BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047K18

Length=125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630454.1|  PREDICTED: probable phosphoribosylformylglyc...  69.3    5e-12   Nicotiana tomentosiformis
ref|XP_009788513.1|  PREDICTED: probable phosphoribosylformylglyc...  67.8    2e-11   Nicotiana sylvestris
gb|EYU19934.1|  hypothetical protein MIMGU_mgv1a000220mg              62.8    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_004233026.1|  PREDICTED: probable phosphoribosylformylglyc...  61.6    2e-09   Solanum lycopersicum
ref|XP_006362398.1|  PREDICTED: probable phosphoribosylformylglyc...  61.2    3e-09   Solanum tuberosum [potatoes]
ref|XP_010242666.1|  PREDICTED: probable phosphoribosylformylglyc...  61.2    4e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010027660.1|  PREDICTED: probable phosphoribosylformylglyc...  59.7    1e-08   Eucalyptus grandis [rose gum]
emb|CDP12877.1|  unnamed protein product                              59.7    1e-08   Coffea canephora [robusta coffee]
ref|XP_007027277.1|  Purine biosynthesis 4                            59.3    2e-08   
gb|KJB62495.1|  hypothetical protein B456_009G419700                  59.3    2e-08   Gossypium raimondii
ref|XP_006486399.1|  PREDICTED: probable phosphoribosylformylglyc...  58.9    2e-08   
ref|XP_007135941.1|  hypothetical protein PHAVU_009G004700g           58.9    2e-08   Phaseolus vulgaris [French bean]
gb|KHG19255.1|  hypothetical protein F383_23948                       58.5    3e-08   Gossypium arboreum [tree cotton]
ref|XP_004301174.1|  PREDICTED: probable phosphoribosylformylglyc...  58.2    4e-08   Fragaria vesca subsp. vesca
ref|XP_008337483.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...  58.2    4e-08   
ref|XP_008352301.1|  PREDICTED: probable phosphoribosylformylglyc...  58.2    4e-08   
ref|XP_009371082.1|  PREDICTED: probable phosphoribosylformylglyc...  58.2    4e-08   
ref|XP_009371080.1|  PREDICTED: probable phosphoribosylformylglyc...  58.2    5e-08   
ref|XP_009371075.1|  PREDICTED: probable phosphoribosylformylglyc...  57.8    5e-08   Pyrus x bretschneideri [bai li]
ref|XP_010668487.1|  PREDICTED: probable phosphoribosylformylglyc...  57.8    5e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007200335.1|  hypothetical protein PRUPE_ppa000243mg           57.4    7e-08   Prunus persica
ref|XP_008237658.1|  PREDICTED: probable phosphoribosylformylglyc...  57.4    7e-08   
ref|XP_002533184.1|  Phosphoribosylformylglycinamidine synthase, ...  57.4    7e-08   
gb|KDO69155.1|  hypothetical protein CISIN_1g000572mg                 57.4    7e-08   Citrus sinensis [apfelsine]
ref|XP_006300588.1|  hypothetical protein CARUB_v10019663mg           57.0    1e-07   Capsella rubella
ref|XP_007225512.1|  hypothetical protein PRUPE_ppa000246mg           56.6    1e-07   Prunus persica
ref|XP_007163437.1|  hypothetical protein PHAVU_001G234500g           56.6    2e-07   Phaseolus vulgaris [French bean]
ref|XP_006435635.1|  hypothetical protein CICLE_v10030516mg           56.2    2e-07   Citrus clementina [clementine]
gb|KFK41873.1|  hypothetical protein AALP_AA2G182400                  56.2    2e-07   Arabis alpina [alpine rockcress]
ref|XP_002888969.1|  hypothetical protein ARALYDRAFT_476563           56.2    2e-07   Arabidopsis lyrata subsp. lyrata
gb|AAG52403.1|AC020579_5  putative phosphoribosylformylglycinamid...  56.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ABW87767.1|  phosphoribosylformylglycinamidine synthase            56.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177566.3|  phosphoribosylformylglycinamidine synthase          56.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373601.1|  PREDICTED: probable phosphoribosylformylglyc...  55.8    2e-07   Pyrus x bretschneideri [bai li]
gb|KDP44919.1|  hypothetical protein JCGZ_01419                       55.8    2e-07   Jatropha curcas
gb|EPS62326.1|  hypothetical protein M569_12463                       55.8    2e-07   Genlisea aurea
