366 bits (940),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 196/226 (87%), Gaps = 6/226 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  142  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  201

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  202  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  261

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  262  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  321

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLL  67
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L
Sbjct  322  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPIL  367



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   368 bits (945),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 200/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV +CQAIDLRHLE+NLK  V
Sbjct  184  TTHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVGICQAIDLRHLEENLKQTV  243

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+ YADDPCS  YPL+QKLR V
Sbjct  244  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  303

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LP E+E AR  ++NG  AIPN+I +CR
Sbjct  304  IVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECR  363

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGTE+LTGEK  SPGE  DKVFTA+CEG IIDPL+ECL+ W+GAP+P+
Sbjct  364  SYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPI  422



>sp|P07218.2|PAL1_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 1; AltName: Full=Phenylalanine 
ammonia-lyase class I, partial [Phaseolus 
vulgaris]
Length=506

 Score =   371 bits (952),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSL LISARKT+E++ +LKLMSST+L+ LCQAIDLRHLE+NLK++V
Sbjct  267  TSHVQSAEQHNQDVNSLDLISARKTNESIEILKLMSSTFLMGLCQAIDLRHLEENLKSSV  326

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDP S  YPLMQKLR V
Sbjct  327  KNTVSQVSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPYSGTYPLMQKLRQV  386

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FE+ELK  LPKE+E  R+ +E+G  AIPNKI +CR
Sbjct  387  LVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECR  446

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  447  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPI  505



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/237 (74%), Positives = 205/237 (86%), Gaps = 6/237 (3%)
 Frame = -2

Query  720  HVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAVKN  541
            HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSSTYL+ALCQAIDLRHLE+NLK+ V +
Sbjct  477  HVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTYLIALCQAIDLRHLEENLKSTVNS  536

Query  540  TVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHVLL  361
            TVSQVAKRTLT G+NGELH SRFCE+DLL+VVDRE+VF Y DDP S  YPLMQKLR VL+
Sbjct  537  TVSQVAKRTLTTGVNGELHSSRFCERDLLKVVDREHVFTYIDDPTSATYPLMQKLRQVLV  596

Query  360  DHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCRSY  199
            DHAL+      N++TSI QKIAAFE+ELK  LPKE+E AR+ +ENGN ++PNKI +CRSY
Sbjct  597  DHALENGDNEKNSSTSIFQKIAAFEEELKTLLPKEVERARTAYENGNSSVPNKIKECRSY  656

Query  198  PLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            PLYKFVRE+LG  +LTGEK RSPGE CDKVFTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  657  PLYKFVREDLGAGLLTGEKTRSPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI  713



>gb|AIZ76768.1| PAL2, partial [Pyrus pyrifolia]
Length=367

 Score =   366 bits (940),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 196/226 (87%), Gaps = 6/226 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLE+NL+N V
Sbjct  141  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  200

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  201  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  260

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA+TSI QKI AFE+ELK  LPKE+E ARS  E+GN A+PN+I +CR
Sbjct  261  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  320

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLL  67
            SYPLYKFVREELG E LTGEKVRSPGE CDKVF A+C+G IIDP+L
Sbjct  321  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPIL  366



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 203/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQA+DLRH+E+NLKN V
Sbjct  470  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAVDLRHMEENLKNTV  529

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VV+REYVFAY DDPCS  YPLMQKLR V
Sbjct  530  KNTVSQVAKRVLTMGSNGELHPSRFCEKDLLKVVNREYVFAYIDDPCSATYPLMQKLRQV  589

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       +TSI QKI AFE+ELK  LPKE+EGAR + ENG  AIPN I +CR
Sbjct  590  LVEHALNNGDKETNLSTSIFQKIGAFEEELKTLLPKEVEGARIEIENGKAAIPNPIKECR  649

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGT +LTGE++RSPGE  DKVF+A+C G +IDPLL+CL  W+GAPLP+
Sbjct  650  SYPLYRFVREELGTSLLTGERIRSPGEEFDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  708