ref|XP_002524208.1|  Phosphoribosylformylglycinamidine synthase, ...  55.8    3e-07   Ricinus communis
ref|XP_002312111.2|  hypothetical protein POPTR_0008s05880g           55.5    3e-07   Populus trichocarpa [western balsam poplar]
gb|KDO69154.1|  hypothetical protein CISIN_1g000572mg                 55.5    3e-07   Citrus sinensis [apfelsine]
ref|XP_010912732.1|  PREDICTED: probable phosphoribosylformylglyc...  55.5    3e-07   Elaeis guineensis
gb|AAL55431.1|  formylglycinamide ribonucleotide amidotransferase     55.5    4e-07   Vigna unguiculata
ref|XP_004503568.1|  PREDICTED: probable phosphoribosylformylglyc...  55.5    4e-07   Cicer arietinum [garbanzo]
ref|XP_008219161.1|  PREDICTED: probable phosphoribosylformylglyc...  55.5    4e-07   Prunus mume [ume]
emb|CDX68192.1|  BnaA07g22320D                                        55.1    4e-07   
ref|XP_009104771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...  55.1    4e-07   Brassica rapa
ref|XP_011085040.1|  PREDICTED: probable phosphoribosylformylglyc...  55.1    4e-07   Sesamum indicum [beniseed]
emb|CBI31638.3|  unnamed protein product                              52.8    5e-07   Vitis vinifera
ref|XP_010471513.1|  PREDICTED: probable phosphoribosylformylglyc...  55.1    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010099731.1|  putative phosphoribosylformylglycinamidine s...  55.1    5e-07   
ref|XP_009106086.1|  PREDICTED: probable phosphoribosylformylglyc...  54.7    6e-07   Brassica rapa
emb|CDX96528.1|  BnaA07g31390D                                        54.7    6e-07   
gb|KEH21294.1|  phosphoribosylformylglycinamidine synthase            54.7    7e-07   Medicago truncatula
gb|KEH24969.1|  phosphoribosylformylglycinamidine synthase            54.7    7e-07   Medicago truncatula
ref|XP_010658537.1|  PREDICTED: probable phosphoribosylformylglyc...  54.3    9e-07   Vitis vinifera
ref|XP_002315209.2|  phosphoribosylformylglycinamidine synthase f...  54.3    9e-07   
ref|XP_003538419.1|  PREDICTED: probable phosphoribosylformylglyc...  54.3    9e-07   
gb|AAO23951.1|  phosphoribosylformylglycinamidine synthase            53.9    1e-06   Glycine max [soybeans]
ref|XP_010428408.1|  PREDICTED: probable phosphoribosylformylglyc...  53.5    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006390444.1|  hypothetical protein EUTSA_v10018011mg           53.5    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_008454828.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...  53.5    2e-06   Cucumis melo [Oriental melon]
ref|XP_010416277.1|  PREDICTED: probable phosphoribosylformylglyc...  53.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004170044.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...  52.8    3e-06   
ref|XP_010543774.1|  PREDICTED: probable phosphoribosylformylglyc...  52.8    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_004148187.1|  PREDICTED: probable phosphoribosylformylglyc...  52.4    3e-06   Cucumis sativus [cucumbers]
ref|XP_008788295.1|  PREDICTED: probable phosphoribosylformylglyc...  52.0    5e-06   Phoenix dactylifera
gb|KHN07581.1|  Putative phosphoribosylformylglycinamidine syntha...  52.0    5e-06   Glycine soja [wild soybean]
ref|XP_011002631.1|  PREDICTED: probable phosphoribosylformylglyc...  52.0    5e-06   Populus euphratica
gb|AAO23952.1|  FGAM synthase                                         52.0    5e-06   Glycine max [soybeans]
ref|XP_008781955.1|  PREDICTED: probable phosphoribosylformylglyc...  50.8    1e-05   Phoenix dactylifera
ref|XP_010908309.1|  PREDICTED: probable phosphoribosylformylglyc...  50.8    1e-05   
ref|XP_010474334.1|  PREDICTED: probable phosphoribosylformylglyc...  48.1    1e-05   
ref|XP_006845743.1|  hypothetical protein AMTR_s00019p00246290        50.1    2e-05   Amborella trichopoda
ref|XP_009420338.1|  PREDICTED: probable phosphoribosylformylglyc...  50.1    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX85818.1|  BnaC06g23160D                                        50.1    3e-05   



>ref|XP_009630454.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630455.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630456.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630457.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630458.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
Length=1407

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGLNSD+SSEK +VLKWVLG TYEPENLG+ESFL  +K K
Sbjct  125  NIGLNSDISSEKLSVLKWVLGETYEPENLGSESFLDEEKRK  165



>ref|XP_009788513.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana sylvestris]
Length=1407

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGLNSD+SSEK  VLKWVLG TYEPENLG+ESFL  +K K
Sbjct  124  NIGLNSDISSEKLFVLKWVLGETYEPENLGSESFLDEEKRK  164



>gb|EYU19934.1| hypothetical protein MIMGU_mgv1a000220mg [Erythranthe guttata]
Length=1414

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHID  115
            NIGL+ DL +EK AVLKW+LG TYEP+NLGTESFL  D
Sbjct  128  NIGLDGDLPNEKLAVLKWLLGETYEPDNLGTESFLDAD  165



>ref|XP_004233026.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Solanum lycopersicum]
 ref|XP_010316815.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Solanum lycopersicum]
Length=1410

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+GL SDLSS+K +VLKW+LG TYEPE+LG+ESFL  ++ K
Sbjct  128  NVGLKSDLSSDKFSVLKWLLGETYEPESLGSESFLEREQRK  168



>ref|XP_006362398.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X1 [Solanum tuberosum]
 ref|XP_006362399.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X2 [Solanum tuberosum]
Length=1410

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL SDLSS+K +VLKW+LG TYEPE+LG+ESFL
Sbjct  128  NIGLKSDLSSDKFSVLKWLLGETYEPESLGSESFL  162



>ref|XP_010242666.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nelumbo nucifera]
 ref|XP_010242667.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nelumbo nucifera]
Length=1412

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL+S+LSSEK  VLKW+L  TYEP+NLGTESFL+ ++ +
Sbjct  127  NIGLHSELSSEKLGVLKWILQETYEPDNLGTESFLNKERQE  167



>ref|XP_010027660.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Eucalyptus grandis]
 gb|KCW54226.1| hypothetical protein EUGRSUZ_I00206 [Eucalyptus grandis]
Length=1417

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL S LSSEK +VLKW+L  TYEPENLGTESFL
Sbjct  129  NIGLESRLSSEKLSVLKWLLQETYEPENLGTESFL  163



>emb|CDP12877.1| unnamed protein product [Coffea canephora]
Length=1410

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GLNS LSSEK + L+WVLG TYEPENLG +SFL
Sbjct  130  NVGLNSRLSSEKLSALQWVLGETYEPENLGAQSFL  164



>ref|XP_007027277.1| Purine biosynthesis 4 [Theobroma cacao]
 gb|EOY07779.1| Purine biosynthesis 4 [Theobroma cacao]
Length=1412

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL+S++SSEK + LKW+LG TYEPENL TES L   + K
Sbjct  130  NIGLDSNISSEKLSTLKWILGETYEPENLATESLLEKKRQK  170



>gb|KJB62495.1| hypothetical protein B456_009G419700 [Gossypium raimondii]
Length=1412

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL S +SSEK + LKW+LG TYEPENL TESFL
Sbjct  130  NIGLASKISSEKFSTLKWILGETYEPENLATESFL  164



>ref|XP_006486399.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X1 [Citrus sinensis]
 ref|XP_006486400.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X2 [Citrus sinensis]
 ref|XP_006486401.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X3 [Citrus sinensis]
Length=1414