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLV LCQAIDLRHLE+NL+  V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVGLCQAIDLRHLEENLRTTV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS VAKR LTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLM+KLR V
Sbjct  535  KNTVSLVAKRVLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMEKLRQV  594

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E  R+  E+GN  I N+I  CR
Sbjct  595  LVEHALKNEVSEKNVSTSIFQKIGAFEEELKALLPKEVESTRALIESGNGGIANRIKDCR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGTE+LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL SW+G+PLP+
Sbjct  655  SYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLTSWNGSPLPI  713



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   378 bits (970),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 173/239 (72%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLE+NL+  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+ YADDPCS  YPL+QKLR V
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LPKE+E AR+ ++NG  AIPN+I +CR
Sbjct  606  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGTE+LTGEKV SPGE  DKVFTA+CEG IIDP++ECLN W+GAP+P+
Sbjct  666  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPI  724



>prf||2006271A Phe ammonia lyase
Length=725

 Score =   378 bits (970),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  486  TTHVQSAEQHNQDVNSLGLISSRKTKEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLT+G++GELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPL QKLR V
Sbjct  546  KNTVSQVAKKTLTIGVSGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLAQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKIA FE+ELK  LPKE+E AR+ +ENGN  I NKI  CR
Sbjct  606  LVDHALVNGESEKNSNTSIFQKIATFEEELKTLLPKEVESARTAYENGNSTIANKINGCR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDK+FTA+C+G IIDPLL+CL  W+GAPLP+
Sbjct  666  SYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNGAPLPI  724



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   377 bits (969),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  486  TTHVQSAEQHNQDVNSLGLISSRKTKEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLT+G++GELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPL QKLR V
Sbjct  546  KNTVSQVAKKTLTIGVSGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLAQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N+ TSI QKIA FE+ELK  LPKE+E AR+ +ENGN  I NKI  CR
Sbjct  606  LVDHALVNGESEKNSNTSIFQKIATFEEELKTLLPKEVESARTAYENGNSTIANKINGCR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDK+FTA+C+G IIDPLL+CL  W+GAPLP+
Sbjct  666  SYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNGAPLPI  724



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   377 bits (969),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 200/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMSST+LVALCQAIDLRHLE+NLKN V
Sbjct  479  TTHVQSAEQHNQDVNSLGLISSRKTSESIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  538

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLT G+NGELHPSRFCEKDL +VVDREYVFAY DDPC   YP+MQ LR V
Sbjct  539  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLPKVVDREYVFAYIDDPCLATYPMMQNLRQV  598

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL NA       TSI QKIA FEDELK  LPKE+E  R  +ENG  AIPNKI +CR
Sbjct  599  LVDHALANAEAEKNVNTSIFQKIATFEDELKALLPKEVENTRVAYENGQWAIPNKIKECR  658

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVR ELGTE+LTGEKV SPGE  DK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  659  SYPLYKFVRGELGTELLTGEKVISPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  717



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   377 bits (969),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLE+NL++AV
Sbjct  475  TSHVQSAEQHNQNVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLRSAV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCS  YPLMQKLR V
Sbjct  535  KNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQV  594

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TS+ QKIA FE+ELK  LPKE+E AR+ +++GN AI NKI +CR
Sbjct  595  LVDHALANGENEKNASTSVFQKIATFEEELKALLPKEVESARAAYDSGNSAIENKIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+C+G IIDP+LECL  W+GAPLP+
Sbjct  655  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPI  713



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   377 bits (969),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/239 (72%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLE+NL+  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+ YADDPCS  YPL+QKLR V
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LPKE+E AR+ ++NG  AIPN+I +CR
Sbjct  606  IVDHALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGTE+LTGEKV SPGE  DKVFTA+CEG IIDP++ECLN W+GAP+P+
Sbjct  666  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPI  724



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   377 bits (969),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTV  546

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G+NGELHPSRFCEKDLL+VVDREYV+AY DDPCS  YPLMQ LR V
Sbjct  547  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQV  606

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKIAAFE+ELK  LPKE+E AR+ +ENGN AI NKIT+CR
Sbjct  607  LVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECR  666