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL+S +S+EK  VLKW+L  TYEPENLGTESFL   K K
Sbjct  132  NIGLDSRISTEKLEVLKWLLQETYEPENLGTESFLEKKKQK  172



>ref|XP_007135941.1| hypothetical protein PHAVU_009G004700g [Phaseolus vulgaris]
 gb|ESW07935.1| hypothetical protein PHAVU_009G004700g [Phaseolus vulgaris]
Length=1409

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSSEK  VLKW+L  T+EPENLGTESFL
Sbjct  127  NIGLSSQLSSEKFPVLKWLLQETFEPENLGTESFL  161



>gb|KHG19255.1| hypothetical protein F383_23948 [Gossypium arboreum]
Length=1353

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL S +SSEK + LKW+LG TYEPENL TESFL
Sbjct  132  NIGLASKISSEKLSTLKWILGETYEPENLATESFL  166



>ref|XP_004301174.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Fragaria vesca subsp. vesca]
Length=1412

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSSEK AVLKW+L  TYEPENLG +SFL
Sbjct  126  NIGLSSQLSSEKVAVLKWLLQETYEPENLGVDSFL  160



>ref|XP_008337483.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial [Malus domestica]
Length=1413

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSS+K  VLKW+L  TYEPENLGTESFL
Sbjct  131  NIGLDSXLSSDKVLVLKWLLQETYEPENLGTESFL  165



>ref|XP_008352301.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Malus domestica]
 ref|XP_008352302.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Malus domestica]
Length=1412

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSS+K  VLKW+L  TYEPENLGTESFL
Sbjct  130  NIGLDSXLSSDKVLVLKWLLQETYEPENLGTESFL  164



>ref|XP_009371082.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=1365

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSS+K  VLKW+L  TYEPENLGTESFL
Sbjct  130  NIGLDSPLSSDKVLVLKWLLQETYEPENLGTESFL  164



>ref|XP_009371080.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial isoform X1 [Pyrus x bretschneideri]
 ref|XP_009371081.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial isoform X1 [Pyrus x bretschneideri]
 ref|XP_009371085.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
 ref|XP_009371087.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
Length=1412

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSS+K  VLKW+L  TYEPENLGTESFL
Sbjct  130  NIGLDSPLSSDKVLVLKWLLQETYEPENLGTESFL  164



>ref|XP_009371075.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
Length=1412

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSS+K  VLKW+L  TYEPENLGTESFL
Sbjct  130  NIGLDSPLSSDKVLVLKWLLQETYEPENLGTESFL  164



>ref|XP_010668487.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris]
 ref|XP_010668494.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris]
Length=1412

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDK  118
            NIGL++++SSEK  VLKW+LG TYEPE LGTESF  IDK
Sbjct  130  NIGLDAEVSSEKLLVLKWLLGETYEPEKLGTESF--IDK  166



>ref|XP_007200335.1| hypothetical protein PRUPE_ppa000243mg [Prunus persica]
 gb|EMJ01534.1| hypothetical protein PRUPE_ppa000243mg [Prunus persica]
Length=1412

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSS+K  VLKW+L  T+EPENLGTESFL
Sbjct  130  NIGLDSQLSSDKLPVLKWLLQETFEPENLGTESFL  164



>ref|XP_008237658.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Prunus mume]
Length=1400

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+S LSS+K  VLKW+L  T+EPENLGTESFL
Sbjct  118  NIGLDSQLSSDKLPVLKWLLQETFEPENLGTESFL  152



>ref|XP_002533184.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
 gb|EEF29198.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
Length=1355

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+GL S++SSEK  VL+W+L  T+EPENLGTESFL   K +
Sbjct  131  NVGLQSEISSEKLGVLRWLLQETFEPENLGTESFLEKKKKE  171



>gb|KDO69155.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
 gb|KDO69156.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
 gb|KDO69157.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
 gb|KDO69158.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
Length=1414

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL+S +S++K  VLKW+L  TYEPENLGTESFL   K K
Sbjct  132  NIGLDSRISTKKLEVLKWLLQETYEPENLGTESFLEKKKQK  172