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVRE+LGT +LTGEKVRSPGE  DKV+TA+C+G +IDP+L CL+ W+G PLP+
Sbjct  667  SYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLACLSGWNGEPLPI  725



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   377 bits (968),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NL+ AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLRQAV  534

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCS  YPLMQKLR +
Sbjct  535  KNTVSQVAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQI  594

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +NA TS+ QKI+AFE+ELK  LPKE+E  R  +E+GNPA  N+I +CR
Sbjct  595  LVEHALANGENEKNAGTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATANRIKECR  654

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTG+KV SPGE  DKVFTA+C+G IIDP+++CL  W+GAPLP+
Sbjct  655  SYPLYKFVREELGTGLLTGDKVMSPGEEFDKVFTAMCQGKIIDPMMDCLKEWNGAPLPI  713



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   377 bits (968),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>dbj|BAF36976.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=732

 Score =   377 bits (969),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+LVALCQAIDLRHLE+NLK+ V
Sbjct  493  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLVALCQAIDLRHLEENLKHTV  552

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTV+QVAKRTLT G+NGELHPSRFCEKDLL VVDRE VFAY DDPCS  YPLMQKLR  
Sbjct  553  KNTVNQVAKRTLTTGVNGELHPSRFCEKDLLTVVDREDVFAYIDDPCSGTYPLMQKLRQS  612

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+NA       TSI QKIA FEDELK  LPKE+E AR  ++NG  AIPNKI +CR
Sbjct  613  LVDHALENADAEKNVNTSIFQKIAIFEDELKAILPKEVESARVAYDNGESAIPNKIKECR  672

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DK+FTA+C+G IIDP+LECL  W+GAPLP+
Sbjct  673  SYPLYKFVREELGTGLLTGEKVKSPGEDFDKLFTAMCQGKIIDPILECLGEWNGAPLPI  731



>gb|AAY82486.1| phenylalanine ammonia-lyase [Ulmus pumila]
Length=622

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMS+T+LVALCQAIDLRHLE+NLK+ V
Sbjct  383  TNHVQSAEQHNQDVNSLGLISSRKTEEAVEILKLMSTTFLVALCQAIDLRHLEENLKSTV  442

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLR V
Sbjct  443  KNTVSQVAKKVLTTGANGELHPSRFCEKDLLKVVDREYVFSYIDDPCSSIYPLMQKLRQV  502

Query  366  LLDHALQNAA------TSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL N        TSI QKI AFE+ELK  LPKE+E +R + ENGNPAIP+KI  CR
Sbjct  503  LVDHALNNGEKETNPNTSIFQKIVAFEEELKTLLPKEVESSRVELENGNPAIPDKIKGCR  562

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            S+PLYKFVREEL T +LTGEKV+SPGE  DKVF A+C G +IDPLLECL  WDGAPLP+
Sbjct  563  SFPLYKFVREELRTGLLTGEKVKSPGEEFDKVFPAICAGKLIDPLLECLKEWDGAPLPI  621



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLE+NLK AV
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTVEAMDILKLMSSTYLVALCQAIDLRHLEENLKLAV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  531  KNTVSQVAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLMQKLRQV  590

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N       +TSI  KI AFE+ELK  LPKE+E AR   E+G PA+ N+I +CR
Sbjct  591  LVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+RE LGT  LTGEK  SPGE CDKVFTA+C+G I+DPLLECL  W+G PLP+
Sbjct  651  SYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPI  709



>gb|AAZ29732.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=724

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  485  TTHVQSAEQHNQDVNSLGLISSRKTKEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  544

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLT+G+NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPL QKLR V
Sbjct  545  KNTVSQVAKKTLTIGVNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLSQKLRQV  604

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N+ TSI QKIA FE+ELK  LPKE+E AR+ +E+GN  I NKI  CR
Sbjct  605  LVEHALVNGESEKNSNTSIFQKIATFEEELKTLLPKEVESARTAYESGNSTIANKINGCR  664

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDK+FTA+C+G IIDPLLECL  W+GAPLP+
Sbjct  665  SYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  723



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 200/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+L+AL QAIDLRHLE+NLKN V
Sbjct  484  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLIALSQAIDLRHLEENLKNTV  543

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT+G NGELHPSRFCEKDLL++VDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  544  KNTVSQVAKRVLTIGFNGELHPSRFCEKDLLKIVDREHVFAYIDDPCSSTYPLMQKLRQV  603

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N++TSI QKI AFEDELK  LPKE+E  R D+ENGN AI N+I  CR
Sbjct  604  LVEHALINGEREKNSSTSIFQKIVAFEDELKALLPKEVESTRIDYENGNSAISNRIKDCR  663

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELG   LTGEK  SPGE CDKVFTA+C G +IDPLL+CL  W+GAPLP+
Sbjct  664  SYPLYKFVREELGASFLTGEKTTSPGEECDKVFTAMCAGKLIDPLLDCLKEWNGAPLPI  722



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  468  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  527

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEK LL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  528  KKTVSHVAKKTLTTGANGELHPSRFCEKXLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  587

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  588  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECR  647

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  648  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  706



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   377 bits (967),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E+V +LKLMS+T+LVALCQAIDLRH+E+NL+  V
Sbjct  482  TSHVQSAEQHNQDVNSLGLISSRKTQESVDILKLMSTTFLVALCQAIDLRHMEENLRQTV  541

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  542  KNTVSQVAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI QKI+AFE ELK  LPKE+E AR+ +E+GN  IPN+I +CR
Sbjct  602  IVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECR  661

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREE GT +LTG+KVRSPGE  DKVFTA+C+G IIDPL++CL  W+GAPLP+
Sbjct  662  SYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPI  720



>ref|XP_010516949.1| PREDICTED: phenylalanine ammonia-lyase 1 [Camelina sativa]
Length=727

 Score =   377 bits (967),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLE+NL+  V
Sbjct  488  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  547

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+ YADDPCS  YPL+QKLR V
Sbjct  548  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  607

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LPKE+E AR+ ++NG  AIPN+I +CR
Sbjct  608  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  667

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREE+GTE+LTGEKV SPGE  DKVFTA+CEG IIDP++ECLN W+GAP+P+
Sbjct  668  SYPLYRFVREEIGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPI  726



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQKLR V
Sbjct  531  KKTVSHVAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+ PN+I +CR
Sbjct  591  LVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGAVESGNPSTPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>ref|XP_003591877.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES62128.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=722

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV + KLMSST+LVALCQAIDLRH+E+N K+ V
Sbjct  483  TTHVQSAEQHNQDVNSLGLISARKTAEAVEIWKLMSSTFLVALCQAIDLRHIEENFKSVV  542

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT+G+NGELHPSRFCEKDLL VV+ EYVF Y DDPCS  YPLMQKLR+V
Sbjct  543  KNTVSQVAKRILTVGVNGELHPSRFCEKDLLNVVEGEYVFTYIDDPCSPIYPLMQKLRYV  602

Query  366  LLDHALQ------NAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHALQ      N++TSI QKI AFE+ELK  LPKE+E AR + ENGNPA+PN I +CR
Sbjct  603  LVDHALQNGDKEANSSTSIFQKIGAFEEELKALLPKEVENARVEIENGNPAVPNMIKECR  662

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+RE LGT +LTGEK+RSPGE CDKVFTA+C+G  IDP+L+CL  W+G PLP+
Sbjct  663  SYPLYKFMRETLGTSLLTGEKIRSPGEDCDKVFTAMCDGRFIDPMLDCLKEWNGVPLPI  721



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 204/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT E+V +LKLMS+T+LVALCQAIDLRH+E+NL+  V
Sbjct  482  TSHVQSAEQHNQDVNSLGLISSRKTQESVDILKLMSTTFLVALCQAIDLRHMEENLRQTV  541

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS  YPLMQKLR V
Sbjct  542  KNTVSQVAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI QKI+AFE ELK  LPKE+E AR+ +E+GN  IPN+I +CR
Sbjct  602  IVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECR  661