>ref|XP_006300588.1| hypothetical protein CARUB_v10019663mg [Capsella rubella]
 gb|EOA33486.1| hypothetical protein CARUB_v10019663mg [Capsella rubella]
Length=1407

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S+L  EK +VLKW+L  TYEPENLGT+SFL   K +
Sbjct  126  NIGLESELKDEKLSVLKWILQETYEPENLGTDSFLERKKQE  166



>ref|XP_007225512.1| hypothetical protein PRUPE_ppa000246mg [Prunus persica]
 gb|EMJ26711.1| hypothetical protein PRUPE_ppa000246mg [Prunus persica]
Length=1410

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL+  LSSEK +VLKW+L  TYEPENLG ESFL   K +
Sbjct  128  NIGLDLQLSSEKLSVLKWLLQETYEPENLGAESFLEKKKQE  168



>ref|XP_007163437.1| hypothetical protein PHAVU_001G234500g [Phaseolus vulgaris]
 gb|ESW35431.1| hypothetical protein PHAVU_001G234500g [Phaseolus vulgaris]
Length=1402

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GL+S LSSEK +VLKW+L  T+EPENLG ESFL
Sbjct  120  NVGLSSQLSSEKISVLKWLLEETFEPENLGNESFL  154



>ref|XP_006435635.1| hypothetical protein CICLE_v10030516mg [Citrus clementina]
 gb|ESR48875.1| hypothetical protein CICLE_v10030516mg [Citrus clementina]
Length=1414

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL+S + +EK  VLKW+L  TYEPENLGTESFL   K K
Sbjct  132  NIGLDSRILTEKLEVLKWLLQETYEPENLGTESFLEKKKQK  172



>gb|KFK41873.1| hypothetical protein AALP_AA2G182400 [Arabis alpina]
Length=1402

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S+L +EK  VLKW+L  TYEPENLGT+SFL   K +
Sbjct  122  NIGLESELENEKVLVLKWILQETYEPENLGTDSFLEKKKQE  162



>ref|XP_002888969.1| hypothetical protein ARALYDRAFT_476563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65228.1| hypothetical protein ARALYDRAFT_476563 [Arabidopsis lyrata subsp. 
lyrata]
Length=1410

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S L  EK +VLKW+L  TYEPENLGT+SFL   K +
Sbjct  129  NIGLESKLKDEKLSVLKWILQETYEPENLGTDSFLERKKQE  169



>gb|AAG52403.1|AC020579_5 putative phosphoribosylformylglycinamidine synthase; 25509-29950 
[Arabidopsis thaliana]
Length=1387

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S L  EK +VLKW+L  TYEPENLGT+SFL   K +
Sbjct  106  NIGLESKLKDEKLSVLKWILQETYEPENLGTDSFLERKKQE  146



>gb|ABW87767.1| phosphoribosylformylglycinamidine synthase [Arabidopsis thaliana]
Length=1387

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S L  EK +VLKW+L  TYEPENLGT+SFL   K +
Sbjct  106  NIGLESKLKDEKLSVLKWILQETYEPENLGTDSFLERKKQE  146



>ref|NP_177566.3| phosphoribosylformylglycinamidine synthase [Arabidopsis thaliana]
 sp|Q9M8D3.3|PUR4_ARATH RecName: Full=Probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial; Short=FGAM synthase; Short=FGAMS; 
AltName: Full=Formylglycinamide ribonucleotide amidotransferase; 
Short=FGAR amidotransferase; Short=FGAR-AT; AltName: 
Full=Formylglycinamide ribotide amidotransferase; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE35571.1| phosphoribosylformylglycinamidine synthase [Arabidopsis thaliana]
Length=1407

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S L  EK +VLKW+L  TYEPENLGT+SFL   K +
Sbjct  126  NIGLESKLKDEKLSVLKWILQETYEPENLGTDSFLERKKQE  166



>ref|XP_009373601.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
 ref|XP_009373602.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
 ref|XP_009373603.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
Length=1414

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +2

Query  2    NIGLNSD--LSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+SD  LSS+K  VLKW+L  TYEPENLGTESFL
Sbjct  130  NIGLDSDSPLSSDKVLVLKWLLQETYEPENLGTESFL  166



>gb|KDP44919.1| hypothetical protein JCGZ_01419 [Jatropha curcas]
Length=1413

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +2

Query  2    NIGLNSDLSSEKH-AVLKWVLGXTYEPENLGTESFLHIDK  118
            NIGL S++SSEK   VLKW+L  TYEPEN GTESFL   K
Sbjct  130  NIGLQSEISSEKKLGVLKWILQETYEPENFGTESFLEKKK  169



>gb|EPS62326.1| hypothetical protein M569_12463, partial [Genlisea aurea]
Length=1337

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+G++ DLS +K +VLKW+LG TYEP+NLG +SFL
Sbjct  52   NVGVSGDLSDDKQSVLKWLLGETYEPDNLGAKSFL  86



>ref|XP_002524208.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
 gb|EEF38132.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
Length=1414

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+GL S++SSEK   L+W+L  TYEPENLGTESFL   K +
Sbjct  132  NVGLQSEISSEKLGDLRWLLQETYEPENLGTESFLEKKKKE  172



>ref|XP_002312111.2| hypothetical protein POPTR_0008s05880g [Populus trichocarpa]
 gb|EEE89478.2| hypothetical protein POPTR_0008s05880g [Populus trichocarpa]
Length=1452

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIG+ S +SS+K  VL+W+L  TYEPENLGTESFL
Sbjct  170  NIGIRSGISSQKLGVLRWLLQETYEPENLGTESFL  204



>gb|KDO69154.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
Length=1057

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL+S +S++K  VLKW+L  TYEPENLGTESFL   K K
Sbjct  132  NIGLDSRISTKKLEVLKWLLQETYEPENLGTESFLEKKKQK  172



>ref|XP_010912732.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Elaeis guineensis]
Length=1413

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIG+N+ LSSEK ++L+W+L  TYEPENL TESFL
Sbjct  128  NIGVNAVLSSEKLSILRWLLQETYEPENLNTESFL  162



>gb|AAL55431.1| formylglycinamide ribonucleotide amidotransferase [Vigna unguiculata]
Length=1289

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GL+S LSSE  +VLKW+L  T+EPENLG ESFL
Sbjct  7    NVGLSSQLSSENFSVLKWLLQETFEPENLGNESFL  41



>ref|XP_004503568.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like [Cicer arietinum]
Length=1407

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+G+ S LSS K +VLKW+L  T+EPENLGTESFL
Sbjct  125  NVGIGSQLSSRKISVLKWLLSETFEPENLGTESFL  159



>ref|XP_008219161.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Prunus mume]
Length=1410

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDK  118
            NIGL+  LSSEK +VLKW+L  TYEPEN G ESFL   K
Sbjct  128  NIGLDLQLSSEKLSVLKWLLQETYEPENFGAESFLEKKK  166



>emb|CDX68192.1| BnaA07g22320D [Brassica napus]
Length=1384

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL ++L+ EK +VLKW+L  T+EPENLGT+SFL   K +
Sbjct  120  NIGLETELAQEKLSVLKWILQETFEPENLGTDSFLERKKKQ  160



>ref|XP_009104771.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial [Brassica 
rapa]
Length=1404

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL ++L+ EK +VLKW+L  T+EPENLGT+SFL   K +
Sbjct  120  NIGLETELAQEKLSVLKWILQETFEPENLGTDSFLERKKKQ  160



>ref|XP_011085040.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Sesamum indicum]
Length=1411

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIG++ D+ SEK +VL+W+LG TYEP+NLGT SFL
Sbjct  125  NIGVDGDIPSEKLSVLRWLLGETYEPDNLGTVSFL  159



>emb|CBI31638.3| unnamed protein product [Vitis vinifera]
Length=212

 Score = 52.8 bits (125),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL   LS +K  VLKW+L  TYEPENLGTESFL
Sbjct  128  NIGLEGGLSGQKLLVLKWLLQETYEPENLGTESFL  162



>ref|XP_010471513.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Camelina sativa]
Length=1407

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S+L  EK +VLKW+L  T+EPENLG ESFL   K +
Sbjct  126  NIGLESELKDEKVSVLKWILQETFEPENLGAESFLERKKQE  166