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREE GT +LTG+KVRSPGE  DKVFTA+C+G IIDPL++CL  W+GAPLP+
Sbjct  662  SYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPI  720



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  447  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  506

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQ +R V
Sbjct  507  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQNVRQV  566

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  567  LVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  626

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKVRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  627  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  685



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 199/239 (83%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQA+DLRHLE+NLK AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAVDLRHLEENLKQAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDL+ VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLISVVDREYVFAYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL+N       +TSI  KI AFE+ELK  LPKE+E AR   E GNPAI N+I++CR
Sbjct  592  LVDHALKNGETEKNVSTSIFHKIEAFEEELKALLPKEVESARIALEGGNPAIANRISECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+REELG   LTGEK  SPGE CD+VFTA+  G I+DPLL CL  W+GAPLP+
Sbjct  652  SYPLYKFIREELGASFLTGEKTTSPGEECDRVFTALSNGLIVDPLLNCLQGWNGAPLPI  710



>ref|XP_010935894.1| PREDICTED: phenylalanine ammonia-lyase [Elaeis guineensis]
Length=712

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 201/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLE+NLKN V
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSSTYLVALCQAIDLRHLEENLKNTV  532

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTV+QVAKR LT+G NGELHPSRFCEKDL++V+DREYVFAY DDPCS  YPLMQKLR V
Sbjct  533  KNTVTQVAKRVLTIGANGELHPSRFCEKDLIKVIDREYVFAYIDDPCSFTYPLMQKLRQV  592

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL N       ++SI QKI+ FE+ELK  LPKE+EGAR  FENGN AI N+I +CR
Sbjct  593  LVEHALNNGEKEKDPSSSIFQKISVFEEELKTLLPKEVEGARVAFENGNSAIANRIKECR  652

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVR+EL    LTGEKVRSPGE  +KVF A+CEG +IDPLLECL  W+GAPLP+
Sbjct  653  SYPLYRFVRDELDAGFLTGEKVRSPGEEFNKVFNAICEGKVIDPLLECLKDWNGAPLPI  711



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/240 (74%), Positives = 201/240 (84%), Gaps = 6/240 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS++YLVALCQ+IDLRHLE+N+++ V
Sbjct  474  TNHVQSAEQHNQDVNSLGLISARKTSEAVEILKLMSTSYLVALCQSIDLRHLEENMRSTV  533

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  534  KNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLREV  593

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +N +TSI QKI AFEDELK  LPKE+EG R+ +E+G  AIPN+I  CR
Sbjct  594  LVDHALNNGETEKNTSTSIFQKIGAFEDELKAILPKEVEGVRTSYEDGTLAIPNRIKACR  653

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPLI  25
            SYPLY+FVREELGT  LTGEKV SPGE  DK FT +C+G IIDPLLEC+  W+G PLP+ 
Sbjct  654  SYPLYRFVREELGTGFLTGEKVTSPGEEFDKGFTPMCKGQIIDPLLECVEGWNGVPLPIF  713



>gb|ABF50788.1| phenylalanine ammonia-lyase [Isatis tinctoria]
Length=725

 Score =   376 bits (966),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLE+NLK  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE V+AYADDPCS  YPL+QKLR V
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYAYADDPCSATYPLIQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            ++DHAL      +NA TSI  KI AFE+ELK  LPKE++ AR+ +ENG  AIPN+I +CR
Sbjct  606  IVDHALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVDAARAAYENGTSAIPNRIKECR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLY+FVREELGT++LTG++V SPGE  DKVFTA+CEG IIDP++ECLN W+GAP+P+
Sbjct  666  SYPLYRFVREELGTQLLTGDRVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPI  724



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   376 bits (965),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 200/239 (84%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLE+NLK+ V
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  536

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVS VAKR LTMG+NGELHPSRFCEKDLLR VDREY+FAY DDPCS  YPLMQKLR  
Sbjct  537  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRFVDREYIFAYIDDPCSATYPLMQKLRQT  596

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL+N        TSI QKIA FEDELK  LPKE+E AR+  E+GNPAIPN+I +CR
Sbjct  597  LVEHALKNGDNERNMNTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  656