>ref|XP_010099731.1| putative phosphoribosylformylglycinamidine synthase [Morus notabilis]
 gb|EXB80308.1| putative phosphoribosylformylglycinamidine synthase [Morus notabilis]
Length=1413

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL S+LS +K +VLKW+L  TYEPENLG ESFL
Sbjct  122  NIGLESELSDQKVSVLKWLLQETYEPENLGFESFL  156



>ref|XP_009106086.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Brassica rapa]
Length=1398

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDK  118
            NIGL ++L+ EK +VLKW+L  T+EPENLGT+SFL   K
Sbjct  119  NIGLETELAEEKVSVLKWILQETFEPENLGTDSFLERKK  157



>emb|CDX96528.1| BnaA07g31390D [Brassica napus]
Length=1379

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDK  118
            NIGL ++L+ EK +VLKW+L  T+EPENLGT+SFL   K
Sbjct  119  NIGLETELAEEKVSVLKWILQETFEPENLGTDSFLERKK  157



>gb|KEH21294.1| phosphoribosylformylglycinamidine synthase [Medicago truncatula]
Length=1410

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GL S LSS K +VL+W+L  T+EPENLGTESFL
Sbjct  128  NVGLGSHLSSGKLSVLRWLLSETFEPENLGTESFL  162



>gb|KEH24969.1| phosphoribosylformylglycinamidine synthase [Medicago truncatula]
Length=1410

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GL S LSS K +VL+W+L  T+EPENLGTESFL
Sbjct  128  NVGLGSHLSSGKLSVLRWLLSETFEPENLGTESFL  162



>ref|XP_010658537.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Vitis vinifera]
Length=1412

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL   LS +K  VLKW+L  TYEPENLGTESFL
Sbjct  128  NIGLEGGLSGQKLLVLKWLLQETYEPENLGTESFL  162



>ref|XP_002315209.2| phosphoribosylformylglycinamidine synthase family protein [Populus 
trichocarpa]
 gb|EEF01380.2| phosphoribosylformylglycinamidine synthase family protein [Populus 
trichocarpa]
Length=1413

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIG+ S +SS+K   L+W+L  TYEPENLGTESFL   KTK
Sbjct  131  NIGIQSGVSSQKLGCLRWLLQETYEPENLGTESFLE-KKTK  170



>ref|XP_003538419.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X1 [Glycine max]
 ref|XP_006591348.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X2 [Glycine max]
 gb|KHN17907.1| Putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Glycine soja]
Length=1410

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+GL+S LS  K +VL+W+L  T+EPENLGTESFL   K +
Sbjct  128  NVGLSSQLSGGKFSVLRWLLQETFEPENLGTESFLEKKKKE  168



>gb|AAO23951.1| phosphoribosylformylglycinamidine synthase [Glycine max]
Length=1313

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+GL+S LS  K +VL+W+L  T+EPENLGTESFL   K +
Sbjct  31   NVGLSSQLSGGKFSVLRWLLQETFEPENLGTESFLEKKKKE  71



>ref|XP_010428408.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Camelina sativa]
Length=1407

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S+L  EK +VLKW+L  T+EPENLG +SFL   K +
Sbjct  126  NIGLESELKDEKVSVLKWILQETFEPENLGADSFLEKKKQE  166



>ref|XP_006390444.1| hypothetical protein EUTSA_v10018011mg [Eutrema salsugineum]
 gb|ESQ27730.1| hypothetical protein EUTSA_v10018011mg [Eutrema salsugineum]
Length=1407

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S+L  EK  VLKW+L  T+EPENLGT+SF+   K +
Sbjct  127  NIGLESELEDEKLLVLKWILQETFEPENLGTDSFIERKKQE  167



>ref|XP_008454828.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial [Cucumis 
melo]
Length=1413

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+G+ S++S++K +VL+W+L  TYEPEN GTESFL
Sbjct  128  NVGIQSEISNDKLSVLRWLLQETYEPENFGTESFL  162



>ref|XP_010416277.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Camelina sativa]
Length=1407