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVR+ELG E LTGEKV SPGE  DKVF A+ +G IIDPLLECL SW+GAPLP+
Sbjct  657  SYPLYKFVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGEIIDPLLECLESWNGAPLPI  715



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   375 bits (964),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLE+NLK+ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCS  YPLMQK+R V
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N +TSI QKI AFE+ELK  LPKE+E AR   E+GNP+IPN+I +CR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE VRSPGE  DKVFTA+CEG IIDPLL+CL++W+GAPLP+
Sbjct  651  SYPLYKFVREELGTGLLTGETVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI  709



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   375 bits (964),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLE+NLK+AV
Sbjct  476  TTHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  536  KNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQV  595

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
             +DHAL+N       +TS+ QKI AFE+ELK  LPKE+E AR+ +++GN AI NKI +CR
Sbjct  596  FVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C+G IIDP+LECL  W+G+PLP+
Sbjct  656  SYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPI  714



>gb|AAZ29734.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   376 bits (965),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 206/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLE+NLKN+V
Sbjct  486  TTHVQSAEQHNQDVNSLGLISSRKTKEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  545

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAK+TLT+G+NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCS  YPL QKLR V
Sbjct  546  KNTVSQVAKKTLTVGVNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLSQKLRQV  605

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL      +N+ TSI QKIA FE+ELK  LPKE+E AR+ +E+GN  I NKI  CR
Sbjct  606  LVEHALVNGESEKNSNTSIFQKIATFEEELKTLLPKEVESARTAYESGNSTIANKINGCR  665

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGE+V SPGE CDK+FTA+C+G IIDPLLECL  W+G+PLP+
Sbjct  666  SYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGSPLPI  724



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   375 bits (962),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+E+NLKN V
Sbjct  443  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKNTV  502

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKR LTMG NGELHPSR CEKDLL++VD+E+VFAY DDPCS  YPLMQKLR V
Sbjct  503  KNTVSQVAKRVLTMGFNGELHPSRLCEKDLLKLVDKEHVFAYIDDPCSATYPLMQKLRQV  562

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L++HAL       N+ TSI QKI +FE+ELK  LPKE+E AR + ENGNP +PN+I +CR
Sbjct  563  LVEHALVNGERETNSTTSIFQKIRSFEEELKTLLPKEVESARLEVENGNPVVPNRIKECR  622

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C G ++DPLLECL  W+GAPLP+
Sbjct  623  SYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLPI  681



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLE+NLK+AV
Sbjct  476  TTHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAV  535

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  536  KNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQV  595

Query  366  LLDHALQNA------ATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
             +DHAL+N       +TS+ QKI AFE+ELK  LPKE+E AR+ +++GN AI NKI +CR
Sbjct  596  FVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECR  655

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKFVREELGT +LTGEKV+SPGE  DKVFTA+C+G IIDP+LECL  W+G+PLP+
Sbjct  656  SYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPI  714



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 202/239 (85%), Gaps = 6/239 (3%)
 Frame = -2

Query  726  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEDNLKNAV  547
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRHLE+NLK+AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHLEENLKHAV  531

Query  546  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYADDPCSDNYPLMQKLRHV  367
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLMQKLR V
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQV  591

Query  366  LLDHAL------QNAATSILQKIAAFEDELKEFLPKEMEGARSDFENGNPAIPNKITQCR  205
            L+DHAL      +NA+TSI QKI AFE+ELK  LPKE+E AR   E+G+P + N+I +CR
Sbjct  592  LVDHALKNGDLEKNASTSIFQKIEAFEEELKALLPKEVESARMALESGSPTVANRIAECR  651

Query  204  SYPLYKFVREELGTEMLTGEKVRSPGEVCDKVFTAVCEGGIIDPLLECLNSWDGAPLPL  28
            SYPLYKF+RE+LG   LTGEK  SPGE C+KVFTA+  G IIDPLLECL  W+G PLP+
Sbjct  652  SYPLYKFIREQLGAGFLTGEKAVSPGEECEKVFTALSNGLIIDPLLECLQGWNGQPLPI  710



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455