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S+L  EK +VLKW+L  T+EPENLG +SFL   K +
Sbjct  126  NIGLESELKDEKVSVLKWILQETFEPENLGADSFLERKKQE  166



>ref|XP_004170044.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial-like [Cucumis 
sativus]
Length=1413

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+G+ S++S++K  VL+W+L  TYEPEN GTESFL   + K
Sbjct  128  NVGIQSEISNDKLFVLRWLLQETYEPENFGTESFLEKKQRK  168



>ref|XP_010543774.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Tarenaya hassleriana]
Length=1414

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL S++  +K  VL+W+L  TYEPENLGT+SFL  +KTK
Sbjct  129  NIGLESEIQGDKLMVLQWLLQETYEPENLGTDSFL--EKTK  167



>ref|XP_004148187.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like [Cucumis sativus]
Length=1413

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+G+ S++S++K  VL+W+L  TYEPEN GTESFL   + K
Sbjct  128  NVGIQSEISNDKLFVLRWLLQETYEPENFGTESFLEKKQRK  168



>ref|XP_008788295.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Phoenix dactylifera]
 ref|XP_008788296.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Phoenix dactylifera]
Length=1417

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL   LS +K A+LKW+L  TYEPENL TESFL
Sbjct  132  NIGLTGVLSGDKLAILKWLLQETYEPENLQTESFL  166



>gb|KHN07581.1| Putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Glycine soja]
Length=1425

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GL+S LS  K +VL W+L  T+EPENLGTESFL
Sbjct  128  NVGLSSQLSGGKFSVLGWLLQETFEPENLGTESFL  162



>ref|XP_011002631.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Populus euphratica]
 ref|XP_011002632.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Populus euphratica]
Length=1413

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIG+ S +SS+K   L+W+L  TYEPENLG ESFL   KTK
Sbjct  131  NIGIQSGVSSQKLGCLRWLLQETYEPENLGIESFLE-KKTK  170



>gb|AAO23952.1| FGAM synthase [Glycine max]
Length=1044

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GL+S LS  K +VL W+L  T+EPENLGTESFL
Sbjct  31   NVGLSSQLSGGKFSVLGWLLQETFEPENLGTESFL  65



>ref|XP_008781955.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Phoenix dactylifera]
Length=1413

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIG+N  LSSEK  +LKW+L  TYEPENL   SFL
Sbjct  128  NIGVNVVLSSEKLRILKWILQETYEPENLNAHSFL  162



>ref|XP_010908309.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Elaeis guineensis]
Length=1420

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            NIGL+  LS +K  +LKW+L  TYEPENL TESFL
Sbjct  135  NIGLSGVLSGDKLTILKWLLQETYEPENLKTESFL  169



>ref|XP_010474334.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Camelina sativa]
Length=181

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGT  94
            NIGL S+L  EK +VLKW+L  T+EPENLGT
Sbjct  126  NIGLESELKDEKVSVLKWILQETFEPENLGT  156



>ref|XP_006845743.1| hypothetical protein AMTR_s00019p00246290 [Amborella trichopoda]
 gb|ERN07418.1| hypothetical protein AMTR_s00019p00246290 [Amborella trichopoda]
Length=1412

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFL  106
            N+GL+S LS +K  +LKW+L  TYEPENL  ESFL
Sbjct  125  NVGLSSPLSDDKLDILKWLLQETYEPENLKNESFL  159



>ref|XP_009420338.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Musa acuminata subsp. malaccensis]
Length=1421

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NIGLNSDLSSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            N+GLN  LS E+  +LKW+L  T+EPENL  ESFL  + +K
Sbjct  136  NVGLNGMLSGEQLRILKWLLQETFEPENLQAESFLEKEASK  176



>emb|CDX85818.1| BnaC06g23160D [Brassica napus]
Length=1382

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    NIGLNSDL-SSEKHAVLKWVLGXTYEPENLGTESFLHIDKTK  124
            NIGL ++L   EK +VLKW+L  T+EPENLGT+SFL   K +
Sbjct  118  NIGLETELPEEEKLSVLKWILQETFEPENLGTDSFLERKKQQ  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562529751290